data_4J29 # _entry.id 4J29 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4J29 RCSB RCSB077504 WWPDB D_1000077504 # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id NESG-OR258 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 4J29 _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-02-04 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vorobiev, S.' 1 'Su, M.' 2 'Koga, R.' 3 'Seetharaman, J.' 4 'Koga, N.' 5 'Mao, L.' 6 'Xiao, R.' 7 'Kohan, E.' 8 'Castelllanos, J.' 9 'Everett, J.K.' 10 'Acton, T.B.' 11 'Baker, D.' 12 'Montelione, G.T.' 13 'Tong, L.' 14 'Hunt, J.F.' 15 'Northeast Structural Genomics Consortium (NESG)' 16 # _citation.id primary _citation.title 'Crystal Structure of Engineered Protein OR258.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vorobiev, S.' 1 primary 'Su, M.' 2 primary 'Koga, R.' 3 primary 'Seetharaman, J.' 4 primary 'Koga, N.' 5 primary 'Mao, L.' 6 primary 'Xiao, R.' 7 primary 'Kohan, E.' 8 primary 'Castelllanos, J.' 9 primary 'Everett, J.K.' 10 primary 'Acton, T.B.' 11 primary 'Baker, D.' 12 primary 'Montelione, G.T.' 13 primary 'Tong, L.' 14 primary 'Hunt, J.F.' 15 # _cell.entry_id 4J29 _cell.length_a 67.558 _cell.length_b 67.558 _cell.length_c 48.907 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4J29 _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Engineered Protein OR258' 15862.859 1 ? ? ? ? 2 water nat water 18.015 16 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GTVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKE GLRVLVI(MSE)VDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGTVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKEGLRV LVIMVDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-OR258 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 THR n 1 4 VAL n 1 5 VAL n 1 6 ILE n 1 7 VAL n 1 8 VAL n 1 9 SER n 1 10 ARG n 1 11 ASP n 1 12 GLU n 1 13 ARG n 1 14 ILE n 1 15 LEU n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 LEU n 1 20 GLU n 1 21 VAL n 1 22 VAL n 1 23 LEU n 1 24 LYS n 1 25 SER n 1 26 ASP n 1 27 PRO n 1 28 ASN n 1 29 VAL n 1 30 LYS n 1 31 THR n 1 32 VAL n 1 33 ARG n 1 34 THR n 1 35 ASP n 1 36 ASP n 1 37 LYS n 1 38 GLU n 1 39 LYS n 1 40 VAL n 1 41 LYS n 1 42 GLU n 1 43 GLU n 1 44 ILE n 1 45 GLU n 1 46 LYS n 1 47 ALA n 1 48 ARG n 1 49 LYS n 1 50 GLN n 1 51 GLY n 1 52 ARG n 1 53 PRO n 1 54 ILE n 1 55 VAL n 1 56 ILE n 1 57 PHE n 1 58 ILE n 1 59 ARG n 1 60 GLY n 1 61 ALA n 1 62 THR n 1 63 GLU n 1 64 GLU n 1 65 VAL n 1 66 VAL n 1 67 ARG n 1 68 ASP n 1 69 ILE n 1 70 VAL n 1 71 GLU n 1 72 TYR n 1 73 ALA n 1 74 GLN n 1 75 LYS n 1 76 GLU n 1 77 GLY n 1 78 LEU n 1 79 ARG n 1 80 VAL n 1 81 LEU n 1 82 VAL n 1 83 ILE n 1 84 MSE n 1 85 VAL n 1 86 ASP n 1 87 GLN n 1 88 ASP n 1 89 GLN n 1 90 GLU n 1 91 GLU n 1 92 LEU n 1 93 GLU n 1 94 ARG n 1 95 ILE n 1 96 TYR n 1 97 GLU n 1 98 GLN n 1 99 LEU n 1 100 LYS n 1 101 LYS n 1 102 ASP n 1 103 GLY n 1 104 VAL n 1 105 ASP n 1 106 VAL n 1 107 ARG n 1 108 VAL n 1 109 THR n 1 110 ASP n 1 111 ASN n 1 112 GLU n 1 113 ASP n 1 114 GLU n 1 115 ALA n 1 116 LYS n 1 117 LYS n 1 118 ARG n 1 119 LEU n 1 120 LYS n 1 121 GLU n 1 122 LEU n 1 123 LEU n 1 124 GLU n 1 125 LYS n 1 126 VAL n 1 127 LEU n 1 128 GLU n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)Gold' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET29b+, OR258-29.1' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 4J29 _struct_ref.pdbx_db_accession 4J29 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGTVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKEGLRV LVIMVDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEHHHHHH ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4J29 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 4J29 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4J29 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 1.76 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 30.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp ? _exptl_crystal_grow.pdbx_details '100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl pH 7.5, VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.details ? _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2012-12-06 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97921 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.pdbx_wavelength_list 0.97921 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 24-ID-E # _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.limit_k_max ? _reflns.d_resolution_high 2.10 _reflns.observed_criterion_F_min ? _reflns.pdbx_netI_over_sigmaI 22.3 _reflns.observed_criterion_F_max ? _reflns.pdbx_Rmerge_I_obs 0.151 _reflns.limit_l_max ? _reflns.limit_k_min ? _reflns.entry_id 4J29 _reflns.B_iso_Wilson_estimate 36.160 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rsym_value ? _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.limit_l_min ? _reflns.limit_h_min ? _reflns.R_free_details ? _reflns.number_all 12677 _reflns.d_resolution_low 50.0 _reflns.pdbx_redundancy 27.6 _reflns.number_obs 12646 _reflns.limit_h_max ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.21 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 1.870 _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 28.5 _reflns_shell.number_unique_all 1663 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.ls_percent_reflns_R_free 4.690 _refine.overall_SU_B ? _refine.pdbx_solvent_vdw_probe_radii 1.100 _refine.pdbx_R_Free_selection_details RANDOM _refine.overall_FOM_free_R_set ? _refine.pdbx_data_cutoff_low_absF ? _refine.entry_id 4J29 _refine.aniso_B[2][3] -0.000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_ML 0.690 _refine.pdbx_ls_sigma_I ? _refine.aniso_B[1][3] -0.000 _refine.pdbx_stereochemistry_target_values ML _refine.aniso_B[3][3] -4.550 _refine.occupancy_max 1.00 _refine.ls_number_restraints ? _refine.aniso_B[1][1] 2.275 _refine.pdbx_overall_ESU_R ? _refine.ls_R_factor_obs 0.239 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_starting_model ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_method_to_determine_struct SAD _refine.solvent_model_param_ksol 0.380 _refine.pdbx_solvent_shrinkage_radii 0.860 _refine.correlation_coeff_Fo_to_Fc ? _refine.ls_number_reflns_R_free 593 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_ls_sigma_F 1.35 _refine.ls_percent_reflns_obs 99.950 _refine.ls_R_factor_R_work 0.237 _refine.overall_SU_R_free ? _refine.ls_d_res_high 2.100 _refine.pdbx_overall_ESU_R_Free ? _refine.B_iso_min 20.24 _refine.occupancy_min 0.88 _refine.B_iso_mean 46.611 _refine.pdbx_stereochem_target_val_spec_case ? _refine.ls_R_factor_all ? _refine.aniso_B[2][2] 2.275 _refine.B_iso_max 104.57 _refine.ls_d_res_low 23.885 _refine.pdbx_overall_phase_error 25.440 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.aniso_B[1][2] 0.000 _refine.ls_R_factor_R_free 0.268 _refine.ls_R_factor_R_free_error ? _refine.ls_number_reflns_obs 12634 _refine.overall_FOM_work_R_set ? _refine.ls_number_parameters ? _refine.details 'IN THE CRYSTAL STRUCTURE OR258 FORMS DIMER WITH CRYSTAL SYMMETRY MATE (-X+1,-Y+1,Z) BY DOMAIN SWAPPING.' _refine.ls_number_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.solvent_model_param_bsol 62.951 _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1039 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1055 _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 23.885 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 1044 0.011 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1401 1.258 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 169 0.094 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 181 0.004 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 426 17.096 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 2.100 2.311 4 100.000 3002 . 0.292 0.345 . 159 . 3161 . . 'X-RAY DIFFRACTION' 2.311 2.645 4 100.000 2986 . 0.263 0.267 . 162 . 3148 . . 'X-RAY DIFFRACTION' 2.645 3.331 4 100.000 3029 . 0.251 0.288 . 138 . 3167 . . 'X-RAY DIFFRACTION' 3.331 23.887 4 100.000 3024 . 0.214 0.243 . 134 . 3158 . . 'X-RAY DIFFRACTION' # _struct.entry_id 4J29 _struct.title 'Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR258.' _struct.pdbx_descriptor OR258 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown Function' _struct_keywords.text ;Structural Genomics, PSI-Biology, Protein Structure Initiative, NESG, OR258, Northeast Structural Genomics Consortium, Unknown Function ; _struct_keywords.entry_id 4J29 # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? ASP A 26 ? ASP A 11 ASP A 26 1 ? 16 HELX_P HELX_P2 2 ASP A 36 ? GLN A 50 ? ASP A 36 GLN A 50 1 ? 15 HELX_P HELX_P3 3 THR A 62 ? LYS A 75 ? THR A 62 LYS A 75 1 ? 14 HELX_P HELX_P4 4 ASP A 86 ? ASP A 102 ? ASP A 86 ASP A 102 1 ? 17 HELX_P HELX_P5 5 ASN A 111 ? LEU A 127 ? ASN A 111 LEU A 127 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ILE 83 C ? ? ? 1_555 A MSE 84 N ? ? A ILE 83 A MSE 84 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale ? ? A MSE 84 C ? ? ? 1_555 A VAL 85 N ? ? A MSE 84 A VAL 85 1_555 ? ? ? ? ? ? ? 1.324 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 60 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 60 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ALA _struct_mon_prot_cis.pdbx_label_seq_id_2 61 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ALA _struct_mon_prot_cis.pdbx_auth_seq_id_2 61 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.40 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 30 ? ARG A 33 ? LYS A 30 ARG A 33 A 2 ILE A 54 ? ILE A 58 ? ILE A 54 ILE A 58 A 3 VAL A 4 ? VAL A 8 ? VAL A 4 VAL A 8 A 4 VAL A 80 ? MSE A 84 ? VAL A 80 MSE A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 32 ? N VAL A 32 O PHE A 57 ? O PHE A 57 A 2 3 O ILE A 56 ? O ILE A 56 N VAL A 7 ? N VAL A 7 A 3 4 N VAL A 8 ? N VAL A 8 O ILE A 83 ? O ILE A 83 # _atom_sites.entry_id 4J29 _atom_sites.fract_transf_matrix[1][1] 0.014802 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014802 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020447 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLU 63 63 63 GLU ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 MSE 84 84 84 MSE MSE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 HIS 130 130 ? ? ? A . n A 1 131 HIS 131 131 ? ? ? A . n A 1 132 HIS 132 132 ? ? ? A . n A 1 133 HIS 133 133 ? ? ? A . n A 1 134 HIS 134 134 ? ? ? A . n # _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.id 1 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH WAT A . B 2 HOH 2 202 202 HOH WAT A . B 2 HOH 3 203 203 HOH WAT A . B 2 HOH 4 204 204 HOH WAT A . B 2 HOH 5 205 205 HOH WAT A . B 2 HOH 6 206 206 HOH WAT A . B 2 HOH 7 207 208 HOH WAT A . B 2 HOH 8 208 209 HOH WAT A . B 2 HOH 9 209 210 HOH WAT A . B 2 HOH 10 210 211 HOH WAT A . B 2 HOH 11 211 212 HOH WAT A . B 2 HOH 12 212 213 HOH WAT A . B 2 HOH 13 213 214 HOH WAT A . B 2 HOH 14 214 215 HOH WAT A . B 2 HOH 15 215 216 HOH WAT A . B 2 HOH 16 216 217 HOH WAT A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 84 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 84 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5520 ? 1 MORE -44 ? 1 'SSA (A^2)' 13090 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 67.5580000000 0.0000000000 -1.0000000000 0.0000000000 67.5580000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 212 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 34.5346 _pdbx_refine_tls.origin_y 25.6132 _pdbx_refine_tls.origin_z 12.4845 _pdbx_refine_tls.T[1][1] 0.2804 _pdbx_refine_tls.T[2][2] 0.2428 _pdbx_refine_tls.T[3][3] 0.2587 _pdbx_refine_tls.T[1][2] -0.0117 _pdbx_refine_tls.T[1][3] 0.0338 _pdbx_refine_tls.T[2][3] 0.0045 _pdbx_refine_tls.L[1][1] 1.1917 _pdbx_refine_tls.L[2][2] 1.2539 _pdbx_refine_tls.L[3][3] 1.1222 _pdbx_refine_tls.L[1][2] -0.9876 _pdbx_refine_tls.L[1][3] -0.4079 _pdbx_refine_tls.L[2][3] -0.0062 _pdbx_refine_tls.S[1][1] -0.2437 _pdbx_refine_tls.S[2][2] 0.0726 _pdbx_refine_tls.S[3][3] 0.1081 _pdbx_refine_tls.S[1][2] 0.0605 _pdbx_refine_tls.S[1][3] -0.1524 _pdbx_refine_tls.S[2][3] 0.1568 _pdbx_refine_tls.S[2][1] 0.2844 _pdbx_refine_tls.S[3][1] 0.1590 _pdbx_refine_tls.S[3][2] -0.0696 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 3 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 129 _pdbx_refine_tls_group.selection_details 'chain A' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 PHENIX 1.7.2_869 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 PDB_EXTRACT 3.100 'Jan. 22, 2010' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 4 XDS . ? ? ? ? 'data reduction' ? ? ? 5 XSCALE . ? ? ? ? 'data scaling' ? ? ? 6 SHELXDE . ? ? ? ? phasing ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 27 ? ? -60.86 3.92 2 1 THR A 62 ? ? -37.72 127.07 3 1 ASP A 86 ? ? -114.79 77.96 4 1 ASP A 102 ? ? -80.44 -157.75 5 1 GLU A 128 ? ? -165.78 103.88 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 63 ? CG ? A GLU 63 CG 2 1 Y 1 A GLU 63 ? CD ? A GLU 63 CD 3 1 Y 1 A GLU 63 ? OE1 ? A GLU 63 OE1 4 1 Y 1 A GLU 63 ? OE2 ? A GLU 63 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A HIS 130 ? A HIS 130 4 1 Y 1 A HIS 131 ? A HIS 131 5 1 Y 1 A HIS 132 ? A HIS 132 6 1 Y 1 A HIS 133 ? A HIS 133 7 1 Y 1 A HIS 134 ? A HIS 134 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #