data_4JWQ # _entry.id 4JWQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4JWQ pdb_00004jwq 10.2210/pdb4jwq/pdb RCSB RCSB078600 ? ? WWPDB D_1000078600 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-17 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 1 2 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ncs_dom_lim 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.value' 21 3 'Structure model' '_struct_conn.pdbx_dist_value' 22 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 23 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 24 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 30 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 31 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 34 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 35 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 36 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 37 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 38 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 39 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 40 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 41 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 42 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' 43 3 'Structure model' '_struct_ref_seq_dif.details' 44 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 45 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 46 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 4JWQ _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-03-27 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wernimont, A.K.' 1 'Loppnau, P.' 2 'Lin, Y.H.' 3 'Arrowsmith, C.H.' 4 'Bountra, C.' 5 'Edwards, A.M.' 6 'Hui, R.' 7 'Mottaghi, K.' 8 'Structural Genomics Consortium (SGC)' 9 # _citation.id primary _citation.title 'Crystal Structure of the Calcium Binding Domain of CDPK3 from Plasmodium Berghei, PB000947.00' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wernimont, A.K.' 1 ? primary 'Loppnau, P.' 2 ? primary 'Lin, Y.H.' 3 ? primary 'Arrowsmith, C.H.' 4 ? primary 'Bountra, C.' 5 ? primary 'Edwards, A.M.' 6 ? primary 'Hui, R.' 7 ? primary 'Mottaghi, K.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-dependent protein kinase' 23036.268 2 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 4 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGLDVKMDIHVLENFKNYALLLKLQKLAMTIIAQQSNDYDLQQLKTVFLYLDEDGKGNITKNQL KKGLENSGLKLPQNFDVLLDQIDSDGSGRIDYTEFLAAALDRKHLSKKLIYCAFRVFDVDNDGEITTAELAHILYNGNKK GSITQKDVNQVKKMIQEVDKNNDGKIDFYEFCEMMKLKY ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGLDVKMDIHVLENFKNYALLLKLQKLAMTIIAQQSNDYDLQQLKTVFLYLDEDGKGNITKNQL KKGLENSGLKLPQNFDVLLDQIDSDGSGRIDYTEFLAAALDRKHLSKKLIYCAFRVFDVDNDGEITTAELAHILYNGNKK GSITQKDVNQVKKMIQEVDKNNDGKIDFYEFCEMMKLKY ; _entity_poly.pdbx_strand_id A,C _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 LEU n 1 20 ASP n 1 21 VAL n 1 22 LYS n 1 23 MET n 1 24 ASP n 1 25 ILE n 1 26 HIS n 1 27 VAL n 1 28 LEU n 1 29 GLU n 1 30 ASN n 1 31 PHE n 1 32 LYS n 1 33 ASN n 1 34 TYR n 1 35 ALA n 1 36 LEU n 1 37 LEU n 1 38 LEU n 1 39 LYS n 1 40 LEU n 1 41 GLN n 1 42 LYS n 1 43 LEU n 1 44 ALA n 1 45 MET n 1 46 THR n 1 47 ILE n 1 48 ILE n 1 49 ALA n 1 50 GLN n 1 51 GLN n 1 52 SER n 1 53 ASN n 1 54 ASP n 1 55 TYR n 1 56 ASP n 1 57 LEU n 1 58 GLN n 1 59 GLN n 1 60 LEU n 1 61 LYS n 1 62 THR n 1 63 VAL n 1 64 PHE n 1 65 LEU n 1 66 TYR n 1 67 LEU n 1 68 ASP n 1 69 GLU n 1 70 ASP n 1 71 GLY n 1 72 LYS n 1 73 GLY n 1 74 ASN n 1 75 ILE n 1 76 THR n 1 77 LYS n 1 78 ASN n 1 79 GLN n 1 80 LEU n 1 81 LYS n 1 82 LYS n 1 83 GLY n 1 84 LEU n 1 85 GLU n 1 86 ASN n 1 87 SER n 1 88 GLY n 1 89 LEU n 1 90 LYS n 1 91 LEU n 1 92 PRO n 1 93 GLN n 1 94 ASN n 1 95 PHE n 1 96 ASP n 1 97 VAL n 1 98 LEU n 1 99 LEU n 1 100 ASP n 1 101 GLN n 1 102 ILE n 1 103 ASP n 1 104 SER n 1 105 ASP n 1 106 GLY n 1 107 SER n 1 108 GLY n 1 109 ARG n 1 110 ILE n 1 111 ASP n 1 112 TYR n 1 113 THR n 1 114 GLU n 1 115 PHE n 1 116 LEU n 1 117 ALA n 1 118 ALA n 1 119 ALA n 1 120 LEU n 1 121 ASP n 1 122 ARG n 1 123 LYS n 1 124 HIS n 1 125 LEU n 1 126 SER n 1 127 LYS n 1 128 LYS n 1 129 LEU n 1 130 ILE n 1 131 TYR n 1 132 CYS n 1 133 ALA n 1 134 PHE n 1 135 ARG n 1 136 VAL n 1 137 PHE n 1 138 ASP n 1 139 VAL n 1 140 ASP n 1 141 ASN n 1 142 ASP n 1 143 GLY n 1 144 GLU n 1 145 ILE n 1 146 THR n 1 147 THR n 1 148 ALA n 1 149 GLU n 1 150 LEU n 1 151 ALA n 1 152 HIS n 1 153 ILE n 1 154 LEU n 1 155 TYR n 1 156 ASN n 1 157 GLY n 1 158 ASN n 1 159 LYS n 1 160 LYS n 1 161 GLY n 1 162 SER n 1 163 ILE n 1 164 THR n 1 165 GLN n 1 166 LYS n 1 167 ASP n 1 168 VAL n 1 169 ASN n 1 170 GLN n 1 171 VAL n 1 172 LYS n 1 173 LYS n 1 174 MET n 1 175 ILE n 1 176 GLN n 1 177 GLU n 1 178 VAL n 1 179 ASP n 1 180 LYS n 1 181 ASN n 1 182 ASN n 1 183 ASP n 1 184 GLY n 1 185 LYS n 1 186 ILE n 1 187 ASP n 1 188 PHE n 1 189 TYR n 1 190 GLU n 1 191 PHE n 1 192 CYS n 1 193 GLU n 1 194 MET n 1 195 MET n 1 196 LYS n 1 197 LEU n 1 198 LYS n 1 199 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PB000947.00.0, PBANKA_040820' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Anka _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium berghei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 ASN 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 TYR 15 15 ? ? ? A . n A 1 16 PHE 16 16 ? ? ? A . n A 1 17 GLN 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 LEU 19 19 ? ? ? A . n A 1 20 ASP 20 20 ? ? ? A . n A 1 21 VAL 21 21 ? ? ? A . n A 1 22 LYS 22 22 ? ? ? A . n A 1 23 MET 23 23 ? ? ? A . n A 1 24 ASP 24 24 ? ? ? A . n A 1 25 ILE 25 25 ? ? ? A . n A 1 26 HIS 26 26 ? ? ? A . n A 1 27 VAL 27 27 ? ? ? A . n A 1 28 LEU 28 28 ? ? ? A . n A 1 29 GLU 29 29 ? ? ? A . n A 1 30 ASN 30 30 ? ? ? A . n A 1 31 PHE 31 31 ? ? ? A . n A 1 32 LYS 32 32 ? ? ? A . n A 1 33 ASN 33 33 ? ? ? A . n A 1 34 TYR 34 34 ? ? ? A . n A 1 35 ALA 35 35 ? ? ? A . n A 1 36 LEU 36 36 ? ? ? A . n A 1 37 LEU 37 37 ? ? ? A . n A 1 38 LEU 38 38 ? ? ? A . n A 1 39 LYS 39 39 ? ? ? A . n A 1 40 LEU 40 40 ? ? ? A . n A 1 41 GLN 41 41 ? ? ? A . n A 1 42 LYS 42 42 ? ? ? A . n A 1 43 LEU 43 43 ? ? ? A . n A 1 44 ALA 44 44 ? ? ? A . n A 1 45 MET 45 45 ? ? ? A . n A 1 46 THR 46 46 ? ? ? A . n A 1 47 ILE 47 47 ? ? ? A . n A 1 48 ILE 48 48 ? ? ? A . n A 1 49 ALA 49 49 ? ? ? A . n A 1 50 GLN 50 50 ? ? ? A . n A 1 51 GLN 51 51 ? ? ? A . n A 1 52 SER 52 52 ? ? ? A . n A 1 53 ASN 53 53 ? ? ? A . n A 1 54 ASP 54 54 ? ? ? A . n A 1 55 TYR 55 55 ? ? ? A . n A 1 56 ASP 56 56 ? ? ? A . n A 1 57 LEU 57 57 ? ? ? A . n A 1 58 GLN 58 58 ? ? ? A . n A 1 59 GLN 59 59 ? ? ? A . n A 1 60 LEU 60 60 ? ? ? A . n A 1 61 LYS 61 61 ? ? ? A . n A 1 62 THR 62 62 ? ? ? A . n A 1 63 VAL 63 63 ? ? ? A . n A 1 64 PHE 64 64 ? ? ? A . n A 1 65 LEU 65 65 ? ? ? A . n A 1 66 TYR 66 66 ? ? ? A . n A 1 67 LEU 67 67 ? ? ? A . n A 1 68 ASP 68 68 ? ? ? A . n A 1 69 GLU 69 69 ? ? ? A . n A 1 70 ASP 70 70 ? ? ? A . n A 1 71 GLY 71 71 ? ? ? A . n A 1 72 LYS 72 72 ? ? ? A . n A 1 73 GLY 73 73 ? ? ? A . n A 1 74 ASN 74 74 ? ? ? A . n A 1 75 ILE 75 75 ? ? ? A . n A 1 76 THR 76 76 ? ? ? A . n A 1 77 LYS 77 77 ? ? ? A . n A 1 78 ASN 78 78 ? ? ? A . n A 1 79 GLN 79 79 ? ? ? A . n A 1 80 LEU 80 80 ? ? ? A . n A 1 81 LYS 81 81 ? ? ? A . n A 1 82 LYS 82 82 ? ? ? A . n A 1 83 GLY 83 83 ? ? ? A . n A 1 84 LEU 84 84 ? ? ? A . n A 1 85 GLU 85 85 ? ? ? A . n A 1 86 ASN 86 86 ? ? ? A . n A 1 87 SER 87 87 ? ? ? A . n A 1 88 GLY 88 88 ? ? ? A . n A 1 89 LEU 89 89 ? ? ? A . n A 1 90 LYS 90 90 ? ? ? A . n A 1 91 LEU 91 91 ? ? ? A . n A 1 92 PRO 92 92 ? ? ? A . n A 1 93 GLN 93 93 ? ? ? A . n A 1 94 ASN 94 94 ? ? ? A . n A 1 95 PHE 95 95 ? ? ? A . n A 1 96 ASP 96 96 ? ? ? A . n A 1 97 VAL 97 97 ? ? ? A . n A 1 98 LEU 98 98 ? ? ? A . n A 1 99 LEU 99 99 ? ? ? A . n A 1 100 ASP 100 100 ? ? ? A . n A 1 101 GLN 101 101 ? ? ? A . n A 1 102 ILE 102 102 ? ? ? A . n A 1 103 ASP 103 103 ? ? ? A . n A 1 104 SER 104 104 ? ? ? A . n A 1 105 ASP 105 105 ? ? ? A . n A 1 106 GLY 106 106 ? ? ? A . n A 1 107 SER 107 107 ? ? ? A . n A 1 108 GLY 108 108 ? ? ? A . n A 1 109 ARG 109 109 ? ? ? A . n A 1 110 ILE 110 110 ? ? ? A . n A 1 111 ASP 111 111 ? ? ? A . n A 1 112 TYR 112 112 ? ? ? A . n A 1 113 THR 113 113 ? ? ? A . n A 1 114 GLU 114 114 ? ? ? A . n A 1 115 PHE 115 115 ? ? ? A . n A 1 116 LEU 116 116 ? ? ? A . n A 1 117 ALA 117 117 ? ? ? A . n A 1 118 ALA 118 118 ? ? ? A . n A 1 119 ALA 119 119 ? ? ? A . n A 1 120 LEU 120 120 ? ? ? A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 ARG 122 122 ? ? ? A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 GLY 157 157 ? ? ? A . n A 1 158 ASN 158 158 ? ? ? A . n A 1 159 LYS 159 159 ? ? ? A . n A 1 160 LYS 160 160 ? ? ? A . n A 1 161 GLY 161 161 ? ? ? A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 MET 174 174 174 MET MET A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 CYS 192 192 192 CYS CYS A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 MET 195 195 195 MET MET A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 LYS 198 198 ? ? ? A . n A 1 199 TYR 199 199 ? ? ? A . n B 1 1 MET 1 1 ? ? ? C . n B 1 2 HIS 2 2 ? ? ? C . n B 1 3 HIS 3 3 ? ? ? C . n B 1 4 HIS 4 4 ? ? ? C . n B 1 5 HIS 5 5 ? ? ? C . n B 1 6 HIS 6 6 ? ? ? C . n B 1 7 HIS 7 7 ? ? ? C . n B 1 8 SER 8 8 ? ? ? C . n B 1 9 SER 9 9 ? ? ? C . n B 1 10 GLY 10 10 ? ? ? C . n B 1 11 ARG 11 11 ? ? ? C . n B 1 12 GLU 12 12 ? ? ? C . n B 1 13 ASN 13 13 ? ? ? C . n B 1 14 LEU 14 14 ? ? ? C . n B 1 15 TYR 15 15 ? ? ? C . n B 1 16 PHE 16 16 ? ? ? C . n B 1 17 GLN 17 17 ? ? ? C . n B 1 18 GLY 18 18 ? ? ? C . n B 1 19 LEU 19 19 ? ? ? C . n B 1 20 ASP 20 20 ? ? ? C . n B 1 21 VAL 21 21 ? ? ? C . n B 1 22 LYS 22 22 ? ? ? C . n B 1 23 MET 23 23 ? ? ? C . n B 1 24 ASP 24 24 ? ? ? C . n B 1 25 ILE 25 25 ? ? ? C . n B 1 26 HIS 26 26 ? ? ? C . n B 1 27 VAL 27 27 ? ? ? C . n B 1 28 LEU 28 28 ? ? ? C . n B 1 29 GLU 29 29 ? ? ? C . n B 1 30 ASN 30 30 ? ? ? C . n B 1 31 PHE 31 31 ? ? ? C . n B 1 32 LYS 32 32 ? ? ? C . n B 1 33 ASN 33 33 ? ? ? C . n B 1 34 TYR 34 34 ? ? ? C . n B 1 35 ALA 35 35 ? ? ? C . n B 1 36 LEU 36 36 ? ? ? C . n B 1 37 LEU 37 37 ? ? ? C . n B 1 38 LEU 38 38 ? ? ? C . n B 1 39 LYS 39 39 ? ? ? C . n B 1 40 LEU 40 40 ? ? ? C . n B 1 41 GLN 41 41 ? ? ? C . n B 1 42 LYS 42 42 ? ? ? C . n B 1 43 LEU 43 43 ? ? ? C . n B 1 44 ALA 44 44 ? ? ? C . n B 1 45 MET 45 45 ? ? ? C . n B 1 46 THR 46 46 ? ? ? C . n B 1 47 ILE 47 47 ? ? ? C . n B 1 48 ILE 48 48 ? ? ? C . n B 1 49 ALA 49 49 ? ? ? C . n B 1 50 GLN 50 50 ? ? ? C . n B 1 51 GLN 51 51 ? ? ? C . n B 1 52 SER 52 52 ? ? ? C . n B 1 53 ASN 53 53 ? ? ? C . n B 1 54 ASP 54 54 ? ? ? C . n B 1 55 TYR 55 55 ? ? ? C . n B 1 56 ASP 56 56 ? ? ? C . n B 1 57 LEU 57 57 ? ? ? C . n B 1 58 GLN 58 58 ? ? ? C . n B 1 59 GLN 59 59 ? ? ? C . n B 1 60 LEU 60 60 ? ? ? C . n B 1 61 LYS 61 61 ? ? ? C . n B 1 62 THR 62 62 ? ? ? C . n B 1 63 VAL 63 63 ? ? ? C . n B 1 64 PHE 64 64 ? ? ? C . n B 1 65 LEU 65 65 ? ? ? C . n B 1 66 TYR 66 66 ? ? ? C . n B 1 67 LEU 67 67 ? ? ? C . n B 1 68 ASP 68 68 ? ? ? C . n B 1 69 GLU 69 69 ? ? ? C . n B 1 70 ASP 70 70 ? ? ? C . n B 1 71 GLY 71 71 ? ? ? C . n B 1 72 LYS 72 72 ? ? ? C . n B 1 73 GLY 73 73 ? ? ? C . n B 1 74 ASN 74 74 ? ? ? C . n B 1 75 ILE 75 75 ? ? ? C . n B 1 76 THR 76 76 ? ? ? C . n B 1 77 LYS 77 77 ? ? ? C . n B 1 78 ASN 78 78 ? ? ? C . n B 1 79 GLN 79 79 ? ? ? C . n B 1 80 LEU 80 80 ? ? ? C . n B 1 81 LYS 81 81 ? ? ? C . n B 1 82 LYS 82 82 ? ? ? C . n B 1 83 GLY 83 83 ? ? ? C . n B 1 84 LEU 84 84 ? ? ? C . n B 1 85 GLU 85 85 ? ? ? C . n B 1 86 ASN 86 86 ? ? ? C . n B 1 87 SER 87 87 ? ? ? C . n B 1 88 GLY 88 88 ? ? ? C . n B 1 89 LEU 89 89 ? ? ? C . n B 1 90 LYS 90 90 ? ? ? C . n B 1 91 LEU 91 91 ? ? ? C . n B 1 92 PRO 92 92 ? ? ? C . n B 1 93 GLN 93 93 ? ? ? C . n B 1 94 ASN 94 94 ? ? ? C . n B 1 95 PHE 95 95 ? ? ? C . n B 1 96 ASP 96 96 ? ? ? C . n B 1 97 VAL 97 97 ? ? ? C . n B 1 98 LEU 98 98 ? ? ? C . n B 1 99 LEU 99 99 ? ? ? C . n B 1 100 ASP 100 100 ? ? ? C . n B 1 101 GLN 101 101 ? ? ? C . n B 1 102 ILE 102 102 ? ? ? C . n B 1 103 ASP 103 103 ? ? ? C . n B 1 104 SER 104 104 ? ? ? C . n B 1 105 ASP 105 105 ? ? ? C . n B 1 106 GLY 106 106 ? ? ? C . n B 1 107 SER 107 107 ? ? ? C . n B 1 108 GLY 108 108 ? ? ? C . n B 1 109 ARG 109 109 ? ? ? C . n B 1 110 ILE 110 110 ? ? ? C . n B 1 111 ASP 111 111 ? ? ? C . n B 1 112 TYR 112 112 ? ? ? C . n B 1 113 THR 113 113 ? ? ? C . n B 1 114 GLU 114 114 ? ? ? C . n B 1 115 PHE 115 115 ? ? ? C . n B 1 116 LEU 116 116 ? ? ? C . n B 1 117 ALA 117 117 ? ? ? C . n B 1 118 ALA 118 118 ? ? ? C . n B 1 119 ALA 119 119 ? ? ? C . n B 1 120 LEU 120 120 ? ? ? C . n B 1 121 ASP 121 121 121 ASP ASP C . n B 1 122 ARG 122 122 122 ARG ARG C . n B 1 123 LYS 123 123 123 LYS LYS C . n B 1 124 HIS 124 124 124 HIS HIS C . n B 1 125 LEU 125 125 125 LEU LEU C . n B 1 126 SER 126 126 126 SER SER C . n B 1 127 LYS 127 127 127 LYS LYS C . n B 1 128 LYS 128 128 128 LYS LYS C . n B 1 129 LEU 129 129 129 LEU LEU C . n B 1 130 ILE 130 130 130 ILE ILE C . n B 1 131 TYR 131 131 131 TYR TYR C . n B 1 132 CYS 132 132 132 CYS CYS C . n B 1 133 ALA 133 133 133 ALA ALA C . n B 1 134 PHE 134 134 134 PHE PHE C . n B 1 135 ARG 135 135 135 ARG ARG C . n B 1 136 VAL 136 136 136 VAL VAL C . n B 1 137 PHE 137 137 137 PHE PHE C . n B 1 138 ASP 138 138 138 ASP ASP C . n B 1 139 VAL 139 139 139 VAL VAL C . n B 1 140 ASP 140 140 140 ASP ASP C . n B 1 141 ASN 141 141 141 ASN ASN C . n B 1 142 ASP 142 142 142 ASP ASP C . n B 1 143 GLY 143 143 143 GLY GLY C . n B 1 144 GLU 144 144 144 GLU GLU C . n B 1 145 ILE 145 145 145 ILE ILE C . n B 1 146 THR 146 146 146 THR THR C . n B 1 147 THR 147 147 147 THR THR C . n B 1 148 ALA 148 148 148 ALA ALA C . n B 1 149 GLU 149 149 149 GLU GLU C . n B 1 150 LEU 150 150 150 LEU LEU C . n B 1 151 ALA 151 151 151 ALA ALA C . n B 1 152 HIS 152 152 152 HIS HIS C . n B 1 153 ILE 153 153 153 ILE ILE C . n B 1 154 LEU 154 154 154 LEU LEU C . n B 1 155 TYR 155 155 155 TYR TYR C . n B 1 156 ASN 156 156 156 ASN ASN C . n B 1 157 GLY 157 157 ? ? ? C . n B 1 158 ASN 158 158 ? ? ? C . n B 1 159 LYS 159 159 ? ? ? C . n B 1 160 LYS 160 160 ? ? ? C . n B 1 161 GLY 161 161 ? ? ? C . n B 1 162 SER 162 162 ? ? ? C . n B 1 163 ILE 163 163 163 ILE ILE C . n B 1 164 THR 164 164 164 THR THR C . n B 1 165 GLN 165 165 165 GLN GLN C . n B 1 166 LYS 166 166 166 LYS LYS C . n B 1 167 ASP 167 167 167 ASP ASP C . n B 1 168 VAL 168 168 168 VAL VAL C . n B 1 169 ASN 169 169 169 ASN ASN C . n B 1 170 GLN 170 170 170 GLN GLN C . n B 1 171 VAL 171 171 171 VAL VAL C . n B 1 172 LYS 172 172 172 LYS LYS C . n B 1 173 LYS 173 173 173 LYS LYS C . n B 1 174 MET 174 174 174 MET MET C . n B 1 175 ILE 175 175 175 ILE ILE C . n B 1 176 GLN 176 176 176 GLN GLN C . n B 1 177 GLU 177 177 177 GLU GLU C . n B 1 178 VAL 178 178 178 VAL VAL C . n B 1 179 ASP 179 179 179 ASP ASP C . n B 1 180 LYS 180 180 180 LYS LYS C . n B 1 181 ASN 181 181 181 ASN ASN C . n B 1 182 ASN 182 182 182 ASN ASN C . n B 1 183 ASP 183 183 183 ASP ASP C . n B 1 184 GLY 184 184 184 GLY GLY C . n B 1 185 LYS 185 185 185 LYS LYS C . n B 1 186 ILE 186 186 186 ILE ILE C . n B 1 187 ASP 187 187 187 ASP ASP C . n B 1 188 PHE 188 188 188 PHE PHE C . n B 1 189 TYR 189 189 189 TYR TYR C . n B 1 190 GLU 190 190 190 GLU GLU C . n B 1 191 PHE 191 191 191 PHE PHE C . n B 1 192 CYS 192 192 192 CYS CYS C . n B 1 193 GLU 193 193 193 GLU GLU C . n B 1 194 MET 194 194 194 MET MET C . n B 1 195 MET 195 195 195 MET MET C . n B 1 196 LYS 196 196 196 LYS LYS C . n B 1 197 LEU 197 197 197 LEU LEU C . n B 1 198 LYS 198 198 198 LYS LYS C . n B 1 199 TYR 199 199 199 TYR TYR C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CA 1 201 1 CA CA A . D 2 CA 1 202 1 CA CA A . E 2 CA 1 201 1 CA CA C . F 2 CA 1 202 1 CA CA C . G 3 SO4 1 203 1 SO4 SO4 C . H 4 HOH 1 301 1 HOH HOH A . H 4 HOH 2 302 2 HOH HOH A . H 4 HOH 3 303 5 HOH HOH A . H 4 HOH 4 304 8 HOH HOH A . H 4 HOH 5 305 9 HOH HOH A . H 4 HOH 6 306 10 HOH HOH A . H 4 HOH 7 307 11 HOH HOH A . H 4 HOH 8 308 12 HOH HOH A . H 4 HOH 9 309 17 HOH HOH A . H 4 HOH 10 310 18 HOH HOH A . H 4 HOH 11 311 19 HOH HOH A . H 4 HOH 12 312 20 HOH HOH A . H 4 HOH 13 313 23 HOH HOH A . H 4 HOH 14 314 2 HOH HOH A . H 4 HOH 15 315 5 HOH HOH A . H 4 HOH 16 316 9 HOH HOH A . H 4 HOH 17 317 12 HOH HOH A . H 4 HOH 18 318 23 HOH HOH A . H 4 HOH 19 319 24 HOH HOH A . H 4 HOH 20 320 30 HOH HOH A . H 4 HOH 21 321 33 HOH HOH A . I 4 HOH 1 301 3 HOH HOH C . I 4 HOH 2 302 4 HOH HOH C . I 4 HOH 3 303 6 HOH HOH C . I 4 HOH 4 304 7 HOH HOH C . I 4 HOH 5 305 13 HOH HOH C . I 4 HOH 6 306 15 HOH HOH C . I 4 HOH 7 307 16 HOH HOH C . I 4 HOH 8 308 21 HOH HOH C . I 4 HOH 9 309 22 HOH HOH C . I 4 HOH 10 310 1 HOH HOH C . I 4 HOH 11 311 3 HOH HOH C . I 4 HOH 12 312 8 HOH HOH C . I 4 HOH 13 313 14 HOH HOH C . I 4 HOH 14 314 17 HOH HOH C . I 4 HOH 15 315 19 HOH HOH C . I 4 HOH 16 316 22 HOH HOH C . I 4 HOH 17 317 42 HOH HOH C . I 4 HOH 18 318 63 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 123 ? CG ? A LYS 123 CG 2 1 Y 1 A LYS 123 ? CD ? A LYS 123 CD 3 1 Y 1 A LYS 123 ? CE ? A LYS 123 CE 4 1 Y 1 A LYS 123 ? NZ ? A LYS 123 NZ 5 1 Y 1 A LYS 127 ? CG ? A LYS 127 CG 6 1 Y 1 A LYS 127 ? CD ? A LYS 127 CD 7 1 Y 1 A LYS 127 ? CE ? A LYS 127 CE 8 1 Y 1 A LYS 127 ? NZ ? A LYS 127 NZ 9 1 Y 1 A ILE 153 ? CD1 ? A ILE 153 CD1 10 1 Y 1 A LYS 172 ? CE ? A LYS 172 CE 11 1 Y 1 A LYS 172 ? NZ ? A LYS 172 NZ 12 1 Y 1 A LYS 173 ? CD ? A LYS 173 CD 13 1 Y 1 A LYS 173 ? CE ? A LYS 173 CE 14 1 Y 1 A LYS 173 ? NZ ? A LYS 173 NZ 15 1 Y 1 A LYS 196 ? CG ? A LYS 196 CG 16 1 Y 1 A LYS 196 ? CD ? A LYS 196 CD 17 1 Y 1 A LYS 196 ? CE ? A LYS 196 CE 18 1 Y 1 A LYS 196 ? NZ ? A LYS 196 NZ 19 1 Y 1 C ASP 121 ? CG ? B ASP 121 CG 20 1 Y 1 C ASP 121 ? OD1 ? B ASP 121 OD1 21 1 Y 1 C ASP 121 ? OD2 ? B ASP 121 OD2 22 1 Y 1 C LYS 123 ? CG ? B LYS 123 CG 23 1 Y 1 C LYS 123 ? CD ? B LYS 123 CD 24 1 Y 1 C LYS 123 ? CE ? B LYS 123 CE 25 1 Y 1 C LYS 123 ? NZ ? B LYS 123 NZ 26 1 Y 1 C ILE 153 ? CD1 ? B ILE 153 CD1 27 1 Y 1 C ASN 156 ? CG ? B ASN 156 CG 28 1 Y 1 C ASN 156 ? OD1 ? B ASN 156 OD1 29 1 Y 1 C ASN 156 ? ND2 ? B ASN 156 ND2 30 1 Y 1 C ILE 163 ? CG1 ? B ILE 163 CG1 31 1 Y 1 C ILE 163 ? CG2 ? B ILE 163 CG2 32 1 Y 1 C ILE 163 ? CD1 ? B ILE 163 CD1 33 1 Y 1 C LYS 198 ? CG ? B LYS 198 CG 34 1 Y 1 C LYS 198 ? CD ? B LYS 198 CD 35 1 Y 1 C LYS 198 ? CE ? B LYS 198 CE 36 1 Y 1 C LYS 198 ? NZ ? B LYS 198 NZ # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 Blu-Ice . ? ? ? ? 'data collection' ? ? ? 6 BALBES . ? ? ? ? phasing ? ? ? # _cell.length_a 24.564 _cell.length_b 69.741 _cell.length_c 90.581 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4JWQ _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 4JWQ _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 4JWQ _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 47.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '30% Peg 4K, 0.2 M NH4SO4, 0.1 M NaCacodylate 6.5, 2 mM CaCl2, Chymotrypsin 1:100, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAR scanner 300 mm plate' _diffrn_detector.pdbx_collection_date 2013-03-21 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 23-ID-D # _reflns.entry_id 4JWQ _reflns.d_resolution_high 2.150 _reflns.d_resolution_low 50.000 _reflns.number_obs 9095 _reflns.pdbx_Rmerge_I_obs 0.103 _reflns.pdbx_netI_over_sigmaI 9.500 _reflns.pdbx_chi_squared 1.727 _reflns.pdbx_redundancy 5.700 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all 9104 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.150 2.190 ? ? ? 0.714 ? ? 0.993 5.700 ? 444 100.000 1 1 2.190 2.230 ? ? ? 0.580 ? ? 1.123 5.800 ? 452 100.000 2 1 2.230 2.270 ? ? ? 0.551 ? ? 1.188 5.700 ? 425 100.000 3 1 2.270 2.320 ? ? ? 0.494 ? ? 1.187 5.900 ? 440 100.000 4 1 2.320 2.370 ? ? ? 0.463 ? ? 1.221 5.800 ? 431 100.000 5 1 2.370 2.420 ? ? ? 0.413 ? ? 1.222 5.700 ? 455 100.000 6 1 2.420 2.480 ? ? ? 0.364 ? ? 1.167 5.800 ? 457 100.000 7 1 2.480 2.550 ? ? ? 0.332 ? ? 1.222 5.800 ? 439 100.000 8 1 2.550 2.620 ? ? ? 0.256 ? ? 1.380 5.800 ? 432 100.000 9 1 2.620 2.710 ? ? ? 0.202 ? ? 1.573 5.800 ? 465 100.000 10 1 2.710 2.810 ? ? ? 0.194 ? ? 1.706 5.700 ? 437 100.000 11 1 2.810 2.920 ? ? ? 0.175 ? ? 1.673 5.800 ? 450 99.800 12 1 2.920 3.050 ? ? ? 0.137 ? ? 1.740 5.800 ? 466 100.000 13 1 3.050 3.210 ? ? ? 0.109 ? ? 1.693 5.800 ? 437 100.000 14 1 3.210 3.410 ? ? ? 0.089 ? ? 1.881 5.800 ? 456 100.000 15 1 3.410 3.680 ? ? ? 0.075 ? ? 2.212 5.700 ? 464 100.000 16 1 3.680 4.050 ? ? ? 0.065 ? ? 2.808 5.600 ? 468 100.000 17 1 4.050 4.630 ? ? ? 0.060 ? ? 2.571 5.400 ? 465 100.000 18 1 4.630 5.830 ? ? ? 0.059 ? ? 2.530 5.500 ? 482 99.600 19 1 5.830 50.000 ? ? ? 0.058 ? ? 3.529 4.700 ? 530 99.100 20 1 # _refine.entry_id 4JWQ _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 38.0100 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.7900 _refine.ls_number_reflns_obs 9053 _refine.ls_number_reflns_all 9072 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : RESIDUAL ONLY' _refine.ls_R_factor_all .20292 _refine.ls_R_factor_obs 0.2029 _refine.ls_R_factor_R_work 0.2013 _refine.ls_wR_factor_R_work 0.2007 _refine.ls_R_factor_R_free 0.2360 _refine.ls_wR_factor_R_free 0.2231 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_number_reflns_R_free 433 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 46.389 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -3.4100 _refine.aniso_B[2][2] 4.8100 _refine.aniso_B[3][3] -1.4000 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9520 _refine.correlation_coeff_Fo_to_Fc_free 0.9260 _refine.overall_SU_R_Cruickshank_DPI 0.2452 _refine.overall_SU_R_free 0.1919 _refine.pdbx_overall_ESU_R 0.2450 _refine.pdbx_overall_ESU_R_Free 0.1920 _refine.overall_SU_ML 0.1470 _refine.overall_SU_B 10.6250 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8267 _refine.B_iso_max 62.940 _refine.B_iso_min 11.510 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1141 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1189 _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 38.0100 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 1167 0.015 0.019 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 1086 0.005 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1568 1.631 1.950 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 2493 1.083 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 140 5.080 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 61 33.405 25.902 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 217 16.717 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 3 28.034 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 176 0.085 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 1314 0.008 0.020 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 265 0.005 0.020 ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 'interatomic distance' A 3384 0.110 0.050 ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 'interatomic distance' C 3384 0.110 0.050 ? ? ? ? ? ? # _refine_ls_shell.d_res_high 2.1470 _refine_ls_shell.d_res_low 2.2020 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 98.4800 _refine_ls_shell.number_reflns_R_work 606 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2140 _refine_ls_shell.R_factor_R_free 0.2640 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 647 _refine_ls_shell.number_reflns_obs 606 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 A 1 2 C # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 0 A LYS 123 . A MET 195 . A LYS 123 A MET 195 0 ? 1 2 0 B LYS 123 . B MET 195 . C LYS 123 C MET 195 0 ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 4JWQ _struct.title 'Crystal Structure of the Calcium Binding Domain of CDPK3 from Plasmodium Berghei, PB000947.00' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4JWQ _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Structural Genomics, Structural Genomics Consortium, SGC, calmodulin fold, transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 4 ? I N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4Z443_PLABA _struct_ref.pdbx_db_accession Q4Z443 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LDVKMDIHVLENFKNYALLLKLQKLAMTIIAQQSNDYDLQQLKTVFLYLDEDGKGNITKNQLKKGLENSGLKLPQNFDVL LDQIDSDGSGRIDYTEFLAAALDRKHLSKKLIYCAFRVFDVDNDGEITTAELAHILYNGNKKGSITQKDVNQVKKMIQEV DKNNDGKIDFYEFCEMMKLKY ; _struct_ref.pdbx_align_begin 374 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4JWQ A 19 ? 199 ? Q4Z443 374 ? 554 ? 19 199 2 1 4JWQ C 19 ? 199 ? Q4Z443 374 ? 554 ? 19 199 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4JWQ MET A 1 ? UNP Q4Z443 ? ? 'expression tag' 1 1 1 4JWQ HIS A 2 ? UNP Q4Z443 ? ? 'expression tag' 2 2 1 4JWQ HIS A 3 ? UNP Q4Z443 ? ? 'expression tag' 3 3 1 4JWQ HIS A 4 ? UNP Q4Z443 ? ? 'expression tag' 4 4 1 4JWQ HIS A 5 ? UNP Q4Z443 ? ? 'expression tag' 5 5 1 4JWQ HIS A 6 ? UNP Q4Z443 ? ? 'expression tag' 6 6 1 4JWQ HIS A 7 ? UNP Q4Z443 ? ? 'expression tag' 7 7 1 4JWQ SER A 8 ? UNP Q4Z443 ? ? 'expression tag' 8 8 1 4JWQ SER A 9 ? UNP Q4Z443 ? ? 'expression tag' 9 9 1 4JWQ GLY A 10 ? UNP Q4Z443 ? ? 'expression tag' 10 10 1 4JWQ ARG A 11 ? UNP Q4Z443 ? ? 'expression tag' 11 11 1 4JWQ GLU A 12 ? UNP Q4Z443 ? ? 'expression tag' 12 12 1 4JWQ ASN A 13 ? UNP Q4Z443 ? ? 'expression tag' 13 13 1 4JWQ LEU A 14 ? UNP Q4Z443 ? ? 'expression tag' 14 14 1 4JWQ TYR A 15 ? UNP Q4Z443 ? ? 'expression tag' 15 15 1 4JWQ PHE A 16 ? UNP Q4Z443 ? ? 'expression tag' 16 16 1 4JWQ GLN A 17 ? UNP Q4Z443 ? ? 'expression tag' 17 17 1 4JWQ GLY A 18 ? UNP Q4Z443 ? ? 'expression tag' 18 18 2 4JWQ MET C 1 ? UNP Q4Z443 ? ? 'expression tag' 1 19 2 4JWQ HIS C 2 ? UNP Q4Z443 ? ? 'expression tag' 2 20 2 4JWQ HIS C 3 ? UNP Q4Z443 ? ? 'expression tag' 3 21 2 4JWQ HIS C 4 ? UNP Q4Z443 ? ? 'expression tag' 4 22 2 4JWQ HIS C 5 ? UNP Q4Z443 ? ? 'expression tag' 5 23 2 4JWQ HIS C 6 ? UNP Q4Z443 ? ? 'expression tag' 6 24 2 4JWQ HIS C 7 ? UNP Q4Z443 ? ? 'expression tag' 7 25 2 4JWQ SER C 8 ? UNP Q4Z443 ? ? 'expression tag' 8 26 2 4JWQ SER C 9 ? UNP Q4Z443 ? ? 'expression tag' 9 27 2 4JWQ GLY C 10 ? UNP Q4Z443 ? ? 'expression tag' 10 28 2 4JWQ ARG C 11 ? UNP Q4Z443 ? ? 'expression tag' 11 29 2 4JWQ GLU C 12 ? UNP Q4Z443 ? ? 'expression tag' 12 30 2 4JWQ ASN C 13 ? UNP Q4Z443 ? ? 'expression tag' 13 31 2 4JWQ LEU C 14 ? UNP Q4Z443 ? ? 'expression tag' 14 32 2 4JWQ TYR C 15 ? UNP Q4Z443 ? ? 'expression tag' 15 33 2 4JWQ PHE C 16 ? UNP Q4Z443 ? ? 'expression tag' 16 34 2 4JWQ GLN C 17 ? UNP Q4Z443 ? ? 'expression tag' 17 35 2 4JWQ GLY C 18 ? UNP Q4Z443 ? ? 'expression tag' 18 36 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2350 ? 1 MORE -81 ? 1 'SSA (A^2)' 8690 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 123 ? ASP A 138 ? LYS A 123 ASP A 138 1 ? 16 HELX_P HELX_P2 2 THR A 146 ? ASN A 156 ? THR A 146 ASN A 156 1 ? 11 HELX_P HELX_P3 3 THR A 164 ? ASP A 179 ? THR A 164 ASP A 179 1 ? 16 HELX_P HELX_P4 4 PHE A 188 ? LYS A 196 ? PHE A 188 LYS A 196 1 ? 9 HELX_P HELX_P5 5 ARG B 122 ? ASP B 138 ? ARG C 122 ASP C 138 1 ? 17 HELX_P HELX_P6 6 THR B 146 ? TYR B 155 ? THR C 146 TYR C 155 1 ? 10 HELX_P HELX_P7 7 THR B 164 ? ASP B 179 ? THR C 164 ASP C 179 1 ? 16 HELX_P HELX_P8 8 PHE B 188 ? MET B 195 ? PHE C 188 MET C 195 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 138 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 138 A CA 201 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc2 metalc ? ? A ASP 140 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 140 A CA 201 1_555 ? ? ? ? ? ? ? 2.423 ? ? metalc3 metalc ? ? A ASP 142 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 142 A CA 201 1_555 ? ? ? ? ? ? ? 2.270 ? ? metalc4 metalc ? ? A GLU 144 O ? ? ? 1_555 C CA . CA ? ? A GLU 144 A CA 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc5 metalc ? ? A GLU 149 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 149 A CA 201 1_555 ? ? ? ? ? ? ? 2.376 ? ? metalc6 metalc ? ? A GLU 149 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 149 A CA 201 1_555 ? ? ? ? ? ? ? 2.485 ? ? metalc7 metalc ? ? A ASP 179 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 179 A CA 202 1_555 ? ? ? ? ? ? ? 2.415 ? ? metalc8 metalc ? ? A ASN 181 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 181 A CA 202 1_555 ? ? ? ? ? ? ? 2.436 ? ? metalc9 metalc ? ? A ASP 183 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 183 A CA 202 1_555 ? ? ? ? ? ? ? 2.404 ? ? metalc10 metalc ? ? A LYS 185 O ? ? ? 1_555 D CA . CA ? ? A LYS 185 A CA 202 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc11 metalc ? ? A GLU 190 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 190 A CA 202 1_555 ? ? ? ? ? ? ? 2.397 ? ? metalc12 metalc ? ? A GLU 190 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 190 A CA 202 1_555 ? ? ? ? ? ? ? 2.452 ? ? metalc13 metalc ? ? C CA . CA ? ? ? 1_555 H HOH . O ? ? A CA 201 A HOH 303 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 H HOH . O ? ? A CA 202 A HOH 301 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc15 metalc ? ? B ASP 138 OD1 ? ? ? 1_555 E CA . CA ? ? C ASP 138 C CA 201 1_555 ? ? ? ? ? ? ? 2.273 ? ? metalc16 metalc ? ? B ASP 140 OD1 ? ? ? 1_555 E CA . CA ? ? C ASP 140 C CA 201 1_555 ? ? ? ? ? ? ? 2.444 ? ? metalc17 metalc ? ? B ASP 142 OD1 ? ? ? 1_555 E CA . CA ? ? C ASP 142 C CA 201 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc18 metalc ? ? B GLU 144 O ? ? ? 1_555 E CA . CA ? ? C GLU 144 C CA 201 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc19 metalc ? ? B GLU 149 OE1 ? ? ? 1_555 E CA . CA ? ? C GLU 149 C CA 201 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc20 metalc ? ? B GLU 149 OE2 ? ? ? 1_555 E CA . CA ? ? C GLU 149 C CA 201 1_555 ? ? ? ? ? ? ? 2.524 ? ? metalc21 metalc ? ? B ASP 179 OD1 ? ? ? 1_555 F CA . CA ? ? C ASP 179 C CA 202 1_555 ? ? ? ? ? ? ? 2.369 ? ? metalc22 metalc ? ? B ASN 181 OD1 ? ? ? 1_555 F CA . CA ? ? C ASN 181 C CA 202 1_555 ? ? ? ? ? ? ? 2.512 ? ? metalc23 metalc ? ? B ASP 183 OD1 ? ? ? 1_555 F CA . CA ? ? C ASP 183 C CA 202 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc24 metalc ? ? B LYS 185 O ? ? ? 1_555 F CA . CA ? ? C LYS 185 C CA 202 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc25 metalc ? ? B GLU 190 OE2 ? ? ? 1_555 F CA . CA ? ? C GLU 190 C CA 202 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc26 metalc ? ? B GLU 190 OE1 ? ? ? 1_555 F CA . CA ? ? C GLU 190 C CA 202 1_555 ? ? ? ? ? ? ? 2.497 ? ? metalc27 metalc ? ? E CA . CA ? ? ? 1_555 I HOH . O ? ? C CA 201 C HOH 301 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc28 metalc ? ? F CA . CA ? ? ? 1_555 I HOH . O ? ? C CA 202 C HOH 303 1_555 ? ? ? ? ? ? ? 2.279 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 82.5 ? 2 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OD1 ? A ASP 142 ? A ASP 142 ? 1_555 85.1 ? 3 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OD1 ? A ASP 142 ? A ASP 142 ? 1_555 77.2 ? 4 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? A GLU 144 ? A GLU 144 ? 1_555 87.2 ? 5 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? A GLU 144 ? A GLU 144 ? 1_555 157.1 ? 6 OD1 ? A ASP 142 ? A ASP 142 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? A GLU 144 ? A GLU 144 ? 1_555 81.5 ? 7 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE1 ? A GLU 149 ? A GLU 149 ? 1_555 110.9 ? 8 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE1 ? A GLU 149 ? A GLU 149 ? 1_555 127.1 ? 9 OD1 ? A ASP 142 ? A ASP 142 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE1 ? A GLU 149 ? A GLU 149 ? 1_555 151.2 ? 10 O ? A GLU 144 ? A GLU 144 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE1 ? A GLU 149 ? A GLU 149 ? 1_555 75.7 ? 11 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE2 ? A GLU 149 ? A GLU 149 ? 1_555 97.5 ? 12 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE2 ? A GLU 149 ? A GLU 149 ? 1_555 74.7 ? 13 OD1 ? A ASP 142 ? A ASP 142 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE2 ? A GLU 149 ? A GLU 149 ? 1_555 151.2 ? 14 O ? A GLU 144 ? A GLU 144 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE2 ? A GLU 149 ? A GLU 149 ? 1_555 127.1 ? 15 OE1 ? A GLU 149 ? A GLU 149 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 OE2 ? A GLU 149 ? A GLU 149 ? 1_555 53.4 ? 16 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 154.9 ? 17 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 74.2 ? 18 OD1 ? A ASP 142 ? A ASP 142 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 80.8 ? 19 O ? A GLU 144 ? A GLU 144 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 110.9 ? 20 OE1 ? A GLU 149 ? A GLU 149 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 90.9 ? 21 OE2 ? A GLU 149 ? A GLU 149 ? 1_555 CA ? C CA . ? A CA 201 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 85.5 ? 22 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OD1 ? A ASN 181 ? A ASN 181 ? 1_555 77.2 ? 23 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OD1 ? A ASP 183 ? A ASP 183 ? 1_555 83.8 ? 24 OD1 ? A ASN 181 ? A ASN 181 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OD1 ? A ASP 183 ? A ASP 183 ? 1_555 72.5 ? 25 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? A LYS 185 ? A LYS 185 ? 1_555 85.8 ? 26 OD1 ? A ASN 181 ? A ASN 181 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? A LYS 185 ? A LYS 185 ? 1_555 151.2 ? 27 OD1 ? A ASP 183 ? A ASP 183 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? A LYS 185 ? A LYS 185 ? 1_555 82.8 ? 28 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 83.2 ? 29 OD1 ? A ASN 181 ? A ASN 181 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 77.3 ? 30 OD1 ? A ASP 183 ? A ASP 183 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 149.1 ? 31 O ? A LYS 185 ? A LYS 185 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 123.9 ? 32 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 113.4 ? 33 OD1 ? A ASN 181 ? A ASN 181 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 127.6 ? 34 OD1 ? A ASP 183 ? A ASP 183 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 154.8 ? 35 O ? A LYS 185 ? A LYS 185 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 80.4 ? 36 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 55.1 ? 37 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 162.1 ? 38 OD1 ? A ASN 181 ? A ASN 181 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 94.4 ? 39 OD1 ? A ASP 183 ? A ASP 183 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 78.5 ? 40 O ? A LYS 185 ? A LYS 185 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 94.9 ? 41 OE2 ? A GLU 190 ? A GLU 190 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 110.7 ? 42 OE1 ? A GLU 190 ? A GLU 190 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 O ? H HOH . ? A HOH 301 ? 1_555 84.3 ? 43 OD1 ? B ASP 138 ? C ASP 138 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OD1 ? B ASP 140 ? C ASP 140 ? 1_555 82.1 ? 44 OD1 ? B ASP 138 ? C ASP 138 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OD1 ? B ASP 142 ? C ASP 142 ? 1_555 85.4 ? 45 OD1 ? B ASP 140 ? C ASP 140 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OD1 ? B ASP 142 ? C ASP 142 ? 1_555 74.9 ? 46 OD1 ? B ASP 138 ? C ASP 138 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? B GLU 144 ? C GLU 144 ? 1_555 88.4 ? 47 OD1 ? B ASP 140 ? C ASP 140 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? B GLU 144 ? C GLU 144 ? 1_555 154.5 ? 48 OD1 ? B ASP 142 ? C ASP 142 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? B GLU 144 ? C GLU 144 ? 1_555 80.8 ? 49 OD1 ? B ASP 138 ? C ASP 138 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE1 ? B GLU 149 ? C GLU 149 ? 1_555 111.4 ? 50 OD1 ? B ASP 140 ? C ASP 140 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE1 ? B GLU 149 ? C GLU 149 ? 1_555 127.1 ? 51 OD1 ? B ASP 142 ? C ASP 142 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE1 ? B GLU 149 ? C GLU 149 ? 1_555 152.6 ? 52 O ? B GLU 144 ? C GLU 144 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE1 ? B GLU 149 ? C GLU 149 ? 1_555 78.4 ? 53 OD1 ? B ASP 138 ? C ASP 138 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE2 ? B GLU 149 ? C GLU 149 ? 1_555 97.7 ? 54 OD1 ? B ASP 140 ? C ASP 140 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE2 ? B GLU 149 ? C GLU 149 ? 1_555 74.0 ? 55 OD1 ? B ASP 142 ? C ASP 142 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE2 ? B GLU 149 ? C GLU 149 ? 1_555 148.0 ? 56 O ? B GLU 144 ? C GLU 144 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE2 ? B GLU 149 ? C GLU 149 ? 1_555 130.9 ? 57 OE1 ? B GLU 149 ? C GLU 149 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 OE2 ? B GLU 149 ? C GLU 149 ? 1_555 54.0 ? 58 OD1 ? B ASP 138 ? C ASP 138 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? I HOH . ? C HOH 301 ? 1_555 156.7 ? 59 OD1 ? B ASP 140 ? C ASP 140 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? I HOH . ? C HOH 301 ? 1_555 75.9 ? 60 OD1 ? B ASP 142 ? C ASP 142 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? I HOH . ? C HOH 301 ? 1_555 81.7 ? 61 O ? B GLU 144 ? C GLU 144 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? I HOH . ? C HOH 301 ? 1_555 108.4 ? 62 OE1 ? B GLU 149 ? C GLU 149 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? I HOH . ? C HOH 301 ? 1_555 88.2 ? 63 OE2 ? B GLU 149 ? C GLU 149 ? 1_555 CA ? E CA . ? C CA 201 ? 1_555 O ? I HOH . ? C HOH 301 ? 1_555 83.6 ? 64 OD1 ? B ASP 179 ? C ASP 179 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OD1 ? B ASN 181 ? C ASN 181 ? 1_555 77.3 ? 65 OD1 ? B ASP 179 ? C ASP 179 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OD1 ? B ASP 183 ? C ASP 183 ? 1_555 87.6 ? 66 OD1 ? B ASN 181 ? C ASN 181 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OD1 ? B ASP 183 ? C ASP 183 ? 1_555 72.4 ? 67 OD1 ? B ASP 179 ? C ASP 179 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? B LYS 185 ? C LYS 185 ? 1_555 91.9 ? 68 OD1 ? B ASN 181 ? C ASN 181 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? B LYS 185 ? C LYS 185 ? 1_555 155.5 ? 69 OD1 ? B ASP 183 ? C ASP 183 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? B LYS 185 ? C LYS 185 ? 1_555 85.4 ? 70 OD1 ? B ASP 179 ? C ASP 179 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE2 ? B GLU 190 ? C GLU 190 ? 1_555 82.2 ? 71 OD1 ? B ASN 181 ? C ASN 181 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE2 ? B GLU 190 ? C GLU 190 ? 1_555 75.9 ? 72 OD1 ? B ASP 183 ? C ASP 183 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE2 ? B GLU 190 ? C GLU 190 ? 1_555 148.1 ? 73 O ? B LYS 185 ? C LYS 185 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE2 ? B GLU 190 ? C GLU 190 ? 1_555 124.9 ? 74 OD1 ? B ASP 179 ? C ASP 179 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE1 ? B GLU 190 ? C GLU 190 ? 1_555 113.8 ? 75 OD1 ? B ASN 181 ? C ASN 181 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE1 ? B GLU 190 ? C GLU 190 ? 1_555 123.1 ? 76 OD1 ? B ASP 183 ? C ASP 183 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE1 ? B GLU 190 ? C GLU 190 ? 1_555 155.1 ? 77 O ? B LYS 185 ? C LYS 185 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE1 ? B GLU 190 ? C GLU 190 ? 1_555 81.3 ? 78 OE2 ? B GLU 190 ? C GLU 190 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 OE1 ? B GLU 190 ? C GLU 190 ? 1_555 53.0 ? 79 OD1 ? B ASP 179 ? C ASP 179 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? I HOH . ? C HOH 303 ? 1_555 159.2 ? 80 OD1 ? B ASN 181 ? C ASN 181 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? I HOH . ? C HOH 303 ? 1_555 87.1 ? 81 OD1 ? B ASP 183 ? C ASP 183 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? I HOH . ? C HOH 303 ? 1_555 74.4 ? 82 O ? B LYS 185 ? C LYS 185 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? I HOH . ? C HOH 303 ? 1_555 96.9 ? 83 OE2 ? B GLU 190 ? C GLU 190 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? I HOH . ? C HOH 303 ? 1_555 107.6 ? 84 OE1 ? B GLU 190 ? C GLU 190 ? 1_555 CA ? F CA . ? C CA 202 ? 1_555 O ? I HOH . ? C HOH 303 ? 1_555 86.3 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 144 ? ILE A 145 ? GLU A 144 ILE A 145 A 2 ILE A 186 ? ASP A 187 ? ILE A 186 ASP A 187 B 1 GLU B 144 ? ILE B 145 ? GLU C 144 ILE C 145 B 2 ILE B 186 ? ASP B 187 ? ILE C 186 ASP C 187 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 145 ? N ILE A 145 O ILE A 186 ? O ILE A 186 B 1 2 N ILE B 145 ? N ILE C 145 O ILE B 186 ? O ILE C 186 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 6 'BINDING SITE FOR RESIDUE CA A 201' AC2 Software A CA 202 ? 6 'BINDING SITE FOR RESIDUE CA A 202' AC3 Software C CA 201 ? 6 'BINDING SITE FOR RESIDUE CA C 201' AC4 Software C CA 202 ? 6 'BINDING SITE FOR RESIDUE CA C 202' AC5 Software C SO4 203 ? 3 'BINDING SITE FOR RESIDUE SO4 C 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 138 ? ASP A 138 . ? 1_555 ? 2 AC1 6 ASP A 140 ? ASP A 140 . ? 1_555 ? 3 AC1 6 ASP A 142 ? ASP A 142 . ? 1_555 ? 4 AC1 6 GLU A 144 ? GLU A 144 . ? 1_555 ? 5 AC1 6 GLU A 149 ? GLU A 149 . ? 1_555 ? 6 AC1 6 HOH H . ? HOH A 303 . ? 1_555 ? 7 AC2 6 ASP A 179 ? ASP A 179 . ? 1_555 ? 8 AC2 6 ASN A 181 ? ASN A 181 . ? 1_555 ? 9 AC2 6 ASP A 183 ? ASP A 183 . ? 1_555 ? 10 AC2 6 LYS A 185 ? LYS A 185 . ? 1_555 ? 11 AC2 6 GLU A 190 ? GLU A 190 . ? 1_555 ? 12 AC2 6 HOH H . ? HOH A 301 . ? 1_555 ? 13 AC3 6 ASP B 138 ? ASP C 138 . ? 1_555 ? 14 AC3 6 ASP B 140 ? ASP C 140 . ? 1_555 ? 15 AC3 6 ASP B 142 ? ASP C 142 . ? 1_555 ? 16 AC3 6 GLU B 144 ? GLU C 144 . ? 1_555 ? 17 AC3 6 GLU B 149 ? GLU C 149 . ? 1_555 ? 18 AC3 6 HOH I . ? HOH C 301 . ? 1_555 ? 19 AC4 6 ASP B 179 ? ASP C 179 . ? 1_555 ? 20 AC4 6 ASN B 181 ? ASN C 181 . ? 1_555 ? 21 AC4 6 ASP B 183 ? ASP C 183 . ? 1_555 ? 22 AC4 6 LYS B 185 ? LYS C 185 . ? 1_555 ? 23 AC4 6 GLU B 190 ? GLU C 190 . ? 1_555 ? 24 AC4 6 HOH I . ? HOH C 303 . ? 1_555 ? 25 AC5 3 HOH H . ? HOH A 307 . ? 2_454 ? 26 AC5 3 ARG B 122 ? ARG C 122 . ? 2_454 ? 27 AC5 3 GLN B 165 ? GLN C 165 . ? 1_555 ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 C _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 183 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 C _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 183 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 C _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 183 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.88 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.58 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -7.0070 -0.3620 9.0580 0.3284 0.0958 0.2754 0.0139 -0.0915 0.0569 5.5978 9.3331 10.2373 3.6026 3.7805 -4.8739 -0.5967 -0.1839 0.7806 0.3995 0.6072 0.1606 -0.5134 -0.3440 0.7379 'X-RAY DIFFRACTION' 2 ? refined -6.8460 -12.0790 19.2330 0.1811 0.0206 0.1617 0.0006 0.0423 0.0429 5.1752 2.9568 4.4172 -0.9502 1.6374 -0.5217 -0.0398 -0.1423 0.1821 0.0096 -0.1654 -0.0776 -0.0773 0.3666 -0.0367 'X-RAY DIFFRACTION' 3 ? refined 3.6460 -14.4440 20.1990 0.2576 0.2480 0.2508 0.1033 0.0627 0.0650 28.1680 15.5167 3.2804 -7.1438 -6.2672 6.6731 0.1936 0.2562 -0.4498 1.0552 0.0446 -1.2120 -0.9595 -0.3746 -0.0333 'X-RAY DIFFRACTION' 4 ? refined 6.2220 -16.8240 30.4300 0.3015 0.3322 0.3542 0.2206 -0.1464 -0.0038 14.9554 24.8021 1.5492 13.7553 -2.5566 1.3234 -0.2261 0.2238 0.0023 -0.4448 -0.9266 -1.4570 0.5004 0.2567 0.2671 'X-RAY DIFFRACTION' 5 ? refined 1.2200 -10.7050 31.3350 0.2097 0.0449 0.1937 0.0461 -0.0901 0.0502 0.0755 21.1237 7.1717 0.0702 -0.7196 -3.1784 -0.0079 -0.1118 0.1196 0.0066 -0.0044 -0.9748 1.0911 -0.0541 -0.0587 'X-RAY DIFFRACTION' 6 ? refined -2.8380 -3.8390 29.3420 0.2305 0.1403 0.1422 0.0464 0.0372 -0.0088 2.9804 19.5458 1.9882 -7.3663 0.1132 1.3270 0.1641 -0.0100 -0.1541 0.0663 0.1871 -0.5333 -0.2224 0.2097 0.2365 'X-RAY DIFFRACTION' 7 ? refined -11.2610 -3.4010 25.3850 0.2186 0.1105 0.1004 0.0492 0.0351 0.0255 3.4667 2.5319 10.2624 -0.8480 3.7153 0.3434 -0.3184 0.0600 0.2584 -0.2828 -0.0666 0.2151 0.3659 -0.4435 -0.5416 'X-RAY DIFFRACTION' 8 ? refined -5.4140 1.6940 19.4930 0.3625 0.1225 0.2155 -0.0619 -0.1657 0.1046 4.4473 6.6184 25.4578 2.9210 2.9399 12.4435 -0.5870 0.5705 0.0165 0.7160 0.6515 0.2467 -0.3204 -0.2452 0.7153 'X-RAY DIFFRACTION' 9 ? refined 2.3400 1.2440 25.3990 0.5051 0.5597 0.2305 0.2874 -0.0683 -0.1166 1.0052 7.4356 1.8512 2.3701 -1.3627 -3.1365 0.2272 0.3069 -0.5341 -0.0253 0.3968 1.1194 0.4507 -0.2971 0.0536 'X-RAY DIFFRACTION' 10 ? refined 4.7430 -2.8460 17.5640 0.2408 0.0749 0.0729 0.0219 -0.0360 0.0149 5.9344 5.7101 11.3885 -0.8054 -1.5456 2.1651 -0.3135 0.2130 0.1005 -0.4538 0.1051 -0.1406 0.5260 0.0713 -0.2569 'X-RAY DIFFRACTION' 11 ? refined 4.9140 -6.5810 3.7770 0.1780 0.0547 0.1055 -0.0066 0.0190 -0.0029 3.2765 2.8072 7.6165 0.2758 2.9243 0.6310 0.1381 -0.2091 0.0709 0.3081 -0.2234 -0.1789 0.0225 0.3719 0.1347 'X-RAY DIFFRACTION' 12 ? refined -5.4520 -7.2450 0.7030 0.0461 0.1142 0.0654 -0.0501 -0.0098 0.0151 30.0246 24.4617 21.7063 -3.5803 -3.6764 -0.7355 0.2270 -0.1808 -0.0463 -0.3376 -1.0505 0.9296 0.0622 0.8895 -0.9059 'X-RAY DIFFRACTION' 13 ? refined -5.5330 -1.0600 -8.5190 0.3458 0.2045 0.0957 0.0733 -0.0495 -0.0145 4.3082 2.8521 15.1897 3.1007 7.2077 3.8200 0.0299 0.1433 -0.1732 0.0306 -0.0168 0.0938 -0.0901 0.1684 -0.2763 'X-RAY DIFFRACTION' 14 ? refined 1.5020 6.6440 -0.7350 0.3184 0.1302 0.2707 0.0349 -0.1493 -0.0610 26.4125 13.4569 12.3481 9.3441 8.4890 10.9010 -0.4759 -0.2907 0.7666 0.0141 0.8537 -0.1613 -0.6089 -1.1358 -0.6461 'X-RAY DIFFRACTION' 15 ? refined 8.1930 3.1600 4.7850 0.2366 0.0747 0.1370 -0.0686 -0.0392 0.0784 4.8085 4.2981 11.5030 -0.8226 -0.4373 -0.8941 -0.1393 -0.2229 0.3622 0.4012 0.3971 -0.4303 -0.0190 -0.7681 0.5841 'X-RAY DIFFRACTION' 16 ? refined 1.8070 10.8030 13.0820 0.5206 0.0622 0.6023 0.0828 0.0510 -0.1379 2.6259 32.2494 3.1697 -9.1112 -2.2863 8.7323 0.1758 0.1062 -0.2820 -0.0379 -0.4077 1.1187 -1.1397 -0.7069 0.1043 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 123 A 135 ? . . . . ? 'X-RAY DIFFRACTION' 2 2 A 136 A 151 ? . . . . ? 'X-RAY DIFFRACTION' 3 3 A 152 A 162 ? . . . . ? 'X-RAY DIFFRACTION' 4 4 A 163 A 167 ? . . . . ? 'X-RAY DIFFRACTION' 5 5 A 168 A 173 ? . . . . ? 'X-RAY DIFFRACTION' 6 6 A 174 A 178 ? . . . . ? 'X-RAY DIFFRACTION' 7 7 A 179 A 190 ? . . . . ? 'X-RAY DIFFRACTION' 8 8 A 191 A 196 ? . . . . ? 'X-RAY DIFFRACTION' 9 9 C 121 C 126 ? . . . . ? 'X-RAY DIFFRACTION' 10 10 C 127 C 133 ? . . . . ? 'X-RAY DIFFRACTION' 11 11 C 134 C 151 ? . . . . ? 'X-RAY DIFFRACTION' 12 12 C 152 C 156 ? . . . . ? 'X-RAY DIFFRACTION' 13 13 C 163 C 172 ? . . . . ? 'X-RAY DIFFRACTION' 14 14 C 173 C 180 ? . . . . ? 'X-RAY DIFFRACTION' 15 15 C 181 C 193 ? . . . . ? 'X-RAY DIFFRACTION' 16 16 C 194 C 199 ? . . . . ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A ASN 13 ? A ASN 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A TYR 15 ? A TYR 15 16 1 Y 1 A PHE 16 ? A PHE 16 17 1 Y 1 A GLN 17 ? A GLN 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A LEU 19 ? A LEU 19 20 1 Y 1 A ASP 20 ? A ASP 20 21 1 Y 1 A VAL 21 ? A VAL 21 22 1 Y 1 A LYS 22 ? A LYS 22 23 1 Y 1 A MET 23 ? A MET 23 24 1 Y 1 A ASP 24 ? A ASP 24 25 1 Y 1 A ILE 25 ? A ILE 25 26 1 Y 1 A HIS 26 ? A HIS 26 27 1 Y 1 A VAL 27 ? A VAL 27 28 1 Y 1 A LEU 28 ? A LEU 28 29 1 Y 1 A GLU 29 ? A GLU 29 30 1 Y 1 A ASN 30 ? A ASN 30 31 1 Y 1 A PHE 31 ? A PHE 31 32 1 Y 1 A LYS 32 ? A LYS 32 33 1 Y 1 A ASN 33 ? A ASN 33 34 1 Y 1 A TYR 34 ? A TYR 34 35 1 Y 1 A ALA 35 ? A ALA 35 36 1 Y 1 A LEU 36 ? A LEU 36 37 1 Y 1 A LEU 37 ? A LEU 37 38 1 Y 1 A LEU 38 ? A LEU 38 39 1 Y 1 A LYS 39 ? A LYS 39 40 1 Y 1 A LEU 40 ? A LEU 40 41 1 Y 1 A GLN 41 ? A GLN 41 42 1 Y 1 A LYS 42 ? A LYS 42 43 1 Y 1 A LEU 43 ? A LEU 43 44 1 Y 1 A ALA 44 ? A ALA 44 45 1 Y 1 A MET 45 ? A MET 45 46 1 Y 1 A THR 46 ? A THR 46 47 1 Y 1 A ILE 47 ? A ILE 47 48 1 Y 1 A ILE 48 ? A ILE 48 49 1 Y 1 A ALA 49 ? A ALA 49 50 1 Y 1 A GLN 50 ? A GLN 50 51 1 Y 1 A GLN 51 ? A GLN 51 52 1 Y 1 A SER 52 ? A SER 52 53 1 Y 1 A ASN 53 ? A ASN 53 54 1 Y 1 A ASP 54 ? A ASP 54 55 1 Y 1 A TYR 55 ? A TYR 55 56 1 Y 1 A ASP 56 ? A ASP 56 57 1 Y 1 A LEU 57 ? A LEU 57 58 1 Y 1 A GLN 58 ? A GLN 58 59 1 Y 1 A GLN 59 ? A GLN 59 60 1 Y 1 A LEU 60 ? A LEU 60 61 1 Y 1 A LYS 61 ? A LYS 61 62 1 Y 1 A THR 62 ? A THR 62 63 1 Y 1 A VAL 63 ? A VAL 63 64 1 Y 1 A PHE 64 ? A PHE 64 65 1 Y 1 A LEU 65 ? A LEU 65 66 1 Y 1 A TYR 66 ? A TYR 66 67 1 Y 1 A LEU 67 ? A LEU 67 68 1 Y 1 A ASP 68 ? A ASP 68 69 1 Y 1 A GLU 69 ? A GLU 69 70 1 Y 1 A ASP 70 ? A ASP 70 71 1 Y 1 A GLY 71 ? A GLY 71 72 1 Y 1 A LYS 72 ? A LYS 72 73 1 Y 1 A GLY 73 ? A GLY 73 74 1 Y 1 A ASN 74 ? A ASN 74 75 1 Y 1 A ILE 75 ? A ILE 75 76 1 Y 1 A THR 76 ? A THR 76 77 1 Y 1 A LYS 77 ? A LYS 77 78 1 Y 1 A ASN 78 ? A ASN 78 79 1 Y 1 A GLN 79 ? A GLN 79 80 1 Y 1 A LEU 80 ? A LEU 80 81 1 Y 1 A LYS 81 ? A LYS 81 82 1 Y 1 A LYS 82 ? A LYS 82 83 1 Y 1 A GLY 83 ? A GLY 83 84 1 Y 1 A LEU 84 ? A LEU 84 85 1 Y 1 A GLU 85 ? A GLU 85 86 1 Y 1 A ASN 86 ? A ASN 86 87 1 Y 1 A SER 87 ? A SER 87 88 1 Y 1 A GLY 88 ? A GLY 88 89 1 Y 1 A LEU 89 ? A LEU 89 90 1 Y 1 A LYS 90 ? A LYS 90 91 1 Y 1 A LEU 91 ? A LEU 91 92 1 Y 1 A PRO 92 ? A PRO 92 93 1 Y 1 A GLN 93 ? A GLN 93 94 1 Y 1 A ASN 94 ? A ASN 94 95 1 Y 1 A PHE 95 ? A PHE 95 96 1 Y 1 A ASP 96 ? A ASP 96 97 1 Y 1 A VAL 97 ? A VAL 97 98 1 Y 1 A LEU 98 ? A LEU 98 99 1 Y 1 A LEU 99 ? A LEU 99 100 1 Y 1 A ASP 100 ? A ASP 100 101 1 Y 1 A GLN 101 ? A GLN 101 102 1 Y 1 A ILE 102 ? A ILE 102 103 1 Y 1 A ASP 103 ? A ASP 103 104 1 Y 1 A SER 104 ? A SER 104 105 1 Y 1 A ASP 105 ? A ASP 105 106 1 Y 1 A GLY 106 ? A GLY 106 107 1 Y 1 A SER 107 ? A SER 107 108 1 Y 1 A GLY 108 ? A GLY 108 109 1 Y 1 A ARG 109 ? A ARG 109 110 1 Y 1 A ILE 110 ? A ILE 110 111 1 Y 1 A ASP 111 ? A ASP 111 112 1 Y 1 A TYR 112 ? A TYR 112 113 1 Y 1 A THR 113 ? A THR 113 114 1 Y 1 A GLU 114 ? A GLU 114 115 1 Y 1 A PHE 115 ? A PHE 115 116 1 Y 1 A LEU 116 ? A LEU 116 117 1 Y 1 A ALA 117 ? A ALA 117 118 1 Y 1 A ALA 118 ? A ALA 118 119 1 Y 1 A ALA 119 ? A ALA 119 120 1 Y 1 A LEU 120 ? A LEU 120 121 1 Y 1 A ASP 121 ? A ASP 121 122 1 Y 1 A ARG 122 ? A ARG 122 123 1 Y 1 A GLY 157 ? A GLY 157 124 1 Y 1 A ASN 158 ? A ASN 158 125 1 Y 1 A LYS 159 ? A LYS 159 126 1 Y 1 A LYS 160 ? A LYS 160 127 1 Y 1 A GLY 161 ? A GLY 161 128 1 Y 1 A LEU 197 ? A LEU 197 129 1 Y 1 A LYS 198 ? A LYS 198 130 1 Y 1 A TYR 199 ? A TYR 199 131 1 Y 1 C MET 1 ? B MET 1 132 1 Y 1 C HIS 2 ? B HIS 2 133 1 Y 1 C HIS 3 ? B HIS 3 134 1 Y 1 C HIS 4 ? B HIS 4 135 1 Y 1 C HIS 5 ? B HIS 5 136 1 Y 1 C HIS 6 ? B HIS 6 137 1 Y 1 C HIS 7 ? B HIS 7 138 1 Y 1 C SER 8 ? B SER 8 139 1 Y 1 C SER 9 ? B SER 9 140 1 Y 1 C GLY 10 ? B GLY 10 141 1 Y 1 C ARG 11 ? B ARG 11 142 1 Y 1 C GLU 12 ? B GLU 12 143 1 Y 1 C ASN 13 ? B ASN 13 144 1 Y 1 C LEU 14 ? B LEU 14 145 1 Y 1 C TYR 15 ? B TYR 15 146 1 Y 1 C PHE 16 ? B PHE 16 147 1 Y 1 C GLN 17 ? B GLN 17 148 1 Y 1 C GLY 18 ? B GLY 18 149 1 Y 1 C LEU 19 ? B LEU 19 150 1 Y 1 C ASP 20 ? B ASP 20 151 1 Y 1 C VAL 21 ? B VAL 21 152 1 Y 1 C LYS 22 ? B LYS 22 153 1 Y 1 C MET 23 ? B MET 23 154 1 Y 1 C ASP 24 ? B ASP 24 155 1 Y 1 C ILE 25 ? B ILE 25 156 1 Y 1 C HIS 26 ? B HIS 26 157 1 Y 1 C VAL 27 ? B VAL 27 158 1 Y 1 C LEU 28 ? B LEU 28 159 1 Y 1 C GLU 29 ? B GLU 29 160 1 Y 1 C ASN 30 ? B ASN 30 161 1 Y 1 C PHE 31 ? B PHE 31 162 1 Y 1 C LYS 32 ? B LYS 32 163 1 Y 1 C ASN 33 ? B ASN 33 164 1 Y 1 C TYR 34 ? B TYR 34 165 1 Y 1 C ALA 35 ? B ALA 35 166 1 Y 1 C LEU 36 ? B LEU 36 167 1 Y 1 C LEU 37 ? B LEU 37 168 1 Y 1 C LEU 38 ? B LEU 38 169 1 Y 1 C LYS 39 ? B LYS 39 170 1 Y 1 C LEU 40 ? B LEU 40 171 1 Y 1 C GLN 41 ? B GLN 41 172 1 Y 1 C LYS 42 ? B LYS 42 173 1 Y 1 C LEU 43 ? B LEU 43 174 1 Y 1 C ALA 44 ? B ALA 44 175 1 Y 1 C MET 45 ? B MET 45 176 1 Y 1 C THR 46 ? B THR 46 177 1 Y 1 C ILE 47 ? B ILE 47 178 1 Y 1 C ILE 48 ? B ILE 48 179 1 Y 1 C ALA 49 ? B ALA 49 180 1 Y 1 C GLN 50 ? B GLN 50 181 1 Y 1 C GLN 51 ? B GLN 51 182 1 Y 1 C SER 52 ? B SER 52 183 1 Y 1 C ASN 53 ? B ASN 53 184 1 Y 1 C ASP 54 ? B ASP 54 185 1 Y 1 C TYR 55 ? B TYR 55 186 1 Y 1 C ASP 56 ? B ASP 56 187 1 Y 1 C LEU 57 ? B LEU 57 188 1 Y 1 C GLN 58 ? B GLN 58 189 1 Y 1 C GLN 59 ? B GLN 59 190 1 Y 1 C LEU 60 ? B LEU 60 191 1 Y 1 C LYS 61 ? B LYS 61 192 1 Y 1 C THR 62 ? B THR 62 193 1 Y 1 C VAL 63 ? B VAL 63 194 1 Y 1 C PHE 64 ? B PHE 64 195 1 Y 1 C LEU 65 ? B LEU 65 196 1 Y 1 C TYR 66 ? B TYR 66 197 1 Y 1 C LEU 67 ? B LEU 67 198 1 Y 1 C ASP 68 ? B ASP 68 199 1 Y 1 C GLU 69 ? B GLU 69 200 1 Y 1 C ASP 70 ? B ASP 70 201 1 Y 1 C GLY 71 ? B GLY 71 202 1 Y 1 C LYS 72 ? B LYS 72 203 1 Y 1 C GLY 73 ? B GLY 73 204 1 Y 1 C ASN 74 ? B ASN 74 205 1 Y 1 C ILE 75 ? B ILE 75 206 1 Y 1 C THR 76 ? B THR 76 207 1 Y 1 C LYS 77 ? B LYS 77 208 1 Y 1 C ASN 78 ? B ASN 78 209 1 Y 1 C GLN 79 ? B GLN 79 210 1 Y 1 C LEU 80 ? B LEU 80 211 1 Y 1 C LYS 81 ? B LYS 81 212 1 Y 1 C LYS 82 ? B LYS 82 213 1 Y 1 C GLY 83 ? B GLY 83 214 1 Y 1 C LEU 84 ? B LEU 84 215 1 Y 1 C GLU 85 ? B GLU 85 216 1 Y 1 C ASN 86 ? B ASN 86 217 1 Y 1 C SER 87 ? B SER 87 218 1 Y 1 C GLY 88 ? B GLY 88 219 1 Y 1 C LEU 89 ? B LEU 89 220 1 Y 1 C LYS 90 ? B LYS 90 221 1 Y 1 C LEU 91 ? B LEU 91 222 1 Y 1 C PRO 92 ? B PRO 92 223 1 Y 1 C GLN 93 ? B GLN 93 224 1 Y 1 C ASN 94 ? B ASN 94 225 1 Y 1 C PHE 95 ? B PHE 95 226 1 Y 1 C ASP 96 ? B ASP 96 227 1 Y 1 C VAL 97 ? B VAL 97 228 1 Y 1 C LEU 98 ? B LEU 98 229 1 Y 1 C LEU 99 ? B LEU 99 230 1 Y 1 C ASP 100 ? B ASP 100 231 1 Y 1 C GLN 101 ? B GLN 101 232 1 Y 1 C ILE 102 ? B ILE 102 233 1 Y 1 C ASP 103 ? B ASP 103 234 1 Y 1 C SER 104 ? B SER 104 235 1 Y 1 C ASP 105 ? B ASP 105 236 1 Y 1 C GLY 106 ? B GLY 106 237 1 Y 1 C SER 107 ? B SER 107 238 1 Y 1 C GLY 108 ? B GLY 108 239 1 Y 1 C ARG 109 ? B ARG 109 240 1 Y 1 C ILE 110 ? B ILE 110 241 1 Y 1 C ASP 111 ? B ASP 111 242 1 Y 1 C TYR 112 ? B TYR 112 243 1 Y 1 C THR 113 ? B THR 113 244 1 Y 1 C GLU 114 ? B GLU 114 245 1 Y 1 C PHE 115 ? B PHE 115 246 1 Y 1 C LEU 116 ? B LEU 116 247 1 Y 1 C ALA 117 ? B ALA 117 248 1 Y 1 C ALA 118 ? B ALA 118 249 1 Y 1 C ALA 119 ? B ALA 119 250 1 Y 1 C LEU 120 ? B LEU 120 251 1 Y 1 C GLY 157 ? B GLY 157 252 1 Y 1 C ASN 158 ? B ASN 158 253 1 Y 1 C LYS 159 ? B LYS 159 254 1 Y 1 C LYS 160 ? B LYS 160 255 1 Y 1 C GLY 161 ? B GLY 161 256 1 Y 1 C SER 162 ? B SER 162 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _atom_sites.entry_id 4JWQ _atom_sites.fract_transf_matrix[1][1] 0.040710 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014339 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011040 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O S # loop_