data_4JBP # _entry.id 4JBP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4JBP RCSB RCSB077844 WWPDB D_1000077844 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3M11 . unspecified PDB 3K5U . unspecified PDB 4JBO . unspecified PDB 4JBQ . unspecified # _pdbx_database_status.entry_id 4JBP _pdbx_database_status.status_code REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-02-20 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, J.S.' 1 'Leou, J.S.' 2 'Peng, Y.H.' 3 'Hsueh, C.C.' 4 'Hsieh, H.P.' 5 'Wu, S.Y.' 6 # _citation.id primary _citation.title 'Aurora kinase inhibitors reveal mechanisms of HURP in nucleation of centrosomal and kinetochore microtubules.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 110 _citation.page_first E1779 _citation.page_last E1787 _citation.year 2013 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23610398 _citation.pdbx_database_id_DOI 10.1073/pnas.1220523110 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wu, J.M.' 1 primary 'Chen, C.T.' 2 primary 'Coumar, M.S.' 3 primary 'Lin, W.H.' 4 primary 'Chen, Z.J.' 5 primary 'Hsu, J.T.' 6 primary 'Peng, Y.H.' 7 primary 'Shiao, H.Y.' 8 primary 'Lin, W.H.' 9 primary 'Chu, C.Y.' 10 primary 'Wu, J.S.' 11 primary 'Lin, C.T.' 12 primary 'Chen, C.P.' 13 primary 'Hsueh, C.C.' 14 primary 'Chang, K.Y.' 15 primary 'Kao, L.P.' 16 primary 'Huang, C.Y.' 17 primary 'Chao, Y.S.' 18 primary 'Wu, S.Y.' 19 primary 'Hsieh, H.P.' 20 primary 'Chi, Y.H.' 21 # _cell.length_a 80.810 _cell.length_b 80.810 _cell.length_c 174.308 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4JBP _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.entry_id 4JBP _symmetry.Int_Tables_number 178 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora Kinase A' 32359.123 1 2.7.11.1 T288D 'Catalytic domain, UNP RESIDUES 123-401' ? 2 non-polymer syn '1-(4-{2-[(6-{4-[2-(4-hydroxypiperidin-1-yl)ethoxy]phenyl}furo[2,3-d]pyrimidin-4-yl)amino]ethyl}phenyl)-3-phenylurea' 592.687 1 ? ? ? ? 3 water nat water 18.015 59 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2, Aurora/IPL1-related kinase 1, ARK-1, Aurora-related kinase 1, hARK1, Breast tumor-amplified kinase, Serine/threonine-protein kinase 15, Serine/threonine-protein kinase 6, Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTDLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _entity_poly.pdbx_seq_one_letter_code_can ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTDLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 LYS n 1 4 ARG n 1 5 GLN n 1 6 TRP n 1 7 ALA n 1 8 LEU n 1 9 GLU n 1 10 ASP n 1 11 PHE n 1 12 GLU n 1 13 ILE n 1 14 GLY n 1 15 ARG n 1 16 PRO n 1 17 LEU n 1 18 GLY n 1 19 LYS n 1 20 GLY n 1 21 LYS n 1 22 PHE n 1 23 GLY n 1 24 ASN n 1 25 VAL n 1 26 TYR n 1 27 LEU n 1 28 ALA n 1 29 ARG n 1 30 GLU n 1 31 LYS n 1 32 GLN n 1 33 SER n 1 34 LYS n 1 35 PHE n 1 36 ILE n 1 37 LEU n 1 38 ALA n 1 39 LEU n 1 40 LYS n 1 41 VAL n 1 42 LEU n 1 43 PHE n 1 44 LYS n 1 45 ALA n 1 46 GLN n 1 47 LEU n 1 48 GLU n 1 49 LYS n 1 50 ALA n 1 51 GLY n 1 52 VAL n 1 53 GLU n 1 54 HIS n 1 55 GLN n 1 56 LEU n 1 57 ARG n 1 58 ARG n 1 59 GLU n 1 60 VAL n 1 61 GLU n 1 62 ILE n 1 63 GLN n 1 64 SER n 1 65 HIS n 1 66 LEU n 1 67 ARG n 1 68 HIS n 1 69 PRO n 1 70 ASN n 1 71 ILE n 1 72 LEU n 1 73 ARG n 1 74 LEU n 1 75 TYR n 1 76 GLY n 1 77 TYR n 1 78 PHE n 1 79 HIS n 1 80 ASP n 1 81 ALA n 1 82 THR n 1 83 ARG n 1 84 VAL n 1 85 TYR n 1 86 LEU n 1 87 ILE n 1 88 LEU n 1 89 GLU n 1 90 TYR n 1 91 ALA n 1 92 PRO n 1 93 LEU n 1 94 GLY n 1 95 THR n 1 96 VAL n 1 97 TYR n 1 98 ARG n 1 99 GLU n 1 100 LEU n 1 101 GLN n 1 102 LYS n 1 103 LEU n 1 104 SER n 1 105 LYS n 1 106 PHE n 1 107 ASP n 1 108 GLU n 1 109 GLN n 1 110 ARG n 1 111 THR n 1 112 ALA n 1 113 THR n 1 114 TYR n 1 115 ILE n 1 116 THR n 1 117 GLU n 1 118 LEU n 1 119 ALA n 1 120 ASN n 1 121 ALA n 1 122 LEU n 1 123 SER n 1 124 TYR n 1 125 CYS n 1 126 HIS n 1 127 SER n 1 128 LYS n 1 129 ARG n 1 130 VAL n 1 131 ILE n 1 132 HIS n 1 133 ARG n 1 134 ASP n 1 135 ILE n 1 136 LYS n 1 137 PRO n 1 138 GLU n 1 139 ASN n 1 140 LEU n 1 141 LEU n 1 142 LEU n 1 143 GLY n 1 144 SER n 1 145 ALA n 1 146 GLY n 1 147 GLU n 1 148 LEU n 1 149 LYS n 1 150 ILE n 1 151 ALA n 1 152 ASP n 1 153 PHE n 1 154 GLY n 1 155 TRP n 1 156 SER n 1 157 VAL n 1 158 HIS n 1 159 ALA n 1 160 PRO n 1 161 SER n 1 162 SER n 1 163 ARG n 1 164 ARG n 1 165 THR n 1 166 ASP n 1 167 LEU n 1 168 CYS n 1 169 GLY n 1 170 THR n 1 171 LEU n 1 172 ASP n 1 173 TYR n 1 174 LEU n 1 175 PRO n 1 176 PRO n 1 177 GLU n 1 178 MET n 1 179 ILE n 1 180 GLU n 1 181 GLY n 1 182 ARG n 1 183 MET n 1 184 HIS n 1 185 ASP n 1 186 GLU n 1 187 LYS n 1 188 VAL n 1 189 ASP n 1 190 LEU n 1 191 TRP n 1 192 SER n 1 193 LEU n 1 194 GLY n 1 195 VAL n 1 196 LEU n 1 197 CYS n 1 198 TYR n 1 199 GLU n 1 200 PHE n 1 201 LEU n 1 202 VAL n 1 203 GLY n 1 204 LYS n 1 205 PRO n 1 206 PRO n 1 207 PHE n 1 208 GLU n 1 209 ALA n 1 210 ASN n 1 211 THR n 1 212 TYR n 1 213 GLN n 1 214 GLU n 1 215 THR n 1 216 TYR n 1 217 LYS n 1 218 ARG n 1 219 ILE n 1 220 SER n 1 221 ARG n 1 222 VAL n 1 223 GLU n 1 224 PHE n 1 225 THR n 1 226 PHE n 1 227 PRO n 1 228 ASP n 1 229 PHE n 1 230 VAL n 1 231 THR n 1 232 GLU n 1 233 GLY n 1 234 ALA n 1 235 ARG n 1 236 ASP n 1 237 LEU n 1 238 ILE n 1 239 SER n 1 240 ARG n 1 241 LEU n 1 242 LEU n 1 243 LYS n 1 244 HIS n 1 245 ASN n 1 246 PRO n 1 247 SER n 1 248 GLN n 1 249 ARG n 1 250 PRO n 1 251 MET n 1 252 LEU n 1 253 ARG n 1 254 GLU n 1 255 VAL n 1 256 LEU n 1 257 GLU n 1 258 HIS n 1 259 PRO n 1 260 TRP n 1 261 ILE n 1 262 THR n 1 263 ALA n 1 264 ASN n 1 265 SER n 1 266 SER n 1 267 LYS n 1 268 PRO n 1 269 SER n 1 270 ASN n 1 271 CYS n 1 272 GLN n 1 273 ASN n 1 274 LYS n 1 275 GLU n 1 276 SER n 1 277 ALA n 1 278 SER n 1 279 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASK ; _struct_ref.pdbx_align_begin 123 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4JBP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 279 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 123 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 401 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 123 _struct_ref_seq.pdbx_auth_seq_align_end 401 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4JBP _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 166 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O14965 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 288 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 288 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YPH non-polymer . '1-(4-{2-[(6-{4-[2-(4-hydroxypiperidin-1-yl)ethoxy]phenyl}furo[2,3-d]pyrimidin-4-yl)amino]ethyl}phenyl)-3-phenylurea' ? 'C34 H36 N6 O4' 592.687 # _exptl.crystals_number 1 _exptl.entry_id 4JBP _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 0.629 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 51.55 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.pdbx_details '22% PEG 400, 0.1M ammonia sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2011-04-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL12B2' _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL12B2 # _reflns.entry_id 4JBP _reflns.d_resolution_high 2.450 _reflns.d_resolution_low 30.000 _reflns.number_obs 13014 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_netI_over_sigmaI 16.100 _reflns.pdbx_chi_squared 1.056 _reflns.pdbx_redundancy 4.300 _reflns.percent_possible_obs 99.400 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.450 2.540 ? ? ? ? 0.464 ? ? 1.076 4.400 ? ? ? 1263 ? ? ? ? 100.000 ? ? 1 1 2.540 2.640 ? ? ? ? 0.373 ? ? 1.070 4.400 ? ? ? 1265 ? ? ? ? 100.000 ? ? 2 1 2.640 2.760 ? ? ? ? 0.289 ? ? 1.071 4.300 ? ? ? 1266 ? ? ? ? 99.900 ? ? 3 1 2.760 2.900 ? ? ? ? 0.175 ? ? 1.096 4.400 ? ? ? 1282 ? ? ? ? 100.000 ? ? 4 1 2.900 3.090 ? ? ? ? 0.131 ? ? 1.006 4.400 ? ? ? 1274 ? ? ? ? 99.800 ? ? 5 1 3.090 3.320 ? ? ? ? 0.077 ? ? 1.015 4.300 ? ? ? 1296 ? ? ? ? 100.000 ? ? 6 1 3.320 3.660 ? ? ? ? 0.051 ? ? 1.094 4.300 ? ? ? 1292 ? ? ? ? 99.500 ? ? 7 1 3.660 4.190 ? ? ? ? 0.032 ? ? 1.059 4.200 ? ? ? 1307 ? ? ? ? 99.500 ? ? 8 1 4.190 5.270 ? ? ? ? 0.024 ? ? 1.037 4.200 ? ? ? 1335 ? ? ? ? 99.300 ? ? 9 1 5.270 30.000 ? ? ? ? 0.023 ? ? 1.035 3.900 ? ? ? 1434 ? ? ? ? 96.800 ? ? 10 1 # _refine.entry_id 4JBP _refine.ls_d_res_high 2.4500 _refine.ls_d_res_low 30.0000 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.6400 _refine.ls_number_reflns_obs 12879 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'U VALUES: WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2256 _refine.ls_R_factor_R_work 0.2225 _refine.ls_wR_factor_R_work 0.2198 _refine.ls_R_factor_R_free 0.2907 _refine.ls_wR_factor_R_free 0.2798 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_number_reflns_R_free 632 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 44.9259 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -0.4500 _refine.aniso_B[2][2] -0.4500 _refine.aniso_B[3][3] 0.6700 _refine.aniso_B[1][2] -0.2200 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9310 _refine.correlation_coeff_Fo_to_Fc_free 0.8850 _refine.overall_SU_R_Cruickshank_DPI 0.4481 _refine.overall_SU_R_free 0.3090 _refine.pdbx_overall_ESU_R 0.4480 _refine.pdbx_overall_ESU_R_Free 0.3090 _refine.overall_SU_ML 0.2000 _refine.overall_SU_B 17.1130 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.5000 _refine.pdbx_solvent_ion_probe_radii 1.2000 _refine.pdbx_solvent_shrinkage_radii 1.2000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8093 _refine.B_iso_max 117.530 _refine.B_iso_min 17.680 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2086 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 2189 _refine_hist.d_res_high 2.4500 _refine_hist.d_res_low 30.0000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 2202 0.008 0.020 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 1565 0.001 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2975 1.308 1.988 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 3736 1.246 3.004 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 253 5.745 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 106 35.112 22.830 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 385 14.313 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 19 17.814 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 311 0.165 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 2398 0.004 0.021 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 471 0.001 0.020 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.4500 _refine_ls_shell.d_res_low 2.5140 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 98.1300 _refine_ls_shell.number_reflns_R_work 739 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2850 _refine_ls_shell.R_factor_R_free 0.3180 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 48 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 787 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 4JBP _struct.title 'Novel Aurora kinase inhibitors reveal mechanisms of HURP in nucleation of centrosomal and kinetochore microtubules' _struct.pdbx_descriptor 'Aurora Kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4JBP _struct_keywords.text 'Aurora Kinase inhibitors, HURP, mitotic spindle, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 7 ? GLU A 9 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 2 LYS A 44 ? ALA A 50 ? LYS A 166 ALA A 172 1 ? 7 HELX_P HELX_P3 3 VAL A 52 ? SER A 64 ? VAL A 174 SER A 186 1 ? 13 HELX_P HELX_P4 4 THR A 95 ? SER A 104 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 5 ASP A 107 ? LYS A 128 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 6 LYS A 136 ? GLU A 138 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 7 PRO A 175 ? GLU A 180 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P8 8 LYS A 187 ? GLY A 203 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P9 9 THR A 211 ? VAL A 222 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P10 10 THR A 231 ? LEU A 242 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P11 11 ASN A 245 ? ARG A 249 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P12 12 MET A 251 ? GLU A 257 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P13 13 HIS A 258 ? SER A 265 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 11 ? LYS A 19 ? PHE A 133 LYS A 141 A 2 GLY A 23 ? GLU A 30 ? GLY A 145 GLU A 152 A 3 ILE A 36 ? PHE A 43 ? ILE A 158 PHE A 165 A 4 ARG A 83 ? LEU A 88 ? ARG A 205 LEU A 210 A 5 LEU A 74 ? HIS A 79 ? LEU A 196 HIS A 201 B 1 LEU A 140 ? LEU A 142 ? LEU A 262 LEU A 264 B 2 LEU A 148 ? ILE A 150 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 14 ? N GLY A 136 O LEU A 27 ? O LEU A 149 A 2 3 N TYR A 26 ? N TYR A 148 O LEU A 39 ? O LEU A 161 A 3 4 N LEU A 42 ? N LEU A 164 O VAL A 84 ? O VAL A 206 A 4 5 O TYR A 85 ? O TYR A 207 N PHE A 78 ? N PHE A 200 B 1 2 N LEU A 141 ? N LEU A 263 O LYS A 149 ? O LYS A 271 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 22 _struct_site.details 'BINDING SITE FOR RESIDUE YPH A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 22 ARG A 15 ? ARG A 137 . ? 1_555 ? 2 AC1 22 LEU A 17 ? LEU A 139 . ? 1_555 ? 3 AC1 22 VAL A 25 ? VAL A 147 . ? 1_555 ? 4 AC1 22 ALA A 38 ? ALA A 160 . ? 1_555 ? 5 AC1 22 LYS A 40 ? LYS A 162 . ? 1_555 ? 6 AC1 22 LEU A 42 ? LEU A 164 . ? 1_555 ? 7 AC1 22 LEU A 47 ? LEU A 169 . ? 1_555 ? 8 AC1 22 LEU A 56 ? LEU A 178 . ? 1_555 ? 9 AC1 22 GLU A 59 ? GLU A 181 . ? 1_555 ? 10 AC1 22 LEU A 88 ? LEU A 210 . ? 1_555 ? 11 AC1 22 GLU A 89 ? GLU A 211 . ? 1_555 ? 12 AC1 22 ALA A 91 ? ALA A 213 . ? 1_555 ? 13 AC1 22 PRO A 92 ? PRO A 214 . ? 1_555 ? 14 AC1 22 LEU A 93 ? LEU A 215 . ? 1_555 ? 15 AC1 22 GLY A 94 ? GLY A 216 . ? 1_555 ? 16 AC1 22 LYS A 102 ? LYS A 224 . ? 1_555 ? 17 AC1 22 LEU A 141 ? LEU A 263 . ? 1_555 ? 18 AC1 22 ASP A 152 ? ASP A 274 . ? 1_555 ? 19 AC1 22 GLY A 154 ? GLY A 276 . ? 1_555 ? 20 AC1 22 ARG A 221 ? ARG A 343 . ? 8_565 ? 21 AC1 22 HIS A 244 ? HIS A 366 . ? 8_565 ? 22 AC1 22 HOH C . ? HOH A 606 . ? 1_555 ? # _atom_sites.entry_id 4JBP _atom_sites.fract_transf_matrix[1][1] 0.012375 _atom_sites.fract_transf_matrix[1][2] 0.007145 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014289 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005737 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 123 ? ? ? A . n A 1 2 LYS 2 124 ? ? ? A . n A 1 3 LYS 3 125 ? ? ? A . n A 1 4 ARG 4 126 126 ARG ARG A . n A 1 5 GLN 5 127 127 GLN GLN A . n A 1 6 TRP 6 128 128 TRP TRP A . n A 1 7 ALA 7 129 129 ALA ALA A . n A 1 8 LEU 8 130 130 LEU LEU A . n A 1 9 GLU 9 131 131 GLU GLU A . n A 1 10 ASP 10 132 132 ASP ASP A . n A 1 11 PHE 11 133 133 PHE PHE A . n A 1 12 GLU 12 134 134 GLU GLU A . n A 1 13 ILE 13 135 135 ILE ILE A . n A 1 14 GLY 14 136 136 GLY GLY A . n A 1 15 ARG 15 137 137 ARG ARG A . n A 1 16 PRO 16 138 138 PRO PRO A . n A 1 17 LEU 17 139 139 LEU LEU A . n A 1 18 GLY 18 140 140 GLY GLY A . n A 1 19 LYS 19 141 141 LYS LYS A . n A 1 20 GLY 20 142 142 GLY GLY A . n A 1 21 LYS 21 143 143 LYS LYS A . n A 1 22 PHE 22 144 144 PHE PHE A . n A 1 23 GLY 23 145 145 GLY GLY A . n A 1 24 ASN 24 146 146 ASN ASN A . n A 1 25 VAL 25 147 147 VAL VAL A . n A 1 26 TYR 26 148 148 TYR TYR A . n A 1 27 LEU 27 149 149 LEU LEU A . n A 1 28 ALA 28 150 150 ALA ALA A . n A 1 29 ARG 29 151 151 ARG ARG A . n A 1 30 GLU 30 152 152 GLU GLU A . n A 1 31 LYS 31 153 153 LYS LYS A . n A 1 32 GLN 32 154 154 GLN GLN A . n A 1 33 SER 33 155 155 SER SER A . n A 1 34 LYS 34 156 156 LYS LYS A . n A 1 35 PHE 35 157 157 PHE PHE A . n A 1 36 ILE 36 158 158 ILE ILE A . n A 1 37 LEU 37 159 159 LEU LEU A . n A 1 38 ALA 38 160 160 ALA ALA A . n A 1 39 LEU 39 161 161 LEU LEU A . n A 1 40 LYS 40 162 162 LYS LYS A . n A 1 41 VAL 41 163 163 VAL VAL A . n A 1 42 LEU 42 164 164 LEU LEU A . n A 1 43 PHE 43 165 165 PHE PHE A . n A 1 44 LYS 44 166 166 LYS LYS A . n A 1 45 ALA 45 167 167 ALA ALA A . n A 1 46 GLN 46 168 168 GLN GLN A . n A 1 47 LEU 47 169 169 LEU LEU A . n A 1 48 GLU 48 170 170 GLU GLU A . n A 1 49 LYS 49 171 171 LYS LYS A . n A 1 50 ALA 50 172 172 ALA ALA A . n A 1 51 GLY 51 173 173 GLY GLY A . n A 1 52 VAL 52 174 174 VAL VAL A . n A 1 53 GLU 53 175 175 GLU GLU A . n A 1 54 HIS 54 176 176 HIS HIS A . n A 1 55 GLN 55 177 177 GLN GLN A . n A 1 56 LEU 56 178 178 LEU LEU A . n A 1 57 ARG 57 179 179 ARG ARG A . n A 1 58 ARG 58 180 180 ARG ARG A . n A 1 59 GLU 59 181 181 GLU GLU A . n A 1 60 VAL 60 182 182 VAL VAL A . n A 1 61 GLU 61 183 183 GLU GLU A . n A 1 62 ILE 62 184 184 ILE ILE A . n A 1 63 GLN 63 185 185 GLN GLN A . n A 1 64 SER 64 186 186 SER SER A . n A 1 65 HIS 65 187 187 HIS HIS A . n A 1 66 LEU 66 188 188 LEU LEU A . n A 1 67 ARG 67 189 189 ARG ARG A . n A 1 68 HIS 68 190 190 HIS HIS A . n A 1 69 PRO 69 191 191 PRO PRO A . n A 1 70 ASN 70 192 192 ASN ASN A . n A 1 71 ILE 71 193 193 ILE ILE A . n A 1 72 LEU 72 194 194 LEU LEU A . n A 1 73 ARG 73 195 195 ARG ARG A . n A 1 74 LEU 74 196 196 LEU LEU A . n A 1 75 TYR 75 197 197 TYR TYR A . n A 1 76 GLY 76 198 198 GLY GLY A . n A 1 77 TYR 77 199 199 TYR TYR A . n A 1 78 PHE 78 200 200 PHE PHE A . n A 1 79 HIS 79 201 201 HIS HIS A . n A 1 80 ASP 80 202 202 ASP ASP A . n A 1 81 ALA 81 203 203 ALA ALA A . n A 1 82 THR 82 204 204 THR THR A . n A 1 83 ARG 83 205 205 ARG ARG A . n A 1 84 VAL 84 206 206 VAL VAL A . n A 1 85 TYR 85 207 207 TYR TYR A . n A 1 86 LEU 86 208 208 LEU LEU A . n A 1 87 ILE 87 209 209 ILE ILE A . n A 1 88 LEU 88 210 210 LEU LEU A . n A 1 89 GLU 89 211 211 GLU GLU A . n A 1 90 TYR 90 212 212 TYR TYR A . n A 1 91 ALA 91 213 213 ALA ALA A . n A 1 92 PRO 92 214 214 PRO PRO A . n A 1 93 LEU 93 215 215 LEU LEU A . n A 1 94 GLY 94 216 216 GLY GLY A . n A 1 95 THR 95 217 217 THR THR A . n A 1 96 VAL 96 218 218 VAL VAL A . n A 1 97 TYR 97 219 219 TYR TYR A . n A 1 98 ARG 98 220 220 ARG ARG A . n A 1 99 GLU 99 221 221 GLU GLU A . n A 1 100 LEU 100 222 222 LEU LEU A . n A 1 101 GLN 101 223 223 GLN GLN A . n A 1 102 LYS 102 224 224 LYS LYS A . n A 1 103 LEU 103 225 225 LEU LEU A . n A 1 104 SER 104 226 226 SER SER A . n A 1 105 LYS 105 227 227 LYS LYS A . n A 1 106 PHE 106 228 228 PHE PHE A . n A 1 107 ASP 107 229 229 ASP ASP A . n A 1 108 GLU 108 230 230 GLU GLU A . n A 1 109 GLN 109 231 231 GLN GLN A . n A 1 110 ARG 110 232 232 ARG ARG A . n A 1 111 THR 111 233 233 THR THR A . n A 1 112 ALA 112 234 234 ALA ALA A . n A 1 113 THR 113 235 235 THR THR A . n A 1 114 TYR 114 236 236 TYR TYR A . n A 1 115 ILE 115 237 237 ILE ILE A . n A 1 116 THR 116 238 238 THR THR A . n A 1 117 GLU 117 239 239 GLU GLU A . n A 1 118 LEU 118 240 240 LEU LEU A . n A 1 119 ALA 119 241 241 ALA ALA A . n A 1 120 ASN 120 242 242 ASN ASN A . n A 1 121 ALA 121 243 243 ALA ALA A . n A 1 122 LEU 122 244 244 LEU LEU A . n A 1 123 SER 123 245 245 SER SER A . n A 1 124 TYR 124 246 246 TYR TYR A . n A 1 125 CYS 125 247 247 CYS CYS A . n A 1 126 HIS 126 248 248 HIS HIS A . n A 1 127 SER 127 249 249 SER SER A . n A 1 128 LYS 128 250 250 LYS LYS A . n A 1 129 ARG 129 251 251 ARG ARG A . n A 1 130 VAL 130 252 252 VAL VAL A . n A 1 131 ILE 131 253 253 ILE ILE A . n A 1 132 HIS 132 254 254 HIS HIS A . n A 1 133 ARG 133 255 255 ARG ARG A . n A 1 134 ASP 134 256 256 ASP ASP A . n A 1 135 ILE 135 257 257 ILE ILE A . n A 1 136 LYS 136 258 258 LYS LYS A . n A 1 137 PRO 137 259 259 PRO PRO A . n A 1 138 GLU 138 260 260 GLU GLU A . n A 1 139 ASN 139 261 261 ASN ASN A . n A 1 140 LEU 140 262 262 LEU LEU A . n A 1 141 LEU 141 263 263 LEU LEU A . n A 1 142 LEU 142 264 264 LEU LEU A . n A 1 143 GLY 143 265 265 GLY GLY A . n A 1 144 SER 144 266 266 SER SER A . n A 1 145 ALA 145 267 267 ALA ALA A . n A 1 146 GLY 146 268 268 GLY GLY A . n A 1 147 GLU 147 269 269 GLU GLU A . n A 1 148 LEU 148 270 270 LEU LEU A . n A 1 149 LYS 149 271 271 LYS LYS A . n A 1 150 ILE 150 272 272 ILE ILE A . n A 1 151 ALA 151 273 273 ALA ALA A . n A 1 152 ASP 152 274 274 ASP ASP A . n A 1 153 PHE 153 275 275 PHE PHE A . n A 1 154 GLY 154 276 276 GLY GLY A . n A 1 155 TRP 155 277 277 TRP TRP A . n A 1 156 SER 156 278 278 SER SER A . n A 1 157 VAL 157 279 279 VAL VAL A . n A 1 158 HIS 158 280 280 HIS HIS A . n A 1 159 ALA 159 281 ? ? ? A . n A 1 160 PRO 160 282 ? ? ? A . n A 1 161 SER 161 283 ? ? ? A . n A 1 162 SER 162 284 ? ? ? A . n A 1 163 ARG 163 285 ? ? ? A . n A 1 164 ARG 164 286 ? ? ? A . n A 1 165 THR 165 287 ? ? ? A . n A 1 166 ASP 166 288 ? ? ? A . n A 1 167 LEU 167 289 ? ? ? A . n A 1 168 CYS 168 290 ? ? ? A . n A 1 169 GLY 169 291 291 GLY GLY A . n A 1 170 THR 170 292 292 THR THR A . n A 1 171 LEU 171 293 293 LEU LEU A . n A 1 172 ASP 172 294 294 ASP ASP A . n A 1 173 TYR 173 295 295 TYR TYR A . n A 1 174 LEU 174 296 296 LEU LEU A . n A 1 175 PRO 175 297 297 PRO PRO A . n A 1 176 PRO 176 298 298 PRO PRO A . n A 1 177 GLU 177 299 299 GLU GLU A . n A 1 178 MET 178 300 300 MET MET A . n A 1 179 ILE 179 301 301 ILE ILE A . n A 1 180 GLU 180 302 302 GLU GLU A . n A 1 181 GLY 181 303 303 GLY GLY A . n A 1 182 ARG 182 304 304 ARG ARG A . n A 1 183 MET 183 305 305 MET MET A . n A 1 184 HIS 184 306 306 HIS HIS A . n A 1 185 ASP 185 307 307 ASP ASP A . n A 1 186 GLU 186 308 308 GLU GLU A . n A 1 187 LYS 187 309 309 LYS LYS A . n A 1 188 VAL 188 310 310 VAL VAL A . n A 1 189 ASP 189 311 311 ASP ASP A . n A 1 190 LEU 190 312 312 LEU LEU A . n A 1 191 TRP 191 313 313 TRP TRP A . n A 1 192 SER 192 314 314 SER SER A . n A 1 193 LEU 193 315 315 LEU LEU A . n A 1 194 GLY 194 316 316 GLY GLY A . n A 1 195 VAL 195 317 317 VAL VAL A . n A 1 196 LEU 196 318 318 LEU LEU A . n A 1 197 CYS 197 319 319 CYS CYS A . n A 1 198 TYR 198 320 320 TYR TYR A . n A 1 199 GLU 199 321 321 GLU GLU A . n A 1 200 PHE 200 322 322 PHE PHE A . n A 1 201 LEU 201 323 323 LEU LEU A . n A 1 202 VAL 202 324 324 VAL VAL A . n A 1 203 GLY 203 325 325 GLY GLY A . n A 1 204 LYS 204 326 326 LYS LYS A . n A 1 205 PRO 205 327 327 PRO PRO A . n A 1 206 PRO 206 328 328 PRO PRO A . n A 1 207 PHE 207 329 329 PHE PHE A . n A 1 208 GLU 208 330 330 GLU GLU A . n A 1 209 ALA 209 331 331 ALA ALA A . n A 1 210 ASN 210 332 332 ASN ASN A . n A 1 211 THR 211 333 333 THR THR A . n A 1 212 TYR 212 334 334 TYR TYR A . n A 1 213 GLN 213 335 335 GLN GLN A . n A 1 214 GLU 214 336 336 GLU GLU A . n A 1 215 THR 215 337 337 THR THR A . n A 1 216 TYR 216 338 338 TYR TYR A . n A 1 217 LYS 217 339 339 LYS LYS A . n A 1 218 ARG 218 340 340 ARG ARG A . n A 1 219 ILE 219 341 341 ILE ILE A . n A 1 220 SER 220 342 342 SER SER A . n A 1 221 ARG 221 343 343 ARG ARG A . n A 1 222 VAL 222 344 344 VAL VAL A . n A 1 223 GLU 223 345 345 GLU GLU A . n A 1 224 PHE 224 346 346 PHE PHE A . n A 1 225 THR 225 347 347 THR THR A . n A 1 226 PHE 226 348 348 PHE PHE A . n A 1 227 PRO 227 349 349 PRO PRO A . n A 1 228 ASP 228 350 350 ASP ASP A . n A 1 229 PHE 229 351 351 PHE PHE A . n A 1 230 VAL 230 352 352 VAL VAL A . n A 1 231 THR 231 353 353 THR THR A . n A 1 232 GLU 232 354 354 GLU GLU A . n A 1 233 GLY 233 355 355 GLY GLY A . n A 1 234 ALA 234 356 356 ALA ALA A . n A 1 235 ARG 235 357 357 ARG ARG A . n A 1 236 ASP 236 358 358 ASP ASP A . n A 1 237 LEU 237 359 359 LEU LEU A . n A 1 238 ILE 238 360 360 ILE ILE A . n A 1 239 SER 239 361 361 SER SER A . n A 1 240 ARG 240 362 362 ARG ARG A . n A 1 241 LEU 241 363 363 LEU LEU A . n A 1 242 LEU 242 364 364 LEU LEU A . n A 1 243 LYS 243 365 365 LYS LYS A . n A 1 244 HIS 244 366 366 HIS HIS A . n A 1 245 ASN 245 367 367 ASN ASN A . n A 1 246 PRO 246 368 368 PRO PRO A . n A 1 247 SER 247 369 369 SER SER A . n A 1 248 GLN 248 370 370 GLN GLN A . n A 1 249 ARG 249 371 371 ARG ARG A . n A 1 250 PRO 250 372 372 PRO PRO A . n A 1 251 MET 251 373 373 MET MET A . n A 1 252 LEU 252 374 374 LEU LEU A . n A 1 253 ARG 253 375 375 ARG ARG A . n A 1 254 GLU 254 376 376 GLU GLU A . n A 1 255 VAL 255 377 377 VAL VAL A . n A 1 256 LEU 256 378 378 LEU LEU A . n A 1 257 GLU 257 379 379 GLU GLU A . n A 1 258 HIS 258 380 380 HIS HIS A . n A 1 259 PRO 259 381 381 PRO PRO A . n A 1 260 TRP 260 382 382 TRP TRP A . n A 1 261 ILE 261 383 383 ILE ILE A . n A 1 262 THR 262 384 384 THR THR A . n A 1 263 ALA 263 385 385 ALA ALA A . n A 1 264 ASN 264 386 386 ASN ASN A . n A 1 265 SER 265 387 387 SER SER A . n A 1 266 SER 266 388 388 SER SER A . n A 1 267 LYS 267 389 389 LYS LYS A . n A 1 268 PRO 268 390 390 PRO PRO A . n A 1 269 SER 269 391 ? ? ? A . n A 1 270 ASN 270 392 ? ? ? A . n A 1 271 CYS 271 393 ? ? ? A . n A 1 272 GLN 272 394 ? ? ? A . n A 1 273 ASN 273 395 ? ? ? A . n A 1 274 LYS 274 396 ? ? ? A . n A 1 275 GLU 275 397 ? ? ? A . n A 1 276 SER 276 398 ? ? ? A . n A 1 277 ALA 277 399 ? ? ? A . n A 1 278 SER 278 400 ? ? ? A . n A 1 279 LYS 279 401 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-06-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 16.7460 _pdbx_refine_tls.origin_y 31.8160 _pdbx_refine_tls.origin_z 8.0050 _pdbx_refine_tls.T[1][1] 0.0533 _pdbx_refine_tls.T[2][2] 0.1110 _pdbx_refine_tls.T[3][3] 0.1197 _pdbx_refine_tls.T[1][2] 0.0202 _pdbx_refine_tls.T[1][3] -0.0167 _pdbx_refine_tls.T[2][3] -0.0101 _pdbx_refine_tls.L[1][1] 3.0617 _pdbx_refine_tls.L[2][2] 0.6775 _pdbx_refine_tls.L[3][3] 1.1970 _pdbx_refine_tls.L[1][2] 0.5326 _pdbx_refine_tls.L[1][3] -1.4504 _pdbx_refine_tls.L[2][3] -0.2040 _pdbx_refine_tls.S[1][1] 0.0095 _pdbx_refine_tls.S[2][2] 0.0022 _pdbx_refine_tls.S[3][3] -0.0118 _pdbx_refine_tls.S[1][2] -0.3344 _pdbx_refine_tls.S[1][3] -0.1906 _pdbx_refine_tls.S[2][3] -0.0252 _pdbx_refine_tls.S[2][1] 0.0407 _pdbx_refine_tls.S[3][1] 0.0829 _pdbx_refine_tls.S[3][2] 0.1905 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 126 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 390 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _pdbx_phasing_MR.entry_id 4JBP _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.690 _pdbx_phasing_MR.d_res_low_rotation 29.980 _pdbx_phasing_MR.d_res_high_translation 2.690 _pdbx_phasing_MR.d_res_low_translation 29.980 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 MOLREP . ? program 'Alexei Vaguine' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 4 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 7 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 8 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 226 ? ? 83.46 -58.05 2 1 ASP A 256 ? ? -149.37 37.78 3 1 ASP A 274 ? ? 63.38 95.52 4 1 ASP A 307 ? ? -144.48 -157.33 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 251 ? CG ? A ARG 129 CG 2 1 Y 1 A ARG 251 ? CD ? A ARG 129 CD 3 1 Y 1 A ARG 251 ? NE ? A ARG 129 NE 4 1 Y 1 A ARG 251 ? CZ ? A ARG 129 CZ 5 1 Y 1 A ARG 251 ? NH1 ? A ARG 129 NH1 6 1 Y 1 A ARG 251 ? NH2 ? A ARG 129 NH2 7 1 Y 1 A HIS 280 ? CG ? A HIS 158 CG 8 1 Y 1 A HIS 280 ? ND1 ? A HIS 158 ND1 9 1 Y 1 A HIS 280 ? CD2 ? A HIS 158 CD2 10 1 Y 1 A HIS 280 ? CE1 ? A HIS 158 CE1 11 1 Y 1 A HIS 280 ? NE2 ? A HIS 158 NE2 12 1 Y 1 A MET 305 ? CG ? A MET 183 CG 13 1 Y 1 A MET 305 ? SD ? A MET 183 SD 14 1 Y 1 A MET 305 ? CE ? A MET 183 CE 15 1 Y 1 A PRO 390 ? O ? A PRO 268 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 123 ? A SER 1 2 1 Y 1 A LYS 124 ? A LYS 2 3 1 Y 1 A LYS 125 ? A LYS 3 4 1 Y 1 A ALA 281 ? A ALA 159 5 1 Y 1 A PRO 282 ? A PRO 160 6 1 Y 1 A SER 283 ? A SER 161 7 1 Y 1 A SER 284 ? A SER 162 8 1 Y 1 A ARG 285 ? A ARG 163 9 1 Y 1 A ARG 286 ? A ARG 164 10 1 Y 1 A THR 287 ? A THR 165 11 1 Y 1 A ASP 288 ? A ASP 166 12 1 Y 1 A LEU 289 ? A LEU 167 13 1 Y 1 A CYS 290 ? A CYS 168 14 1 Y 1 A SER 391 ? A SER 269 15 1 Y 1 A ASN 392 ? A ASN 270 16 1 Y 1 A CYS 393 ? A CYS 271 17 1 Y 1 A GLN 394 ? A GLN 272 18 1 Y 1 A ASN 395 ? A ASN 273 19 1 Y 1 A LYS 396 ? A LYS 274 20 1 Y 1 A GLU 397 ? A GLU 275 21 1 Y 1 A SER 398 ? A SER 276 22 1 Y 1 A ALA 399 ? A ALA 277 23 1 Y 1 A SER 400 ? A SER 278 24 1 Y 1 A LYS 401 ? A LYS 279 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(4-{2-[(6-{4-[2-(4-hydroxypiperidin-1-yl)ethoxy]phenyl}furo[2,3-d]pyrimidin-4-yl)amino]ethyl}phenyl)-3-phenylurea' YPH 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 YPH 1 501 1 YPH UNL A . C 3 HOH 1 601 1 HOH HOH A . C 3 HOH 2 602 2 HOH HOH A . C 3 HOH 3 603 3 HOH HOH A . C 3 HOH 4 604 4 HOH HOH A . C 3 HOH 5 605 5 HOH HOH A . C 3 HOH 6 606 6 HOH HOH A . C 3 HOH 7 607 7 HOH HOH A . C 3 HOH 8 608 8 HOH HOH A . C 3 HOH 9 609 9 HOH HOH A . C 3 HOH 10 610 10 HOH HOH A . C 3 HOH 11 611 11 HOH HOH A . C 3 HOH 12 612 12 HOH HOH A . C 3 HOH 13 613 13 HOH HOH A . C 3 HOH 14 614 14 HOH HOH A . C 3 HOH 15 615 15 HOH HOH A . C 3 HOH 16 616 16 HOH HOH A . C 3 HOH 17 617 17 HOH HOH A . C 3 HOH 18 618 18 HOH HOH A . C 3 HOH 19 619 19 HOH HOH A . C 3 HOH 20 620 20 HOH HOH A . C 3 HOH 21 621 21 HOH HOH A . C 3 HOH 22 622 22 HOH HOH A . C 3 HOH 23 623 23 HOH HOH A . C 3 HOH 24 624 24 HOH HOH A . C 3 HOH 25 625 25 HOH HOH A . C 3 HOH 26 626 26 HOH HOH A . C 3 HOH 27 627 27 HOH HOH A . C 3 HOH 28 628 28 HOH HOH A . C 3 HOH 29 629 29 HOH HOH A . C 3 HOH 30 630 30 HOH HOH A . C 3 HOH 31 631 31 HOH HOH A . C 3 HOH 32 632 32 HOH HOH A . C 3 HOH 33 633 33 HOH HOH A . C 3 HOH 34 634 34 HOH HOH A . C 3 HOH 35 635 35 HOH HOH A . C 3 HOH 36 636 36 HOH HOH A . C 3 HOH 37 637 37 HOH HOH A . C 3 HOH 38 638 38 HOH HOH A . C 3 HOH 39 639 39 HOH HOH A . C 3 HOH 40 640 40 HOH HOH A . C 3 HOH 41 641 41 HOH HOH A . C 3 HOH 42 642 42 HOH HOH A . C 3 HOH 43 643 43 HOH HOH A . C 3 HOH 44 644 44 HOH HOH A . C 3 HOH 45 645 45 HOH HOH A . C 3 HOH 46 646 46 HOH HOH A . C 3 HOH 47 647 47 HOH HOH A . C 3 HOH 48 648 48 HOH HOH A . C 3 HOH 49 649 49 HOH HOH A . C 3 HOH 50 650 50 HOH HOH A . C 3 HOH 51 651 51 HOH HOH A . C 3 HOH 52 652 52 HOH HOH A . C 3 HOH 53 653 53 HOH HOH A . C 3 HOH 54 654 54 HOH HOH A . C 3 HOH 55 655 55 HOH HOH A . C 3 HOH 56 656 56 HOH HOH A . C 3 HOH 57 657 57 HOH HOH A . C 3 HOH 58 658 58 HOH HOH A . C 3 HOH 59 659 59 HOH HOH A . #