data_4JQ8 # _entry.id 4JQ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4JQ8 RCSB RCSB078366 WWPDB D_1000078366 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4JQ7 . unspecified PDB 4JR3 . unspecified PDB 4JRV . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4JQ8 _pdbx_database_status.recvd_initial_deposition_date 2013-03-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Peng, Y.H.' 1 'Wu, J.S.' 2 # _citation.id primary _citation.title ;Protein Kinase Inhibitor Design by Targeting the Asp-Phe-Gly (DFG) Motif: The Role of the DFG Motif in the Design of Epidermal Growth Factor Receptor Inhibitors ; _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 56 _citation.page_first 3889 _citation.page_last 3903 _citation.year 2013 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23611691 _citation.pdbx_database_id_DOI 10.1021/jm400072p # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Peng, Y.H.' 1 primary 'Shiao, H.Y.' 2 primary 'Tu, C.H.' 3 primary 'Liu, P.M.' 4 primary 'Hsu, J.T.' 5 primary 'Amancha, P.K.' 6 primary 'Wu, J.S.' 7 primary 'Coumar, M.S.' 8 primary 'Chen, C.H.' 9 primary 'Wang, S.Y.' 10 primary 'Lin, W.H.' 11 primary 'Sun, H.Y.' 12 primary 'Chao, Y.S.' 13 primary 'Lyu, P.C.' 14 primary 'Hsieh, H.P.' 15 primary 'Wu, S.Y.' 16 # _cell.entry_id 4JQ8 _cell.length_a 146.745 _cell.length_b 146.745 _cell.length_c 146.745 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4JQ8 _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37401.250 1 2.7.10.1 ? 'tyrosine kinase domain, UNP residues 696-1021' ? 2 non-polymer syn 'N-[3-(4-{[(1S)-2-hydroxy-1-phenylethyl]amino}-6-phenylfuro[2,3-d]pyrimidin-5-yl)phenyl]-N~3~,N~3~-dimethyl-beta-alaninamide' 521.610 1 ? ? ? ? 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL PQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA DEYLIPQQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL PQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA DEYLIPQQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 GLU n 1 5 ALA n 1 6 PRO n 1 7 ASN n 1 8 GLN n 1 9 ALA n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 LEU n 1 15 LYS n 1 16 GLU n 1 17 THR n 1 18 GLU n 1 19 PHE n 1 20 LYS n 1 21 LYS n 1 22 ILE n 1 23 LYS n 1 24 VAL n 1 25 LEU n 1 26 GLY n 1 27 SER n 1 28 GLY n 1 29 ALA n 1 30 PHE n 1 31 GLY n 1 32 THR n 1 33 VAL n 1 34 TYR n 1 35 LYS n 1 36 GLY n 1 37 LEU n 1 38 TRP n 1 39 ILE n 1 40 PRO n 1 41 GLU n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 VAL n 1 46 LYS n 1 47 ILE n 1 48 PRO n 1 49 VAL n 1 50 ALA n 1 51 ILE n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 ARG n 1 56 GLU n 1 57 ALA n 1 58 THR n 1 59 SER n 1 60 PRO n 1 61 LYS n 1 62 ALA n 1 63 ASN n 1 64 LYS n 1 65 GLU n 1 66 ILE n 1 67 LEU n 1 68 ASP n 1 69 GLU n 1 70 ALA n 1 71 TYR n 1 72 VAL n 1 73 MET n 1 74 ALA n 1 75 SER n 1 76 VAL n 1 77 ASP n 1 78 ASN n 1 79 PRO n 1 80 HIS n 1 81 VAL n 1 82 CYS n 1 83 ARG n 1 84 LEU n 1 85 LEU n 1 86 GLY n 1 87 ILE n 1 88 CYS n 1 89 LEU n 1 90 THR n 1 91 SER n 1 92 THR n 1 93 VAL n 1 94 GLN n 1 95 LEU n 1 96 ILE n 1 97 THR n 1 98 GLN n 1 99 LEU n 1 100 MET n 1 101 PRO n 1 102 PHE n 1 103 GLY n 1 104 CYS n 1 105 LEU n 1 106 LEU n 1 107 ASP n 1 108 TYR n 1 109 VAL n 1 110 ARG n 1 111 GLU n 1 112 HIS n 1 113 LYS n 1 114 ASP n 1 115 ASN n 1 116 ILE n 1 117 GLY n 1 118 SER n 1 119 GLN n 1 120 TYR n 1 121 LEU n 1 122 LEU n 1 123 ASN n 1 124 TRP n 1 125 CYS n 1 126 VAL n 1 127 GLN n 1 128 ILE n 1 129 ALA n 1 130 LYS n 1 131 GLY n 1 132 MET n 1 133 ASN n 1 134 TYR n 1 135 LEU n 1 136 GLU n 1 137 ASP n 1 138 ARG n 1 139 ARG n 1 140 LEU n 1 141 VAL n 1 142 HIS n 1 143 ARG n 1 144 ASP n 1 145 LEU n 1 146 ALA n 1 147 ALA n 1 148 ARG n 1 149 ASN n 1 150 VAL n 1 151 LEU n 1 152 VAL n 1 153 LYS n 1 154 THR n 1 155 PRO n 1 156 GLN n 1 157 HIS n 1 158 VAL n 1 159 LYS n 1 160 ILE n 1 161 THR n 1 162 ASP n 1 163 PHE n 1 164 GLY n 1 165 LEU n 1 166 ALA n 1 167 LYS n 1 168 LEU n 1 169 LEU n 1 170 GLY n 1 171 ALA n 1 172 GLU n 1 173 GLU n 1 174 LYS n 1 175 GLU n 1 176 TYR n 1 177 HIS n 1 178 ALA n 1 179 GLU n 1 180 GLY n 1 181 GLY n 1 182 LYS n 1 183 VAL n 1 184 PRO n 1 185 ILE n 1 186 LYS n 1 187 TRP n 1 188 MET n 1 189 ALA n 1 190 LEU n 1 191 GLU n 1 192 SER n 1 193 ILE n 1 194 LEU n 1 195 HIS n 1 196 ARG n 1 197 ILE n 1 198 TYR n 1 199 THR n 1 200 HIS n 1 201 GLN n 1 202 SER n 1 203 ASP n 1 204 VAL n 1 205 TRP n 1 206 SER n 1 207 TYR n 1 208 GLY n 1 209 VAL n 1 210 THR n 1 211 VAL n 1 212 TRP n 1 213 GLU n 1 214 LEU n 1 215 MET n 1 216 THR n 1 217 PHE n 1 218 GLY n 1 219 SER n 1 220 LYS n 1 221 PRO n 1 222 TYR n 1 223 ASP n 1 224 GLY n 1 225 ILE n 1 226 PRO n 1 227 ALA n 1 228 SER n 1 229 GLU n 1 230 ILE n 1 231 SER n 1 232 SER n 1 233 ILE n 1 234 LEU n 1 235 GLU n 1 236 LYS n 1 237 GLY n 1 238 GLU n 1 239 ARG n 1 240 LEU n 1 241 PRO n 1 242 GLN n 1 243 PRO n 1 244 PRO n 1 245 ILE n 1 246 CYS n 1 247 THR n 1 248 ILE n 1 249 ASP n 1 250 VAL n 1 251 TYR n 1 252 MET n 1 253 ILE n 1 254 MET n 1 255 VAL n 1 256 LYS n 1 257 CYS n 1 258 TRP n 1 259 MET n 1 260 ILE n 1 261 ASP n 1 262 ALA n 1 263 ASP n 1 264 SER n 1 265 ARG n 1 266 PRO n 1 267 LYS n 1 268 PHE n 1 269 ARG n 1 270 GLU n 1 271 LEU n 1 272 ILE n 1 273 ILE n 1 274 GLU n 1 275 PHE n 1 276 SER n 1 277 LYS n 1 278 MET n 1 279 ALA n 1 280 ARG n 1 281 ASP n 1 282 PRO n 1 283 GLN n 1 284 ARG n 1 285 TYR n 1 286 LEU n 1 287 VAL n 1 288 ILE n 1 289 GLN n 1 290 GLY n 1 291 ASP n 1 292 GLU n 1 293 ARG n 1 294 MET n 1 295 HIS n 1 296 LEU n 1 297 PRO n 1 298 SER n 1 299 PRO n 1 300 THR n 1 301 ASP n 1 302 SER n 1 303 ASN n 1 304 PHE n 1 305 TYR n 1 306 ARG n 1 307 ALA n 1 308 LEU n 1 309 MET n 1 310 ASP n 1 311 GLU n 1 312 GLU n 1 313 ASP n 1 314 MET n 1 315 ASP n 1 316 ASP n 1 317 VAL n 1 318 VAL n 1 319 ASP n 1 320 ALA n 1 321 ASP n 1 322 GLU n 1 323 TYR n 1 324 LEU n 1 325 ILE n 1 326 PRO n 1 327 GLN n 1 328 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EGFR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Hi5 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBacPAK-MT-EGFP _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQ ; _struct_ref.pdbx_align_begin 696 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4JQ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 328 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 696 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1021 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 672 _struct_ref_seq.pdbx_auth_seq_align_end 997 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4JQ8 GLY A 1 ? UNP P00533 ? ? 'EXPRESSION TAG' 670 1 1 4JQ8 PRO A 2 ? UNP P00533 ? ? 'EXPRESSION TAG' 671 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KJ8 non-polymer . 'N-[3-(4-{[(1S)-2-hydroxy-1-phenylethyl]amino}-6-phenylfuro[2,3-d]pyrimidin-5-yl)phenyl]-N~3~,N~3~-dimethyl-beta-alaninamide' ? 'C31 H31 N5 O3' 521.610 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4JQ8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.52 _exptl_crystal.density_percent_sol 65.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '1.0M Ammonium citrate tribase, 0.1M Bis-Tris propane, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2011-06-23 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL12B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL12B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 4JQ8 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.83 _reflns.number_obs 12717 _reflns.number_all 12717 _reflns.percent_possible_obs 97.6 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.05 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 16.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.83 _reflns_shell.d_res_low 2.93 _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_obs 0.484 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.14 _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1240 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4JQ8 _refine.ls_number_reflns_obs 11766 _refine.ls_number_reflns_all 12717 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 2.83 _refine.ls_percent_reflns_obs 97.53 _refine.ls_R_factor_obs 0.18591 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18348 _refine.ls_R_factor_R_free 0.23233 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 608 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.920 _refine.B_iso_mean 60.045 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 1.10 _refine.pdbx_solvent_shrinkage_radii 1.10 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB entry 1M17' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.610 _refine.pdbx_overall_ESU_R_Free 0.309 _refine.overall_SU_ML 0.228 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 25.419 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2409 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 2469 _refine_hist.d_res_high 2.83 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.010 0.020 ? 2504 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.003 0.020 ? 1720 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.265 1.994 ? 3391 ? 'X-RAY DIFFRACTION' r_angle_other_deg 1.061 3.005 ? 4205 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 5.828 5.000 ? 301 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 37.610 24.286 ? 105 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.424 15.000 ? 449 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 11.081 15.000 ? 14 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.071 0.200 ? 374 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.005 0.021 ? 2718 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.002 0.020 ? 491 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.829 _refine_ls_shell.d_res_low 2.903 _refine_ls_shell.number_reflns_R_work 814 _refine_ls_shell.R_factor_R_work 0.303 _refine_ls_shell.percent_reflns_obs 99.20 _refine_ls_shell.R_factor_R_free 0.348 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 4JQ8 _struct.title 'Crystal structure of EGFR kinase domain in complex with compound 4b' _struct.pdbx_descriptor 'Epidermal growth factor receptor (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4JQ8 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'Transferase, tyrosine kinase domain, ATP-binding domain, autophosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 15 ? THR A 17 ? LYS A 684 THR A 686 5 ? 3 HELX_P HELX_P2 2 SER A 59 ? SER A 75 ? SER A 728 SER A 744 1 ? 17 HELX_P HELX_P3 3 CYS A 104 ? GLU A 111 ? CYS A 773 GLU A 780 1 ? 8 HELX_P HELX_P4 4 HIS A 112 ? ILE A 116 ? HIS A 781 ILE A 785 5 ? 5 HELX_P HELX_P5 5 GLY A 117 ? ARG A 138 ? GLY A 786 ARG A 807 1 ? 22 HELX_P HELX_P6 6 ALA A 146 ? ARG A 148 ? ALA A 815 ARG A 817 5 ? 3 HELX_P HELX_P7 7 PRO A 184 ? MET A 188 ? PRO A 853 MET A 857 5 ? 5 HELX_P HELX_P8 8 ALA A 189 ? ARG A 196 ? ALA A 858 ARG A 865 1 ? 8 HELX_P HELX_P9 9 THR A 199 ? THR A 216 ? THR A 868 THR A 885 1 ? 18 HELX_P HELX_P10 10 PRO A 226 ? GLY A 237 ? PRO A 895 GLY A 906 1 ? 12 HELX_P HELX_P11 11 THR A 247 ? TRP A 258 ? THR A 916 TRP A 927 1 ? 12 HELX_P HELX_P12 12 ASP A 261 ? ARG A 265 ? ASP A 930 ARG A 934 5 ? 5 HELX_P HELX_P13 13 LYS A 267 ? ARG A 280 ? LYS A 936 ARG A 949 1 ? 14 HELX_P HELX_P14 14 ASP A 281 ? TYR A 285 ? ASP A 950 TYR A 954 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 13 ? LEU A 14 ? ILE A 682 LEU A 683 A 2 LEU A 84 ? LEU A 89 ? LEU A 753 LEU A 758 A 3 VAL A 93 ? GLN A 98 ? VAL A 762 GLN A 767 A 4 ILE A 47 ? GLU A 53 ? ILE A 716 GLU A 722 A 5 THR A 32 ? TRP A 38 ? THR A 701 TRP A 707 A 6 PHE A 19 ? GLY A 26 ? PHE A 688 GLY A 695 B 1 LEU A 140 ? VAL A 141 ? LEU A 809 VAL A 810 B 2 LYS A 167 ? LEU A 168 ? LYS A 836 LEU A 837 C 1 VAL A 150 ? THR A 154 ? VAL A 819 THR A 823 C 2 HIS A 157 ? ILE A 160 ? HIS A 826 ILE A 829 D 1 TYR A 176 ? HIS A 177 ? TYR A 845 HIS A 846 D 2 ILE A 197 ? TYR A 198 ? ILE A 866 TYR A 867 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 14 ? N LEU A 683 O ILE A 87 ? O ILE A 756 A 2 3 N LEU A 85 ? N LEU A 754 O ILE A 96 ? O ILE A 765 A 3 4 O LEU A 95 ? O LEU A 764 N LYS A 52 ? N LYS A 721 A 4 5 O ILE A 47 ? O ILE A 716 N TRP A 38 ? N TRP A 707 A 5 6 O LYS A 35 ? O LYS A 704 N ILE A 22 ? N ILE A 691 B 1 2 N VAL A 141 ? N VAL A 810 O LYS A 167 ? O LYS A 836 C 1 2 N LEU A 151 ? N LEU A 820 O LYS A 159 ? O LYS A 828 D 1 2 N TYR A 176 ? N TYR A 845 O TYR A 198 ? O TYR A 867 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'BINDING SITE FOR RESIDUE KJ8 A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 PHE A 30 ? PHE A 699 . ? 1_555 ? 2 AC1 12 VAL A 33 ? VAL A 702 . ? 1_555 ? 3 AC1 12 ALA A 50 ? ALA A 719 . ? 1_555 ? 4 AC1 12 LYS A 52 ? LYS A 721 . ? 1_555 ? 5 AC1 12 THR A 97 ? THR A 766 . ? 1_555 ? 6 AC1 12 GLN A 98 ? GLN A 767 . ? 1_555 ? 7 AC1 12 MET A 100 ? MET A 769 . ? 1_555 ? 8 AC1 12 PRO A 101 ? PRO A 770 . ? 1_555 ? 9 AC1 12 ARG A 148 ? ARG A 817 . ? 1_555 ? 10 AC1 12 ASN A 149 ? ASN A 818 . ? 1_555 ? 11 AC1 12 LEU A 151 ? LEU A 820 . ? 1_555 ? 12 AC1 12 ASP A 162 ? ASP A 831 . ? 1_555 ? # _database_PDB_matrix.entry_id 4JQ8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4JQ8 _atom_sites.fract_transf_matrix[1][1] 0.006815 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006815 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006815 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 670 ? ? ? A . n A 1 2 PRO 2 671 ? ? ? A . n A 1 3 GLY 3 672 672 GLY GLY A . n A 1 4 GLU 4 673 673 GLU GLU A . n A 1 5 ALA 5 674 674 ALA ALA A . n A 1 6 PRO 6 675 675 PRO PRO A . n A 1 7 ASN 7 676 676 ASN ASN A . n A 1 8 GLN 8 677 677 GLN GLN A . n A 1 9 ALA 9 678 678 ALA ALA A . n A 1 10 LEU 10 679 679 LEU LEU A . n A 1 11 LEU 11 680 680 LEU LEU A . n A 1 12 ARG 12 681 681 ARG ARG A . n A 1 13 ILE 13 682 682 ILE ILE A . n A 1 14 LEU 14 683 683 LEU LEU A . n A 1 15 LYS 15 684 684 LYS LYS A . n A 1 16 GLU 16 685 685 GLU GLU A . n A 1 17 THR 17 686 686 THR THR A . n A 1 18 GLU 18 687 687 GLU GLU A . n A 1 19 PHE 19 688 688 PHE PHE A . n A 1 20 LYS 20 689 689 LYS LYS A . n A 1 21 LYS 21 690 690 LYS LYS A . n A 1 22 ILE 22 691 691 ILE ILE A . n A 1 23 LYS 23 692 692 LYS LYS A . n A 1 24 VAL 24 693 693 VAL VAL A . n A 1 25 LEU 25 694 694 LEU LEU A . n A 1 26 GLY 26 695 695 GLY GLY A . n A 1 27 SER 27 696 696 SER SER A . n A 1 28 GLY 28 697 697 GLY GLY A . n A 1 29 ALA 29 698 698 ALA ALA A . n A 1 30 PHE 30 699 699 PHE PHE A . n A 1 31 GLY 31 700 700 GLY GLY A . n A 1 32 THR 32 701 701 THR THR A . n A 1 33 VAL 33 702 702 VAL VAL A . n A 1 34 TYR 34 703 703 TYR TYR A . n A 1 35 LYS 35 704 704 LYS LYS A . n A 1 36 GLY 36 705 705 GLY GLY A . n A 1 37 LEU 37 706 706 LEU LEU A . n A 1 38 TRP 38 707 707 TRP TRP A . n A 1 39 ILE 39 708 708 ILE ILE A . n A 1 40 PRO 40 709 709 PRO PRO A . n A 1 41 GLU 41 710 710 GLU GLU A . n A 1 42 GLY 42 711 711 GLY GLY A . n A 1 43 GLU 43 712 712 GLU GLU A . n A 1 44 LYS 44 713 713 LYS LYS A . n A 1 45 VAL 45 714 714 VAL VAL A . n A 1 46 LYS 46 715 715 LYS LYS A . n A 1 47 ILE 47 716 716 ILE ILE A . n A 1 48 PRO 48 717 717 PRO PRO A . n A 1 49 VAL 49 718 718 VAL VAL A . n A 1 50 ALA 50 719 719 ALA ALA A . n A 1 51 ILE 51 720 720 ILE ILE A . n A 1 52 LYS 52 721 721 LYS LYS A . n A 1 53 GLU 53 722 722 GLU GLU A . n A 1 54 LEU 54 723 723 LEU LEU A . n A 1 55 ARG 55 724 724 ARG ARG A . n A 1 56 GLU 56 725 725 GLU GLU A . n A 1 57 ALA 57 726 726 ALA ALA A . n A 1 58 THR 58 727 727 THR THR A . n A 1 59 SER 59 728 728 SER SER A . n A 1 60 PRO 60 729 729 PRO PRO A . n A 1 61 LYS 61 730 730 LYS LYS A . n A 1 62 ALA 62 731 731 ALA ALA A . n A 1 63 ASN 63 732 732 ASN ASN A . n A 1 64 LYS 64 733 733 LYS LYS A . n A 1 65 GLU 65 734 734 GLU GLU A . n A 1 66 ILE 66 735 735 ILE ILE A . n A 1 67 LEU 67 736 736 LEU LEU A . n A 1 68 ASP 68 737 737 ASP ASP A . n A 1 69 GLU 69 738 738 GLU GLU A . n A 1 70 ALA 70 739 739 ALA ALA A . n A 1 71 TYR 71 740 740 TYR TYR A . n A 1 72 VAL 72 741 741 VAL VAL A . n A 1 73 MET 73 742 742 MET MET A . n A 1 74 ALA 74 743 743 ALA ALA A . n A 1 75 SER 75 744 744 SER SER A . n A 1 76 VAL 76 745 745 VAL VAL A . n A 1 77 ASP 77 746 746 ASP ASP A . n A 1 78 ASN 78 747 747 ASN ASN A . n A 1 79 PRO 79 748 748 PRO PRO A . n A 1 80 HIS 80 749 749 HIS HIS A . n A 1 81 VAL 81 750 750 VAL VAL A . n A 1 82 CYS 82 751 751 CYS CYS A . n A 1 83 ARG 83 752 752 ARG ARG A . n A 1 84 LEU 84 753 753 LEU LEU A . n A 1 85 LEU 85 754 754 LEU LEU A . n A 1 86 GLY 86 755 755 GLY GLY A . n A 1 87 ILE 87 756 756 ILE ILE A . n A 1 88 CYS 88 757 757 CYS CYS A . n A 1 89 LEU 89 758 758 LEU LEU A . n A 1 90 THR 90 759 759 THR THR A . n A 1 91 SER 91 760 760 SER SER A . n A 1 92 THR 92 761 761 THR THR A . n A 1 93 VAL 93 762 762 VAL VAL A . n A 1 94 GLN 94 763 763 GLN GLN A . n A 1 95 LEU 95 764 764 LEU LEU A . n A 1 96 ILE 96 765 765 ILE ILE A . n A 1 97 THR 97 766 766 THR THR A . n A 1 98 GLN 98 767 767 GLN GLN A . n A 1 99 LEU 99 768 768 LEU LEU A . n A 1 100 MET 100 769 769 MET MET A . n A 1 101 PRO 101 770 770 PRO PRO A . n A 1 102 PHE 102 771 771 PHE PHE A . n A 1 103 GLY 103 772 772 GLY GLY A . n A 1 104 CYS 104 773 773 CYS CYS A . n A 1 105 LEU 105 774 774 LEU LEU A . n A 1 106 LEU 106 775 775 LEU LEU A . n A 1 107 ASP 107 776 776 ASP ASP A . n A 1 108 TYR 108 777 777 TYR TYR A . n A 1 109 VAL 109 778 778 VAL VAL A . n A 1 110 ARG 110 779 779 ARG ARG A . n A 1 111 GLU 111 780 780 GLU GLU A . n A 1 112 HIS 112 781 781 HIS HIS A . n A 1 113 LYS 113 782 782 LYS LYS A . n A 1 114 ASP 114 783 783 ASP ASP A . n A 1 115 ASN 115 784 784 ASN ASN A . n A 1 116 ILE 116 785 785 ILE ILE A . n A 1 117 GLY 117 786 786 GLY GLY A . n A 1 118 SER 118 787 787 SER SER A . n A 1 119 GLN 119 788 788 GLN GLN A . n A 1 120 TYR 120 789 789 TYR TYR A . n A 1 121 LEU 121 790 790 LEU LEU A . n A 1 122 LEU 122 791 791 LEU LEU A . n A 1 123 ASN 123 792 792 ASN ASN A . n A 1 124 TRP 124 793 793 TRP TRP A . n A 1 125 CYS 125 794 794 CYS CYS A . n A 1 126 VAL 126 795 795 VAL VAL A . n A 1 127 GLN 127 796 796 GLN GLN A . n A 1 128 ILE 128 797 797 ILE ILE A . n A 1 129 ALA 129 798 798 ALA ALA A . n A 1 130 LYS 130 799 799 LYS LYS A . n A 1 131 GLY 131 800 800 GLY GLY A . n A 1 132 MET 132 801 801 MET MET A . n A 1 133 ASN 133 802 802 ASN ASN A . n A 1 134 TYR 134 803 803 TYR TYR A . n A 1 135 LEU 135 804 804 LEU LEU A . n A 1 136 GLU 136 805 805 GLU GLU A . n A 1 137 ASP 137 806 806 ASP ASP A . n A 1 138 ARG 138 807 807 ARG ARG A . n A 1 139 ARG 139 808 808 ARG ARG A . n A 1 140 LEU 140 809 809 LEU LEU A . n A 1 141 VAL 141 810 810 VAL VAL A . n A 1 142 HIS 142 811 811 HIS HIS A . n A 1 143 ARG 143 812 812 ARG ARG A . n A 1 144 ASP 144 813 813 ASP ASP A . n A 1 145 LEU 145 814 814 LEU LEU A . n A 1 146 ALA 146 815 815 ALA ALA A . n A 1 147 ALA 147 816 816 ALA ALA A . n A 1 148 ARG 148 817 817 ARG ARG A . n A 1 149 ASN 149 818 818 ASN ASN A . n A 1 150 VAL 150 819 819 VAL VAL A . n A 1 151 LEU 151 820 820 LEU LEU A . n A 1 152 VAL 152 821 821 VAL VAL A . n A 1 153 LYS 153 822 822 LYS LYS A . n A 1 154 THR 154 823 823 THR THR A . n A 1 155 PRO 155 824 824 PRO PRO A . n A 1 156 GLN 156 825 825 GLN GLN A . n A 1 157 HIS 157 826 826 HIS HIS A . n A 1 158 VAL 158 827 827 VAL VAL A . n A 1 159 LYS 159 828 828 LYS LYS A . n A 1 160 ILE 160 829 829 ILE ILE A . n A 1 161 THR 161 830 830 THR THR A . n A 1 162 ASP 162 831 831 ASP ASP A . n A 1 163 PHE 163 832 832 PHE PHE A . n A 1 164 GLY 164 833 833 GLY GLY A . n A 1 165 LEU 165 834 834 LEU LEU A . n A 1 166 ALA 166 835 835 ALA ALA A . n A 1 167 LYS 167 836 836 LYS LYS A . n A 1 168 LEU 168 837 837 LEU LEU A . n A 1 169 LEU 169 838 838 LEU LEU A . n A 1 170 GLY 170 839 839 GLY GLY A . n A 1 171 ALA 171 840 840 ALA ALA A . n A 1 172 GLU 172 841 841 GLU GLU A . n A 1 173 GLU 173 842 842 GLU GLU A . n A 1 174 LYS 174 843 843 LYS LYS A . n A 1 175 GLU 175 844 844 GLU GLU A . n A 1 176 TYR 176 845 845 TYR TYR A . n A 1 177 HIS 177 846 846 HIS HIS A . n A 1 178 ALA 178 847 847 ALA ALA A . n A 1 179 GLU 179 848 848 GLU GLU A . n A 1 180 GLY 180 849 849 GLY GLY A . n A 1 181 GLY 181 850 850 GLY GLY A . n A 1 182 LYS 182 851 851 LYS LYS A . n A 1 183 VAL 183 852 852 VAL VAL A . n A 1 184 PRO 184 853 853 PRO PRO A . n A 1 185 ILE 185 854 854 ILE ILE A . n A 1 186 LYS 186 855 855 LYS LYS A . n A 1 187 TRP 187 856 856 TRP TRP A . n A 1 188 MET 188 857 857 MET MET A . n A 1 189 ALA 189 858 858 ALA ALA A . n A 1 190 LEU 190 859 859 LEU LEU A . n A 1 191 GLU 191 860 860 GLU GLU A . n A 1 192 SER 192 861 861 SER SER A . n A 1 193 ILE 193 862 862 ILE ILE A . n A 1 194 LEU 194 863 863 LEU LEU A . n A 1 195 HIS 195 864 864 HIS HIS A . n A 1 196 ARG 196 865 865 ARG ARG A . n A 1 197 ILE 197 866 866 ILE ILE A . n A 1 198 TYR 198 867 867 TYR TYR A . n A 1 199 THR 199 868 868 THR THR A . n A 1 200 HIS 200 869 869 HIS HIS A . n A 1 201 GLN 201 870 870 GLN GLN A . n A 1 202 SER 202 871 871 SER SER A . n A 1 203 ASP 203 872 872 ASP ASP A . n A 1 204 VAL 204 873 873 VAL VAL A . n A 1 205 TRP 205 874 874 TRP TRP A . n A 1 206 SER 206 875 875 SER SER A . n A 1 207 TYR 207 876 876 TYR TYR A . n A 1 208 GLY 208 877 877 GLY GLY A . n A 1 209 VAL 209 878 878 VAL VAL A . n A 1 210 THR 210 879 879 THR THR A . n A 1 211 VAL 211 880 880 VAL VAL A . n A 1 212 TRP 212 881 881 TRP TRP A . n A 1 213 GLU 213 882 882 GLU GLU A . n A 1 214 LEU 214 883 883 LEU LEU A . n A 1 215 MET 215 884 884 MET MET A . n A 1 216 THR 216 885 885 THR THR A . n A 1 217 PHE 217 886 886 PHE PHE A . n A 1 218 GLY 218 887 887 GLY GLY A . n A 1 219 SER 219 888 888 SER SER A . n A 1 220 LYS 220 889 889 LYS LYS A . n A 1 221 PRO 221 890 890 PRO PRO A . n A 1 222 TYR 222 891 891 TYR TYR A . n A 1 223 ASP 223 892 892 ASP ASP A . n A 1 224 GLY 224 893 893 GLY GLY A . n A 1 225 ILE 225 894 894 ILE ILE A . n A 1 226 PRO 226 895 895 PRO PRO A . n A 1 227 ALA 227 896 896 ALA ALA A . n A 1 228 SER 228 897 897 SER SER A . n A 1 229 GLU 229 898 898 GLU GLU A . n A 1 230 ILE 230 899 899 ILE ILE A . n A 1 231 SER 231 900 900 SER SER A . n A 1 232 SER 232 901 901 SER SER A . n A 1 233 ILE 233 902 902 ILE ILE A . n A 1 234 LEU 234 903 903 LEU LEU A . n A 1 235 GLU 235 904 904 GLU GLU A . n A 1 236 LYS 236 905 905 LYS LYS A . n A 1 237 GLY 237 906 906 GLY GLY A . n A 1 238 GLU 238 907 907 GLU GLU A . n A 1 239 ARG 239 908 908 ARG ARG A . n A 1 240 LEU 240 909 909 LEU LEU A . n A 1 241 PRO 241 910 910 PRO PRO A . n A 1 242 GLN 242 911 911 GLN GLN A . n A 1 243 PRO 243 912 912 PRO PRO A . n A 1 244 PRO 244 913 913 PRO PRO A . n A 1 245 ILE 245 914 914 ILE ILE A . n A 1 246 CYS 246 915 915 CYS CYS A . n A 1 247 THR 247 916 916 THR THR A . n A 1 248 ILE 248 917 917 ILE ILE A . n A 1 249 ASP 249 918 918 ASP ASP A . n A 1 250 VAL 250 919 919 VAL VAL A . n A 1 251 TYR 251 920 920 TYR TYR A . n A 1 252 MET 252 921 921 MET MET A . n A 1 253 ILE 253 922 922 ILE ILE A . n A 1 254 MET 254 923 923 MET MET A . n A 1 255 VAL 255 924 924 VAL VAL A . n A 1 256 LYS 256 925 925 LYS LYS A . n A 1 257 CYS 257 926 926 CYS CYS A . n A 1 258 TRP 258 927 927 TRP TRP A . n A 1 259 MET 259 928 928 MET MET A . n A 1 260 ILE 260 929 929 ILE ILE A . n A 1 261 ASP 261 930 930 ASP ASP A . n A 1 262 ALA 262 931 931 ALA ALA A . n A 1 263 ASP 263 932 932 ASP ASP A . n A 1 264 SER 264 933 933 SER SER A . n A 1 265 ARG 265 934 934 ARG ARG A . n A 1 266 PRO 266 935 935 PRO PRO A . n A 1 267 LYS 267 936 936 LYS LYS A . n A 1 268 PHE 268 937 937 PHE PHE A . n A 1 269 ARG 269 938 938 ARG ARG A . n A 1 270 GLU 270 939 939 GLU GLU A . n A 1 271 LEU 271 940 940 LEU LEU A . n A 1 272 ILE 272 941 941 ILE ILE A . n A 1 273 ILE 273 942 942 ILE ILE A . n A 1 274 GLU 274 943 943 GLU GLU A . n A 1 275 PHE 275 944 944 PHE PHE A . n A 1 276 SER 276 945 945 SER SER A . n A 1 277 LYS 277 946 946 LYS LYS A . n A 1 278 MET 278 947 947 MET MET A . n A 1 279 ALA 279 948 948 ALA ALA A . n A 1 280 ARG 280 949 949 ARG ARG A . n A 1 281 ASP 281 950 950 ASP ASP A . n A 1 282 PRO 282 951 951 PRO PRO A . n A 1 283 GLN 283 952 952 GLN GLN A . n A 1 284 ARG 284 953 953 ARG ARG A . n A 1 285 TYR 285 954 954 TYR TYR A . n A 1 286 LEU 286 955 955 LEU LEU A . n A 1 287 VAL 287 956 956 VAL VAL A . n A 1 288 ILE 288 957 957 ILE ILE A . n A 1 289 GLN 289 958 958 GLN GLN A . n A 1 290 GLY 290 959 959 GLY GLY A . n A 1 291 ASP 291 960 960 ASP ASP A . n A 1 292 GLU 292 961 ? ? ? A . n A 1 293 ARG 293 962 ? ? ? A . n A 1 294 MET 294 963 ? ? ? A . n A 1 295 HIS 295 964 ? ? ? A . n A 1 296 LEU 296 965 ? ? ? A . n A 1 297 PRO 297 966 ? ? ? A . n A 1 298 SER 298 967 ? ? ? A . n A 1 299 PRO 299 968 ? ? ? A . n A 1 300 THR 300 969 ? ? ? A . n A 1 301 ASP 301 970 ? ? ? A . n A 1 302 SER 302 971 ? ? ? A . n A 1 303 ASN 303 972 ? ? ? A . n A 1 304 PHE 304 973 ? ? ? A . n A 1 305 TYR 305 974 ? ? ? A . n A 1 306 ARG 306 975 ? ? ? A . n A 1 307 ALA 307 976 ? ? ? A . n A 1 308 LEU 308 977 ? ? ? A . n A 1 309 MET 309 978 ? ? ? A . n A 1 310 ASP 310 979 ? ? ? A . n A 1 311 GLU 311 980 ? ? ? A . n A 1 312 GLU 312 981 ? ? ? A . n A 1 313 ASP 313 982 982 ASP ASP A . n A 1 314 MET 314 983 983 MET MET A . n A 1 315 ASP 315 984 984 ASP ASP A . n A 1 316 ASP 316 985 985 ASP ASP A . n A 1 317 VAL 317 986 986 VAL VAL A . n A 1 318 VAL 318 987 987 VAL VAL A . n A 1 319 ASP 319 988 988 ASP ASP A . n A 1 320 ALA 320 989 989 ALA ALA A . n A 1 321 ASP 321 990 990 ASP ASP A . n A 1 322 GLU 322 991 991 GLU GLU A . n A 1 323 TYR 323 992 992 TYR TYR A . n A 1 324 LEU 324 993 993 LEU LEU A . n A 1 325 ILE 325 994 994 ILE ILE A . n A 1 326 PRO 326 995 995 PRO PRO A . n A 1 327 GLN 327 996 ? ? ? A . n A 1 328 GLN 328 997 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1970 ? 1 MORE -8 ? 1 'SSA (A^2)' 30580 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_775 -x+2,-y+2,z -1.0000000000 0.0000000000 0.0000000000 293.4900000000 0.0000000000 -1.0000000000 0.0000000000 293.4900000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 156.6700 _pdbx_refine_tls.origin_y 122.7300 _pdbx_refine_tls.origin_z 205.7720 _pdbx_refine_tls.T[1][1] 0.1159 _pdbx_refine_tls.T[2][2] 0.0821 _pdbx_refine_tls.T[3][3] 0.0419 _pdbx_refine_tls.T[1][2] -0.0543 _pdbx_refine_tls.T[1][3] -0.0023 _pdbx_refine_tls.T[2][3] -0.0459 _pdbx_refine_tls.L[1][1] 2.2114 _pdbx_refine_tls.L[2][2] 2.2743 _pdbx_refine_tls.L[3][3] 0.9948 _pdbx_refine_tls.L[1][2] 0.5799 _pdbx_refine_tls.L[1][3] 0.0763 _pdbx_refine_tls.L[2][3] 0.6199 _pdbx_refine_tls.S[1][1] -0.1702 _pdbx_refine_tls.S[1][2] 0.4088 _pdbx_refine_tls.S[1][3] -0.2604 _pdbx_refine_tls.S[2][1] -0.4243 _pdbx_refine_tls.S[2][2] 0.2188 _pdbx_refine_tls.S[2][3] -0.0526 _pdbx_refine_tls.S[3][1] -0.0537 _pdbx_refine_tls.S[3][2] 0.0572 _pdbx_refine_tls.S[3][3] -0.0487 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 672 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 995 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing 9.2 ? 2 REFMAC refinement 5.7.0029 ? 3 HKL-2000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 713 ? ? -116.59 57.80 2 1 GLU A 780 ? ? -95.82 33.00 3 1 HIS A 781 ? ? -150.70 17.55 4 1 ASP A 813 ? ? -149.76 46.40 5 1 PHE A 832 ? ? -90.87 39.65 6 1 GLU A 841 ? ? -98.96 36.03 7 1 GLU A 848 ? ? -143.00 -56.26 8 1 LYS A 851 ? ? 73.35 63.70 9 1 ASP A 990 ? ? -86.45 31.58 10 1 ILE A 994 ? ? -48.38 109.90 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 730 ? CG ? A LYS 61 CG 2 1 Y 1 A LYS 730 ? CD ? A LYS 61 CD 3 1 Y 1 A LYS 730 ? CE ? A LYS 61 CE 4 1 Y 1 A LYS 730 ? NZ ? A LYS 61 NZ 5 1 Y 1 A ILE 994 ? CB ? A ILE 325 CB 6 1 Y 1 A ILE 994 ? CG1 ? A ILE 325 CG1 7 1 Y 1 A ILE 994 ? CG2 ? A ILE 325 CG2 8 1 Y 1 A ILE 994 ? CD1 ? A ILE 325 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 670 ? A GLY 1 2 1 Y 1 A PRO 671 ? A PRO 2 3 1 Y 1 A GLU 961 ? A GLU 292 4 1 Y 1 A ARG 962 ? A ARG 293 5 1 Y 1 A MET 963 ? A MET 294 6 1 Y 1 A HIS 964 ? A HIS 295 7 1 Y 1 A LEU 965 ? A LEU 296 8 1 Y 1 A PRO 966 ? A PRO 297 9 1 Y 1 A SER 967 ? A SER 298 10 1 Y 1 A PRO 968 ? A PRO 299 11 1 Y 1 A THR 969 ? A THR 300 12 1 Y 1 A ASP 970 ? A ASP 301 13 1 Y 1 A SER 971 ? A SER 302 14 1 Y 1 A ASN 972 ? A ASN 303 15 1 Y 1 A PHE 973 ? A PHE 304 16 1 Y 1 A TYR 974 ? A TYR 305 17 1 Y 1 A ARG 975 ? A ARG 306 18 1 Y 1 A ALA 976 ? A ALA 307 19 1 Y 1 A LEU 977 ? A LEU 308 20 1 Y 1 A MET 978 ? A MET 309 21 1 Y 1 A ASP 979 ? A ASP 310 22 1 Y 1 A GLU 980 ? A GLU 311 23 1 Y 1 A GLU 981 ? A GLU 312 24 1 Y 1 A GLN 996 ? A GLN 327 25 1 Y 1 A GLN 997 ? A GLN 328 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-[3-(4-{[(1S)-2-hydroxy-1-phenylethyl]amino}-6-phenylfuro[2,3-d]pyrimidin-5-yl)phenyl]-N~3~,N~3~-dimethyl-beta-alaninamide' KJ8 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 KJ8 1 1001 1996 KJ8 K54 A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . #