data_4IXP # _entry.id 4IXP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4IXP RCSB RCSB077340 WWPDB D_1000077340 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4IXP _pdbx_database_status.recvd_initial_deposition_date 2013-01-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cao, L.S.' 1 'Wang, J.' 2 'Wang, Z.X.' 3 'Wu, J.W.' 4 # _citation.id primary _citation.title 'Structural basis for the regulation of maternal embryonic leucine zipper kinase.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 8 _citation.page_first e70031 _citation.page_last e70031 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23922895 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0070031 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cao, L.S.' 1 primary 'Wang, J.' 2 primary 'Chen, Y.' 3 primary 'Deng, H.' 4 primary 'Wang, Z.X.' 5 primary 'Wu, J.W.' 6 # _cell.entry_id 4IXP _cell.length_a 135.449 _cell.length_b 135.449 _cell.length_c 153.652 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4IXP _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Maternal embryonic leucine zipper kinase' 40423.844 1 '2.7.11.1, 2.7.10.2' 'K40R, D150A' N-terminal ? 2 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hMELK, Protein kinase Eg3, pEg3 kinase, Protein kinase PK38, hPK38, Tyrosine-protein kinase MELK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIRIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETAN KIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIAFGLCAKPKGN KDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLL QQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLL LAKKARGKPVRLRLSSFSCGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIRIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETAN KIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIAFGLCAKPKGN KDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLL QQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLL LAKKARGKPVRLRLSSFSCGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ASP n 1 4 TYR n 1 5 ASP n 1 6 GLU n 1 7 LEU n 1 8 LEU n 1 9 LYS n 1 10 TYR n 1 11 TYR n 1 12 GLU n 1 13 LEU n 1 14 HIS n 1 15 GLU n 1 16 THR n 1 17 ILE n 1 18 GLY n 1 19 THR n 1 20 GLY n 1 21 GLY n 1 22 PHE n 1 23 ALA n 1 24 LYS n 1 25 VAL n 1 26 LYS n 1 27 LEU n 1 28 ALA n 1 29 CYS n 1 30 HIS n 1 31 ILE n 1 32 LEU n 1 33 THR n 1 34 GLY n 1 35 GLU n 1 36 MET n 1 37 VAL n 1 38 ALA n 1 39 ILE n 1 40 ARG n 1 41 ILE n 1 42 MET n 1 43 ASP n 1 44 LYS n 1 45 ASN n 1 46 THR n 1 47 LEU n 1 48 GLY n 1 49 SER n 1 50 ASP n 1 51 LEU n 1 52 PRO n 1 53 ARG n 1 54 ILE n 1 55 LYS n 1 56 THR n 1 57 GLU n 1 58 ILE n 1 59 GLU n 1 60 ALA n 1 61 LEU n 1 62 LYS n 1 63 ASN n 1 64 LEU n 1 65 ARG n 1 66 HIS n 1 67 GLN n 1 68 HIS n 1 69 ILE n 1 70 CYS n 1 71 GLN n 1 72 LEU n 1 73 TYR n 1 74 HIS n 1 75 VAL n 1 76 LEU n 1 77 GLU n 1 78 THR n 1 79 ALA n 1 80 ASN n 1 81 LYS n 1 82 ILE n 1 83 PHE n 1 84 MET n 1 85 VAL n 1 86 LEU n 1 87 GLU n 1 88 TYR n 1 89 CYS n 1 90 PRO n 1 91 GLY n 1 92 GLY n 1 93 GLU n 1 94 LEU n 1 95 PHE n 1 96 ASP n 1 97 TYR n 1 98 ILE n 1 99 ILE n 1 100 SER n 1 101 GLN n 1 102 ASP n 1 103 ARG n 1 104 LEU n 1 105 SER n 1 106 GLU n 1 107 GLU n 1 108 GLU n 1 109 THR n 1 110 ARG n 1 111 VAL n 1 112 VAL n 1 113 PHE n 1 114 ARG n 1 115 GLN n 1 116 ILE n 1 117 VAL n 1 118 SER n 1 119 ALA n 1 120 VAL n 1 121 ALA n 1 122 TYR n 1 123 VAL n 1 124 HIS n 1 125 SER n 1 126 GLN n 1 127 GLY n 1 128 TYR n 1 129 ALA n 1 130 HIS n 1 131 ARG n 1 132 ASP n 1 133 LEU n 1 134 LYS n 1 135 PRO n 1 136 GLU n 1 137 ASN n 1 138 LEU n 1 139 LEU n 1 140 PHE n 1 141 ASP n 1 142 GLU n 1 143 TYR n 1 144 HIS n 1 145 LYS n 1 146 LEU n 1 147 LYS n 1 148 LEU n 1 149 ILE n 1 150 ALA n 1 151 PHE n 1 152 GLY n 1 153 LEU n 1 154 CYS n 1 155 ALA n 1 156 LYS n 1 157 PRO n 1 158 LYS n 1 159 GLY n 1 160 ASN n 1 161 LYS n 1 162 ASP n 1 163 TYR n 1 164 HIS n 1 165 LEU n 1 166 GLN n 1 167 THR n 1 168 CYS n 1 169 CYS n 1 170 GLY n 1 171 SER n 1 172 LEU n 1 173 ALA n 1 174 TYR n 1 175 ALA n 1 176 ALA n 1 177 PRO n 1 178 GLU n 1 179 LEU n 1 180 ILE n 1 181 GLN n 1 182 GLY n 1 183 LYS n 1 184 SER n 1 185 TYR n 1 186 LEU n 1 187 GLY n 1 188 SER n 1 189 GLU n 1 190 ALA n 1 191 ASP n 1 192 VAL n 1 193 TRP n 1 194 SER n 1 195 MET n 1 196 GLY n 1 197 ILE n 1 198 LEU n 1 199 LEU n 1 200 TYR n 1 201 VAL n 1 202 LEU n 1 203 MET n 1 204 CYS n 1 205 GLY n 1 206 PHE n 1 207 LEU n 1 208 PRO n 1 209 PHE n 1 210 ASP n 1 211 ASP n 1 212 ASP n 1 213 ASN n 1 214 VAL n 1 215 MET n 1 216 ALA n 1 217 LEU n 1 218 TYR n 1 219 LYS n 1 220 LYS n 1 221 ILE n 1 222 MET n 1 223 ARG n 1 224 GLY n 1 225 LYS n 1 226 TYR n 1 227 ASP n 1 228 VAL n 1 229 PRO n 1 230 LYS n 1 231 TRP n 1 232 LEU n 1 233 SER n 1 234 PRO n 1 235 SER n 1 236 SER n 1 237 ILE n 1 238 LEU n 1 239 LEU n 1 240 LEU n 1 241 GLN n 1 242 GLN n 1 243 MET n 1 244 LEU n 1 245 GLN n 1 246 VAL n 1 247 ASP n 1 248 PRO n 1 249 LYS n 1 250 LYS n 1 251 ARG n 1 252 ILE n 1 253 SER n 1 254 MET n 1 255 LYS n 1 256 ASN n 1 257 LEU n 1 258 LEU n 1 259 ASN n 1 260 HIS n 1 261 PRO n 1 262 TRP n 1 263 ILE n 1 264 MET n 1 265 GLN n 1 266 ASP n 1 267 TYR n 1 268 ASN n 1 269 TYR n 1 270 PRO n 1 271 VAL n 1 272 GLU n 1 273 TRP n 1 274 GLN n 1 275 SER n 1 276 LYS n 1 277 ASN n 1 278 PRO n 1 279 PHE n 1 280 ILE n 1 281 HIS n 1 282 LEU n 1 283 ASP n 1 284 ASP n 1 285 ASP n 1 286 CYS n 1 287 VAL n 1 288 THR n 1 289 GLU n 1 290 LEU n 1 291 SER n 1 292 VAL n 1 293 HIS n 1 294 HIS n 1 295 ARG n 1 296 ASN n 1 297 ASN n 1 298 ARG n 1 299 GLN n 1 300 THR n 1 301 MET n 1 302 GLU n 1 303 ASP n 1 304 LEU n 1 305 ILE n 1 306 SER n 1 307 LEU n 1 308 TRP n 1 309 GLN n 1 310 TYR n 1 311 ASP n 1 312 HIS n 1 313 LEU n 1 314 THR n 1 315 ALA n 1 316 THR n 1 317 TYR n 1 318 LEU n 1 319 LEU n 1 320 LEU n 1 321 LEU n 1 322 ALA n 1 323 LYS n 1 324 LYS n 1 325 ALA n 1 326 ARG n 1 327 GLY n 1 328 LYS n 1 329 PRO n 1 330 VAL n 1 331 ARG n 1 332 LEU n 1 333 ARG n 1 334 LEU n 1 335 SER n 1 336 SER n 1 337 PHE n 1 338 SER n 1 339 CYS n 1 340 GLY n 1 341 LEU n 1 342 GLU n 1 343 HIS n 1 344 HIS n 1 345 HIS n 1 346 HIS n 1 347 HIS n 1 348 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MELK, KIAA0175' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MELK_HUMAN _struct_ref.pdbx_db_accession Q14680 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETAN KIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGN KDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLL QQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLL LAKKARGKPVRLRLSSFSCG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4IXP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 340 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14680 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 340 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4IXP ARG A 40 ? UNP Q14680 LYS 40 'engineered mutation' 40 1 1 4IXP ALA A 150 ? UNP Q14680 ASP 150 'engineered mutation' 150 2 1 4IXP LEU A 341 ? UNP Q14680 ? ? 'EXPRESSION TAG' 341 3 1 4IXP GLU A 342 ? UNP Q14680 ? ? 'EXPRESSION TAG' 342 4 1 4IXP HIS A 343 ? UNP Q14680 ? ? 'EXPRESSION TAG' 343 5 1 4IXP HIS A 344 ? UNP Q14680 ? ? 'EXPRESSION TAG' 344 6 1 4IXP HIS A 345 ? UNP Q14680 ? ? 'EXPRESSION TAG' 345 7 1 4IXP HIS A 346 ? UNP Q14680 ? ? 'EXPRESSION TAG' 346 8 1 4IXP HIS A 347 ? UNP Q14680 ? ? 'EXPRESSION TAG' 347 9 1 4IXP HIS A 348 ? UNP Q14680 ? ? 'EXPRESSION TAG' 348 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4IXP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 5.03 _exptl_crystal.density_percent_sol 75.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '0.1 M Sodium Cacodylate, 0.7M Sodium Acetate, 2% PEG 400, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.details ? _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-05-26 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97915 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.pdbx_synchrotron_site SSRF _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97915 # _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.limit_k_max ? _reflns.d_resolution_high 2.749 _reflns.observed_criterion_F_min ? _reflns.pdbx_netI_over_sigmaI 30.0 _reflns.observed_criterion_F_max ? _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.limit_l_max ? _reflns.limit_k_min ? _reflns.entry_id 4IXP _reflns.B_iso_Wilson_estimate 60.54 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rsym_value ? _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.limit_l_min ? _reflns.limit_h_min ? _reflns.R_free_details ? _reflns.number_all 22247 _reflns.d_resolution_low 50.00 _reflns.pdbx_redundancy 7.0 _reflns.number_obs 22247 _reflns.limit_h_max ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.749 _reflns_shell.d_res_low 2.80 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.473 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.6 _reflns_shell.pdbx_redundancy 7.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1076 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.ls_percent_reflns_R_free 5.11 _refine.overall_SU_B ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_R_Free_selection_details RANDOM _refine.overall_FOM_free_R_set ? _refine.pdbx_data_cutoff_low_absF ? _refine.entry_id 4IXP _refine.aniso_B[2][3] -0.0000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_ML 0.42 _refine.aniso_B[1][3] 0.0000 _refine.pdbx_stereochemistry_target_values ML _refine.aniso_B[3][3] -15.9808 _refine.solvent_model_param_ksol 0.343 _refine.ls_number_restraints ? _refine.aniso_B[1][1] 7.9904 _refine.pdbx_overall_ESU_R ? _refine.ls_R_factor_obs 0.2035 _refine.occupancy_min ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_starting_model 'PDB ENTRY 3FE3' _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.occupancy_max ? _refine.pdbx_solvent_shrinkage_radii 0.98 _refine.correlation_coeff_Fo_to_Fc ? _refine.ls_number_reflns_R_free 1134 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_ls_sigma_F 1.34 _refine.ls_percent_reflns_obs 99.87 _refine.ls_R_factor_R_work 0.2019 _refine.overall_SU_R_free ? _refine.ls_d_res_high 2.749 _refine.pdbx_overall_ESU_R_Free ? _refine.B_iso_min ? _refine.pdbx_ls_cross_valid_method ? _refine.B_iso_mean ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.ls_R_factor_all 0.2019 _refine.aniso_B[2][2] 7.9904 _refine.B_iso_max ? _refine.pdbx_ls_sigma_I ? _refine.ls_d_res_low 34.847 _refine.pdbx_overall_phase_error 25.01 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.aniso_B[1][2] -0.0000 _refine.ls_R_factor_R_free 0.2323 _refine.ls_R_factor_R_free_error ? _refine.ls_number_reflns_obs 22206 _refine.overall_FOM_work_R_set ? _refine.ls_number_parameters ? _refine.details ? _refine.ls_number_reflns_all 22206 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.solvent_model_param_bsol 55.650 _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2719 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 2758 _refine_hist.d_res_high 2.749 _refine_hist.d_res_low 34.847 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.008 ? ? 2785 ? 'X-RAY DIFFRACTION' f_angle_d 1.110 ? ? 3763 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 15.843 ? ? 1046 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.072 ? ? 414 ? 'X-RAY DIFFRACTION' f_plane_restr 0.006 ? ? 473 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.7494 2.8745 2569 0.3097 100.00 0.3873 . . 133 . . . . 'X-RAY DIFFRACTION' . 2.8745 3.0259 2564 0.2680 100.00 0.3561 . . 149 . . . . 'X-RAY DIFFRACTION' . 3.0259 3.2154 2576 0.2597 100.00 0.2928 . . 154 . . . . 'X-RAY DIFFRACTION' . 3.2154 3.4634 2604 0.2306 100.00 0.3073 . . 136 . . . . 'X-RAY DIFFRACTION' . 3.4634 3.8116 2609 0.2152 100.00 0.2323 . . 138 . . . . 'X-RAY DIFFRACTION' . 3.8116 4.3622 2642 0.1647 100.00 0.2022 . . 138 . . . . 'X-RAY DIFFRACTION' . 4.3622 5.4925 2663 0.1689 100.00 0.1934 . . 154 . . . . 'X-RAY DIFFRACTION' . 5.4925 34.8499 2845 0.1890 100.00 0.1885 . . 132 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4IXP _struct.title 'Crystal structure of Maternal Embryonic Leucine Zipper Kinase (MELK)' _struct.pdbx_descriptor 'Maternal embryonic leucine zipper kinase (E.C.2.7.11.1, 2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4IXP _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'protein kinase, regulated by phosphorylation, transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 3 ? LEU A 8 ? ASP A 3 LEU A 8 1 ? 6 HELX_P HELX_P2 2 LYS A 44 ? GLY A 48 ? LYS A 44 GLY A 48 1 ? 5 HELX_P HELX_P3 3 ASP A 50 ? LYS A 62 ? ASP A 50 LYS A 62 1 ? 13 HELX_P HELX_P4 4 LEU A 94 ? ILE A 99 ? LEU A 94 ILE A 99 1 ? 6 HELX_P HELX_P5 5 SER A 105 ? GLN A 126 ? SER A 105 GLN A 126 1 ? 22 HELX_P HELX_P6 6 LYS A 134 ? GLU A 136 ? LYS A 134 GLU A 136 5 ? 3 HELX_P HELX_P7 7 CYS A 168 ? ALA A 175 ? CYS A 168 ALA A 175 5 ? 8 HELX_P HELX_P8 8 ALA A 176 ? GLY A 182 ? ALA A 176 GLY A 182 1 ? 7 HELX_P HELX_P9 9 LEU A 186 ? GLY A 205 ? LEU A 186 GLY A 205 1 ? 20 HELX_P HELX_P10 10 ASN A 213 ? GLY A 224 ? ASN A 213 GLY A 224 1 ? 12 HELX_P HELX_P11 11 SER A 233 ? LEU A 244 ? SER A 233 LEU A 244 1 ? 12 HELX_P HELX_P12 12 ASP A 247 ? ARG A 251 ? ASP A 247 ARG A 251 5 ? 5 HELX_P HELX_P13 13 SER A 253 ? ASN A 259 ? SER A 253 ASN A 259 1 ? 7 HELX_P HELX_P14 14 HIS A 260 ? GLN A 265 ? HIS A 260 GLN A 265 1 ? 6 HELX_P HELX_P15 15 ASP A 283 ? ARG A 295 ? ASP A 283 ARG A 295 1 ? 13 HELX_P HELX_P16 16 ASN A 297 ? LEU A 307 ? ASN A 297 LEU A 307 1 ? 11 HELX_P HELX_P17 17 ASP A 311 ? ARG A 326 ? ASP A 311 ARG A 326 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 168 SG ? ? A CYS 154 A CYS 168 1_555 ? ? ? ? ? ? ? 2.027 ? disulf2 disulf ? ? A CYS 169 SG ? ? ? 1_555 A CYS 169 SG ? ? A CYS 169 A CYS 169 4_565 ? ? ? ? ? ? ? 2.041 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? GLY A 18 ? TYR A 11 GLY A 18 A 2 LYS A 24 ? HIS A 30 ? LYS A 24 HIS A 30 A 3 MET A 36 ? ASP A 43 ? MET A 36 ASP A 43 A 4 LYS A 81 ? GLU A 87 ? LYS A 81 GLU A 87 A 5 LEU A 72 ? GLU A 77 ? LEU A 72 GLU A 77 B 1 GLY A 92 ? GLU A 93 ? GLY A 92 GLU A 93 B 2 LEU A 138 ? PHE A 140 ? LEU A 138 PHE A 140 B 3 LEU A 146 ? LEU A 148 ? LEU A 146 LEU A 148 C 1 ALA A 155 ? LYS A 158 ? ALA A 155 LYS A 158 C 2 TYR A 163 ? GLN A 166 ? TYR A 163 GLN A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 12 ? N GLU A 12 O CYS A 29 ? O CYS A 29 A 2 3 N LYS A 24 ? N LYS A 24 O ILE A 41 ? O ILE A 41 A 3 4 N ARG A 40 ? N ARG A 40 O MET A 84 ? O MET A 84 A 4 5 O VAL A 85 ? O VAL A 85 N TYR A 73 ? N TYR A 73 B 1 2 N GLY A 92 ? N GLY A 92 O PHE A 140 ? O PHE A 140 B 2 3 N LEU A 139 ? N LEU A 139 O LYS A 147 ? O LYS A 147 C 1 2 N LYS A 156 ? N LYS A 156 O LEU A 165 ? O LEU A 165 # _database_PDB_matrix.entry_id 4IXP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4IXP _atom_sites.fract_transf_matrix[1][1] 0.007383 _atom_sites.fract_transf_matrix[1][2] 0.004262 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008525 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006508 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 TYR 174 174 174 TYR TYR A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 TRP 193 193 193 TRP TRP A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 MET 195 195 195 MET MET A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 MET 203 203 203 MET MET A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 MET 215 215 215 MET MET A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 TRP 231 231 231 TRP TRP A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 MET 243 243 243 MET MET A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 LYS 250 250 250 LYS LYS A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 SER 253 253 253 SER SER A . n A 1 254 MET 254 254 254 MET MET A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 ASN 256 256 256 ASN ASN A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 ASN 259 259 259 ASN ASN A . n A 1 260 HIS 260 260 260 HIS HIS A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 TRP 262 262 262 TRP TRP A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 MET 264 264 264 MET MET A . n A 1 265 GLN 265 265 265 GLN GLN A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 TYR 267 267 267 TYR TYR A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 TYR 269 269 269 TYR TYR A . n A 1 270 PRO 270 270 270 PRO PRO A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 TRP 273 273 273 TRP TRP A . n A 1 274 GLN 274 274 274 GLN GLN A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 LYS 276 276 276 LYS LYS A . n A 1 277 ASN 277 277 277 ASN ASN A . n A 1 278 PRO 278 278 278 PRO PRO A . n A 1 279 PHE 279 279 279 PHE PHE A . n A 1 280 ILE 280 280 280 ILE ILE A . n A 1 281 HIS 281 281 281 HIS HIS A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 ASP 284 284 284 ASP ASP A . n A 1 285 ASP 285 285 285 ASP ASP A . n A 1 286 CYS 286 286 286 CYS CYS A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 THR 288 288 288 THR THR A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 SER 291 291 291 SER SER A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 HIS 293 293 293 HIS HIS A . n A 1 294 HIS 294 294 294 HIS HIS A . n A 1 295 ARG 295 295 295 ARG ARG A . n A 1 296 ASN 296 296 296 ASN ASN A . n A 1 297 ASN 297 297 297 ASN ASN A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 GLN 299 299 299 GLN GLN A . n A 1 300 THR 300 300 300 THR THR A . n A 1 301 MET 301 301 301 MET MET A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 SER 306 306 306 SER SER A . n A 1 307 LEU 307 307 307 LEU LEU A . n A 1 308 TRP 308 308 308 TRP TRP A . n A 1 309 GLN 309 309 309 GLN GLN A . n A 1 310 TYR 310 310 310 TYR TYR A . n A 1 311 ASP 311 311 311 ASP ASP A . n A 1 312 HIS 312 312 312 HIS HIS A . n A 1 313 LEU 313 313 313 LEU LEU A . n A 1 314 THR 314 314 314 THR THR A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 THR 316 316 316 THR THR A . n A 1 317 TYR 317 317 317 TYR TYR A . n A 1 318 LEU 318 318 318 LEU LEU A . n A 1 319 LEU 319 319 319 LEU LEU A . n A 1 320 LEU 320 320 320 LEU LEU A . n A 1 321 LEU 321 321 321 LEU LEU A . n A 1 322 ALA 322 322 322 ALA ALA A . n A 1 323 LYS 323 323 323 LYS LYS A . n A 1 324 LYS 324 324 324 LYS LYS A . n A 1 325 ALA 325 325 325 ALA ALA A . n A 1 326 ARG 326 326 326 ARG ARG A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 LYS 328 328 328 LYS LYS A . n A 1 329 PRO 329 329 329 PRO PRO A . n A 1 330 VAL 330 330 330 VAL VAL A . n A 1 331 ARG 331 331 331 ARG ARG A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 ARG 333 333 333 ARG ARG A . n A 1 334 LEU 334 334 334 LEU LEU A . n A 1 335 SER 335 335 335 SER SER A . n A 1 336 SER 336 336 ? ? ? A . n A 1 337 PHE 337 337 ? ? ? A . n A 1 338 SER 338 338 ? ? ? A . n A 1 339 CYS 339 339 ? ? ? A . n A 1 340 GLY 340 340 ? ? ? A . n A 1 341 LEU 341 341 ? ? ? A . n A 1 342 GLU 342 342 ? ? ? A . n A 1 343 HIS 343 343 ? ? ? A . n A 1 344 HIS 344 344 ? ? ? A . n A 1 345 HIS 345 345 ? ? ? A . n A 1 346 HIS 346 346 ? ? ? A . n A 1 347 HIS 347 347 ? ? ? A . n A 1 348 HIS 348 348 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1680 ? 2 MORE -12 ? 2 'SSA (A^2)' 30430 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 -67.7245000000 0.0000000000 -1.0000000000 0.0000000000 117.3022749172 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-09-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHASER phasing . ? 2 PHENIX refinement '(phenix.refine: 1.7.3_928)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 336 ? A SER 336 3 1 Y 1 A PHE 337 ? A PHE 337 4 1 Y 1 A SER 338 ? A SER 338 5 1 Y 1 A CYS 339 ? A CYS 339 6 1 Y 1 A GLY 340 ? A GLY 340 7 1 Y 1 A LEU 341 ? A LEU 341 8 1 Y 1 A GLU 342 ? A GLU 342 9 1 Y 1 A HIS 343 ? A HIS 343 10 1 Y 1 A HIS 344 ? A HIS 344 11 1 Y 1 A HIS 345 ? A HIS 345 12 1 Y 1 A HIS 346 ? A HIS 346 13 1 Y 1 A HIS 347 ? A HIS 347 14 1 Y 1 A HIS 348 ? A HIS 348 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 1 HOH HOH A . B 2 HOH 2 402 2 HOH HOH A . B 2 HOH 3 403 3 HOH HOH A . B 2 HOH 4 404 4 HOH HOH A . B 2 HOH 5 405 5 HOH HOH A . B 2 HOH 6 406 6 HOH HOH A . B 2 HOH 7 407 7 HOH HOH A . B 2 HOH 8 408 8 HOH HOH A . B 2 HOH 9 409 9 HOH HOH A . B 2 HOH 10 410 12 HOH HOH A . B 2 HOH 11 411 13 HOH HOH A . B 2 HOH 12 412 14 HOH HOH A . B 2 HOH 13 413 15 HOH HOH A . B 2 HOH 14 414 16 HOH HOH A . B 2 HOH 15 415 17 HOH HOH A . B 2 HOH 16 416 19 HOH HOH A . B 2 HOH 17 417 22 HOH HOH A . B 2 HOH 18 418 23 HOH HOH A . B 2 HOH 19 419 24 HOH HOH A . B 2 HOH 20 420 25 HOH HOH A . B 2 HOH 21 421 26 HOH HOH A . B 2 HOH 22 422 27 HOH HOH A . B 2 HOH 23 423 28 HOH HOH A . B 2 HOH 24 424 29 HOH HOH A . B 2 HOH 25 425 30 HOH HOH A . B 2 HOH 26 426 31 HOH HOH A . B 2 HOH 27 427 32 HOH HOH A . B 2 HOH 28 428 33 HOH HOH A . B 2 HOH 29 429 36 HOH HOH A . B 2 HOH 30 430 37 HOH HOH A . B 2 HOH 31 431 38 HOH HOH A . B 2 HOH 32 432 39 HOH HOH A . B 2 HOH 33 433 40 HOH HOH A . B 2 HOH 34 434 44 HOH HOH A . B 2 HOH 35 435 46 HOH HOH A . B 2 HOH 36 436 47 HOH HOH A . B 2 HOH 37 437 48 HOH HOH A . B 2 HOH 38 438 52 HOH HOH A . B 2 HOH 39 439 53 HOH HOH A . #