data_4K5Z # _entry.id 4K5Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4K5Z RCSB RCSB078933 WWPDB D_1000078933 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3S0N 'Human Chymase bound to benzimidazolone inhibitor' unspecified PDB 4K2Y 'Human Chymase in Complex with Fragment Inhibitor 6-chloro-1,3-dihydro-2H-indol-2-one' unspecified PDB 4K60 'Human Chymase in Complex with Fragment 6-bromo-1,3-dihydro-2H-indol-2-one' unspecified PDB 4K69 ;Human Chymase in Complex with Fragment Linked Benzimidazolone Inhibitor: (3S)-3-{3-[(6-bromo-2-oxo-2,3-dihydro-1H-indol-4-yl)methyl]-2-oxo-2,3-dihydro-1H-benzimidazol-1-yl}hexanoic acid ; unspecified # _pdbx_database_status.entry_id 4K5Z _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-04-15 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Collins, B.K.' 1 'Padyana, A.K.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.' J.Med.Chem. 56 4465 4481 2013 JMCMAR US 0022-2623 0151 ? 23659209 10.1021/jm400138z 1 'Benzimidazolone as potent chymase inhibitor: modulation of reactive metabolite formation in the hydrophobic (P1) region.' Bioorg.Med.Chem.Lett. 21 4533 4539 2011 BMCLE8 UK 0960-894X 1127 ? 21733690 10.1016/j.bmcl.2011.05.126 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Taylor, S.J.' 1 ? primary 'Padyana, A.K.' 2 ? primary 'Abeywardane, A.' 3 ? primary 'Liang, S.' 4 ? primary 'Hao, M.H.' 5 ? primary 'De Lombaert, S.' 6 ? primary 'Proudfoot, J.' 7 ? primary 'Farmer, B.S.' 8 ? primary 'Li, X.' 9 ? primary 'Collins, B.' 10 ? primary 'Martin, L.' 11 ? primary 'Albaugh, D.R.' 12 ? primary 'Hill-Drzewi, M.' 13 ? primary 'Pullen, S.S.' 14 ? primary 'Takahashi, H.' 15 ? 1 'Lo, H.Y.' 16 ? 1 'Nemoto, P.A.' 17 ? 1 'Kim, J.M.' 18 ? 1 'Hao, M.H.' 19 ? 1 'Qian, K.C.' 20 ? 1 'Farrow, N.A.' 21 ? 1 'Albaugh, D.R.' 22 ? 1 'Fowler, D.M.' 23 ? 1 'Schneiderman, R.D.' 24 ? 1 'Michael August, E.' 25 ? 1 'Martin, L.' 26 ? 1 'Hill-Drzewi, M.' 27 ? 1 'Pullen, S.S.' 28 ? 1 'Takahashi, H.' 29 ? 1 'De Lombaert, S.' 30 ? # _cell.length_a 74.609 _cell.length_b 74.609 _cell.length_c 49.897 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4K5Z _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 43' _symmetry.entry_id 4K5Z _symmetry.Int_Tables_number 78 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Chymase 24991.857 1 3.4.21.39 ? 'UNP residues 22-247' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn 6-chloro-2,3-dihydro-1H-isoindol-1-one 167.592 1 ? ? ? ? 5 water nat water 18.015 223 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Alpha-chymase, Mast cell protease I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPK YNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDF DHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN ; _entity_poly.pdbx_seq_one_letter_code_can ;IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPK YNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDF DHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ILE n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 GLU n 1 7 CYS n 1 8 LYS n 1 9 PRO n 1 10 HIS n 1 11 SER n 1 12 ARG n 1 13 PRO n 1 14 TYR n 1 15 MET n 1 16 ALA n 1 17 TYR n 1 18 LEU n 1 19 GLU n 1 20 ILE n 1 21 VAL n 1 22 THR n 1 23 SER n 1 24 ASN n 1 25 GLY n 1 26 PRO n 1 27 SER n 1 28 LYS n 1 29 PHE n 1 30 CYS n 1 31 GLY n 1 32 GLY n 1 33 PHE n 1 34 LEU n 1 35 ILE n 1 36 ARG n 1 37 ARG n 1 38 ASN n 1 39 PHE n 1 40 VAL n 1 41 LEU n 1 42 THR n 1 43 ALA n 1 44 ALA n 1 45 HIS n 1 46 CYS n 1 47 ALA n 1 48 GLY n 1 49 ARG n 1 50 SER n 1 51 ILE n 1 52 THR n 1 53 VAL n 1 54 THR n 1 55 LEU n 1 56 GLY n 1 57 ALA n 1 58 HIS n 1 59 ASN n 1 60 ILE n 1 61 THR n 1 62 GLU n 1 63 GLU n 1 64 GLU n 1 65 ASP n 1 66 THR n 1 67 TRP n 1 68 GLN n 1 69 LYS n 1 70 LEU n 1 71 GLU n 1 72 VAL n 1 73 ILE n 1 74 LYS n 1 75 GLN n 1 76 PHE n 1 77 ARG n 1 78 HIS n 1 79 PRO n 1 80 LYS n 1 81 TYR n 1 82 ASN n 1 83 THR n 1 84 SER n 1 85 THR n 1 86 LEU n 1 87 HIS n 1 88 HIS n 1 89 ASP n 1 90 ILE n 1 91 MET n 1 92 LEU n 1 93 LEU n 1 94 LYS n 1 95 LEU n 1 96 LYS n 1 97 GLU n 1 98 LYS n 1 99 ALA n 1 100 SER n 1 101 LEU n 1 102 THR n 1 103 LEU n 1 104 ALA n 1 105 VAL n 1 106 GLY n 1 107 THR n 1 108 LEU n 1 109 PRO n 1 110 PHE n 1 111 PRO n 1 112 SER n 1 113 GLN n 1 114 LYS n 1 115 ASN n 1 116 PHE n 1 117 VAL n 1 118 PRO n 1 119 PRO n 1 120 GLY n 1 121 ARG n 1 122 MET n 1 123 CYS n 1 124 ARG n 1 125 VAL n 1 126 ALA n 1 127 GLY n 1 128 TRP n 1 129 GLY n 1 130 ARG n 1 131 THR n 1 132 GLY n 1 133 VAL n 1 134 LEU n 1 135 LYS n 1 136 PRO n 1 137 GLY n 1 138 SER n 1 139 ASP n 1 140 THR n 1 141 LEU n 1 142 GLN n 1 143 GLU n 1 144 VAL n 1 145 LYS n 1 146 LEU n 1 147 ARG n 1 148 LEU n 1 149 MET n 1 150 ASP n 1 151 PRO n 1 152 GLN n 1 153 ALA n 1 154 CYS n 1 155 SER n 1 156 HIS n 1 157 PHE n 1 158 ARG n 1 159 ASP n 1 160 PHE n 1 161 ASP n 1 162 HIS n 1 163 ASN n 1 164 LEU n 1 165 GLN n 1 166 LEU n 1 167 CYS n 1 168 VAL n 1 169 GLY n 1 170 ASN n 1 171 PRO n 1 172 ARG n 1 173 LYS n 1 174 THR n 1 175 LYS n 1 176 SER n 1 177 ALA n 1 178 PHE n 1 179 LYS n 1 180 GLY n 1 181 ASP n 1 182 SER n 1 183 GLY n 1 184 GLY n 1 185 PRO n 1 186 LEU n 1 187 LEU n 1 188 CYS n 1 189 ALA n 1 190 GLY n 1 191 ALA n 1 192 ALA n 1 193 GLN n 1 194 GLY n 1 195 ILE n 1 196 VAL n 1 197 SER n 1 198 TYR n 1 199 GLY n 1 200 ARG n 1 201 SER n 1 202 ASP n 1 203 ALA n 1 204 LYS n 1 205 PRO n 1 206 PRO n 1 207 ALA n 1 208 VAL n 1 209 PHE n 1 210 THR n 1 211 ARG n 1 212 ILE n 1 213 SER n 1 214 HIS n 1 215 TYR n 1 216 GLN n 1 217 PRO n 1 218 TRP n 1 219 ILE n 1 220 ASN n 1 221 GLN n 1 222 ILE n 1 223 LEU n 1 224 GLN n 1 225 ALA n 1 226 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CMA1, CYH, CYM' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pDest1393 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CMA1_HUMAN _struct_ref.pdbx_db_accession P23946 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPK YNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDF DHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN ; _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4K5Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 226 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23946 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 247 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4K5Z LYS A 114 ? UNP P23946 PHE 135 conflict 127 1 1 4K5Z ALA A 191 ? UNP P23946 VAL 212 conflict 208 2 1 4K5Z GLN A 216 ? UNP P23946 ARG 237 conflict 235 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1P7 non-polymer . 6-chloro-2,3-dihydro-1H-isoindol-1-one ? 'C8 H6 Cl N O' 167.592 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.entry_id 4K5Z _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 55.73 _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_meas ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details '26-33% PEG8000, 0.1 M Tris, pH 8.0, 2 mM zinc sulfate, VAPOR DIFFUSION, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU SATURN 92' _diffrn_detector.pdbx_collection_date 2007-01-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Ni FILTER' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54180 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.pdbx_wavelength_list 1.54180 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 4K5Z _reflns.d_resolution_high 1.800 _reflns.d_resolution_low 74.61 _reflns.number_obs 25581 _reflns.pdbx_scaling_rejects 664 _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_netI_over_sigmaI 12.1 _reflns.pdbx_chi_squared 0.930 _reflns.pdbx_redundancy 3.43 _reflns.percent_possible_obs 99.9 _reflns.observed_criterion_sigma_F 1.0 _reflns.observed_criterion_sigma_I 1.0 _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.800 1.860 ? 6752 ? 0.280 2.40 ? 0.770 2.64 ? 2554 100.0 1 1 1.860 1.940 ? 7021 ? 0.312 1.80 ? 0.920 2.78 ? 2529 100.0 2 1 1.940 2.030 ? 7343 ? 0.207 3.10 ? 0.770 2.90 ? 2531 100.0 3 1 2.030 2.130 ? 7863 ? 0.143 5.00 ? 0.780 3.04 ? 2585 100.0 4 1 2.130 2.270 ? 8142 ? 0.242 3.60 ? 0.850 3.23 ? 2518 99.9 5 1 2.270 2.440 ? 8683 ? 0.145 5.90 ? 0.770 3.41 ? 2546 100.0 6 1 2.440 2.690 ? 9197 ? 0.087 9.60 ? 0.810 3.59 ? 2558 99.9 7 1 2.690 3.080 ? 9824 ? 0.066 14.20 ? 0.980 3.80 ? 2561 99.8 8 1 3.080 3.880 ? 10527 ? 0.083 14.50 ? 1.000 4.03 ? 2587 99.9 9 1 3.880 74.610 ? 13166 ? 0.037 40.30 ? 1.270 4.88 ? 2612 99.1 10 1 # _refine.entry_id 4K5Z _refine.ls_d_res_high 1.800 _refine.ls_d_res_low 74.609 _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 97.53 _refine.ls_number_reflns_obs 24986 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2254 _refine.ls_R_factor_R_work 0.2234 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2627 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.8500 _refine.ls_number_reflns_R_free 1213 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 25.6311 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2400 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 76.940 _refine.B_iso_min 10.880 _refine.pdbx_overall_phase_error 27.0200 _refine.occupancy_max 1.000 _refine.occupancy_min 0.420 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1705 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 223 _refine_hist.number_atoms_total 1954 _refine_hist.d_res_high 1.800 _refine_hist.d_res_low 74.609 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 1792 0.008 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2424 1.141 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 267 0.082 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 311 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 658 12.526 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 1.800 1.8721 9 100.0 2690 . 0.2969 0.3597 . 148 . 2838 . . 'X-RAY DIFFRACTION' 1.8721 1.9573 9 80.0 2126 . 0.4317 0.4752 . 119 . 2245 . . 'X-RAY DIFFRACTION' 1.9573 2.0605 9 100.0 2689 . 0.2394 0.3181 . 132 . 2821 . . 'X-RAY DIFFRACTION' 2.0605 2.1896 9 100.0 2713 . 0.2273 0.2563 . 131 . 2844 . . 'X-RAY DIFFRACTION' 2.1896 2.3587 9 99.0 2684 . 0.3581 0.4451 . 128 . 2812 . . 'X-RAY DIFFRACTION' 2.3587 2.5961 9 100.0 2709 . 0.2080 0.2327 . 131 . 2840 . . 'X-RAY DIFFRACTION' 2.5961 2.9718 9 100.0 2707 . 0.2126 0.2525 . 130 . 2837 . . 'X-RAY DIFFRACTION' 2.9718 3.7441 9 100.0 2720 . 0.1897 0.2395 . 141 . 2861 . . 'X-RAY DIFFRACTION' 3.7441 74.6731 9 99.0 2735 . 0.1639 0.1873 . 153 . 2888 . . 'X-RAY DIFFRACTION' # _struct.entry_id 4K5Z _struct.title 'Crystal Structure of Human Chymase in Complex with Fragment Inhibitor 6-chloro-2,3-dihydro-1H-isoindol-1-one' _struct.pdbx_descriptor 'Chymase (E.C.3.4.21.39)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4K5Z _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' _struct_keywords.text 'serine protease, glycosylated, Mast cells, secreted, HYDROLASE-HYDROLASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 43 ? ALA A 47 ? ALA A 55 ALA A 59 5 ? 5 HELX_P HELX_P2 2 ASP A 150 ? SER A 155 ? ASP A 164 SER A 169 5 ? 6 HELX_P HELX_P3 3 ILE A 212 ? ASN A 226 ? ILE A 231 ASN A 245 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 188 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 167 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.043 ? ? covale1 covale one ? A ASN 59 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 72 A NAG 701 1_555 ? ? ? ? ? ? ? 1.225 ? N-Glycosylation metalc1 metalc ? ? A HIS 10 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 25 A ZN 702 1_555 ? ? ? ? ? ? ? 2.140 ? ? metalc2 metalc ? ? A GLU 64 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 78 A ZN 702 1_555 ? ? ? ? ? ? ? 2.150 ? ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 702 A HOH 982 1_555 ? ? ? ? ? ? ? 2.375 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 205 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 224 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 206 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 225 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.30 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 5 ? GLU A 6 ? THR A 20 GLU A 21 A 2 GLN A 142 ? MET A 149 ? GLN A 156 MET A 163 A 3 GLN A 165 ? VAL A 168 ? GLN A 180 VAL A 183 A 4 ALA A 207 ? ARG A 211 ? ALA A 226 ARG A 230 A 5 ALA A 191 ? TYR A 198 ? ALA A 208 TYR A 215 A 6 PRO A 185 ? CYS A 188 ? PRO A 198 CYS A 201 A 7 MET A 122 ? GLY A 127 ? MET A 135 GLY A 140 A 8 GLN A 142 ? MET A 149 ? GLN A 156 MET A 163 B 1 MET A 15 ? THR A 22 A MET A 30 THR A 36 B 2 GLY A 25 ? ARG A 36 ? GLY A 37 ARG A 48 B 3 PHE A 39 ? THR A 42 ? PHE A 51 THR A 54 B 4 MET A 91 ? LEU A 95 ? MET A 104 LEU A 108 B 5 GLN A 68 ? ARG A 77 ? GLN A 81 ARG A 90 B 6 SER A 50 ? LEU A 55 ? SER A 63 LEU A 68 B 7 MET A 15 ? THR A 22 A MET A 30 THR A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 5 ? N THR A 20 O GLU A 143 ? O GLU A 157 A 2 3 N MET A 149 ? N MET A 163 O CYS A 167 ? O CYS A 182 A 3 4 N LEU A 166 ? N LEU A 181 O PHE A 209 ? O PHE A 228 A 4 5 O VAL A 208 ? O VAL A 227 N TYR A 198 ? N TYR A 215 A 5 6 O GLN A 193 ? O GLN A 210 N LEU A 186 ? N LEU A 199 A 6 7 O LEU A 187 ? O LEU A 200 N ARG A 124 ? N ARG A 137 A 7 8 N CYS A 123 ? N CYS A 136 O LEU A 146 ? O LEU A 160 B 1 2 N ILE A 20 ? N ILE A 35 O LYS A 28 ? O LYS A 40 B 2 3 N PHE A 33 ? N PHE A 45 O LEU A 41 ? O LEU A 53 B 3 4 N VAL A 40 ? N VAL A 52 O LEU A 93 ? O LEU A 106 B 4 5 O LEU A 92 ? O LEU A 105 N PHE A 76 ? N PHE A 89 B 5 6 O LEU A 70 ? O LEU A 83 N VAL A 53 ? N VAL A 66 B 6 7 O SER A 50 ? O SER A 63 N VAL A 21 ? N VAL A 36 # _atom_sites.entry_id 4K5Z _atom_sites.fract_transf_matrix[1][1] 0.013403 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013403 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020041 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 ILE 2 17 17 ILE ILE A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 GLU 6 21 21 GLU GLU A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 LYS 8 23 23 LYS LYS A . n A 1 9 PRO 9 24 24 PRO PRO A . n A 1 10 HIS 10 25 25 HIS HIS A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 ARG 12 27 27 ARG ARG A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 MET 15 30 30 MET MET A . n A 1 16 ALA 16 31 31 ALA ALA A . n A 1 17 TYR 17 32 32 TYR TYR A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 GLU 19 34 34 GLU GLU A . n A 1 20 ILE 20 35 35 ILE ILE A . n A 1 21 VAL 21 36 36 VAL VAL A . n A 1 22 THR 22 36 36 THR THR A A n A 1 23 SER 23 36 36 SER SER A B n A 1 24 ASN 24 36 36 ASN ASN A C n A 1 25 GLY 25 37 37 GLY GLY A . n A 1 26 PRO 26 38 38 PRO PRO A . n A 1 27 SER 27 39 39 SER SER A . n A 1 28 LYS 28 40 40 LYS LYS A . n A 1 29 PHE 29 41 41 PHE PHE A . n A 1 30 CYS 30 42 42 CYS CYS A . n A 1 31 GLY 31 43 43 GLY GLY A . n A 1 32 GLY 32 44 44 GLY GLY A . n A 1 33 PHE 33 45 45 PHE PHE A . n A 1 34 LEU 34 46 46 LEU LEU A . n A 1 35 ILE 35 47 47 ILE ILE A . n A 1 36 ARG 36 48 48 ARG ARG A . n A 1 37 ARG 37 49 49 ARG ARG A . n A 1 38 ASN 38 50 50 ASN ASN A . n A 1 39 PHE 39 51 51 PHE PHE A . n A 1 40 VAL 40 52 52 VAL VAL A . n A 1 41 LEU 41 53 53 LEU LEU A . n A 1 42 THR 42 54 54 THR THR A . n A 1 43 ALA 43 55 55 ALA ALA A . n A 1 44 ALA 44 56 56 ALA ALA A . n A 1 45 HIS 45 57 57 HIS HIS A . n A 1 46 CYS 46 58 58 CYS CYS A . n A 1 47 ALA 47 59 59 ALA ALA A . n A 1 48 GLY 48 60 60 GLY GLY A . n A 1 49 ARG 49 61 61 ARG ARG A . n A 1 50 SER 50 63 63 SER SER A . n A 1 51 ILE 51 64 64 ILE ILE A . n A 1 52 THR 52 65 65 THR THR A . n A 1 53 VAL 53 66 66 VAL VAL A . n A 1 54 THR 54 67 67 THR THR A . n A 1 55 LEU 55 68 68 LEU LEU A . n A 1 56 GLY 56 69 69 GLY GLY A . n A 1 57 ALA 57 70 70 ALA ALA A . n A 1 58 HIS 58 71 71 HIS HIS A . n A 1 59 ASN 59 72 72 ASN ASN A . n A 1 60 ILE 60 73 73 ILE ILE A . n A 1 61 THR 61 74 74 THR THR A . n A 1 62 GLU 62 75 75 GLU GLU A . n A 1 63 GLU 63 77 77 GLU GLU A . n A 1 64 GLU 64 78 78 GLU GLU A . n A 1 65 ASP 65 79 79 ASP ASP A . n A 1 66 THR 66 79 79 THR THR A A n A 1 67 TRP 67 80 80 TRP TRP A . n A 1 68 GLN 68 81 81 GLN GLN A . n A 1 69 LYS 69 82 82 LYS LYS A . n A 1 70 LEU 70 83 83 LEU LEU A . n A 1 71 GLU 71 84 84 GLU GLU A . n A 1 72 VAL 72 85 85 VAL VAL A . n A 1 73 ILE 73 86 86 ILE ILE A . n A 1 74 LYS 74 87 87 LYS LYS A . n A 1 75 GLN 75 88 88 GLN GLN A . n A 1 76 PHE 76 89 89 PHE PHE A . n A 1 77 ARG 77 90 90 ARG ARG A . n A 1 78 HIS 78 91 91 HIS HIS A . n A 1 79 PRO 79 92 92 PRO PRO A . n A 1 80 LYS 80 93 93 LYS LYS A . n A 1 81 TYR 81 94 94 TYR TYR A . n A 1 82 ASN 82 95 95 ASN ASN A . n A 1 83 THR 83 96 96 THR THR A . n A 1 84 SER 84 97 97 SER SER A . n A 1 85 THR 85 98 98 THR THR A . n A 1 86 LEU 86 99 99 LEU LEU A . n A 1 87 HIS 87 100 100 HIS HIS A . n A 1 88 HIS 88 101 101 HIS HIS A . n A 1 89 ASP 89 102 102 ASP ASP A . n A 1 90 ILE 90 103 103 ILE ILE A . n A 1 91 MET 91 104 104 MET MET A . n A 1 92 LEU 92 105 105 LEU LEU A . n A 1 93 LEU 93 106 106 LEU LEU A . n A 1 94 LYS 94 107 107 LYS LYS A . n A 1 95 LEU 95 108 108 LEU LEU A . n A 1 96 LYS 96 109 109 LYS LYS A . n A 1 97 GLU 97 110 110 GLU GLU A . n A 1 98 LYS 98 111 111 LYS LYS A . n A 1 99 ALA 99 112 112 ALA ALA A . n A 1 100 SER 100 113 113 SER SER A . n A 1 101 LEU 101 114 114 LEU LEU A . n A 1 102 THR 102 115 115 THR THR A . n A 1 103 LEU 103 116 116 LEU LEU A . n A 1 104 ALA 104 117 117 ALA ALA A . n A 1 105 VAL 105 118 118 VAL VAL A . n A 1 106 GLY 106 119 119 GLY GLY A . n A 1 107 THR 107 120 120 THR THR A . n A 1 108 LEU 108 121 121 LEU LEU A . n A 1 109 PRO 109 122 122 PRO PRO A . n A 1 110 PHE 110 123 123 PHE PHE A . n A 1 111 PRO 111 124 ? ? ? A . n A 1 112 SER 112 125 ? ? ? A . n A 1 113 GLN 113 126 ? ? ? A . n A 1 114 LYS 114 127 ? ? ? A . n A 1 115 ASN 115 128 ? ? ? A . n A 1 116 PHE 116 129 ? ? ? A . n A 1 117 VAL 117 130 130 VAL VAL A . n A 1 118 PRO 118 131 131 PRO PRO A . n A 1 119 PRO 119 132 132 PRO PRO A . n A 1 120 GLY 120 133 133 GLY GLY A . n A 1 121 ARG 121 134 134 ARG ARG A . n A 1 122 MET 122 135 135 MET MET A . n A 1 123 CYS 123 136 136 CYS CYS A . n A 1 124 ARG 124 137 137 ARG ARG A . n A 1 125 VAL 125 138 138 VAL VAL A . n A 1 126 ALA 126 139 139 ALA ALA A . n A 1 127 GLY 127 140 140 GLY GLY A . n A 1 128 TRP 128 141 141 TRP TRP A . n A 1 129 GLY 129 142 142 GLY GLY A . n A 1 130 ARG 130 143 143 ARG ARG A . n A 1 131 THR 131 144 144 THR THR A . n A 1 132 GLY 132 145 145 GLY GLY A . n A 1 133 VAL 133 146 146 VAL VAL A . n A 1 134 LEU 134 147 147 LEU LEU A . n A 1 135 LYS 135 148 148 LYS LYS A . n A 1 136 PRO 136 150 150 PRO PRO A . n A 1 137 GLY 137 151 151 GLY GLY A . n A 1 138 SER 138 152 152 SER SER A . n A 1 139 ASP 139 153 153 ASP ASP A . n A 1 140 THR 140 154 154 THR THR A . n A 1 141 LEU 141 155 155 LEU LEU A . n A 1 142 GLN 142 156 156 GLN GLN A . n A 1 143 GLU 143 157 157 GLU GLU A . n A 1 144 VAL 144 158 158 VAL VAL A . n A 1 145 LYS 145 159 159 LYS LYS A . n A 1 146 LEU 146 160 160 LEU LEU A . n A 1 147 ARG 147 161 161 ARG ARG A . n A 1 148 LEU 148 162 162 LEU LEU A . n A 1 149 MET 149 163 163 MET MET A . n A 1 150 ASP 150 164 164 ASP ASP A . n A 1 151 PRO 151 165 165 PRO PRO A . n A 1 152 GLN 152 166 166 GLN GLN A . n A 1 153 ALA 153 167 167 ALA ALA A . n A 1 154 CYS 154 168 168 CYS CYS A . n A 1 155 SER 155 169 169 SER SER A . n A 1 156 HIS 156 172 172 HIS HIS A . n A 1 157 PHE 157 173 173 PHE PHE A . n A 1 158 ARG 158 174 174 ARG ARG A . n A 1 159 ASP 159 175 175 ASP ASP A . n A 1 160 PHE 160 176 176 PHE PHE A . n A 1 161 ASP 161 177 177 ASP ASP A . n A 1 162 HIS 162 177 177 HIS HIS A A n A 1 163 ASN 163 178 178 ASN ASN A . n A 1 164 LEU 164 179 179 LEU LEU A . n A 1 165 GLN 165 180 180 GLN GLN A . n A 1 166 LEU 166 181 181 LEU LEU A . n A 1 167 CYS 167 182 182 CYS CYS A . n A 1 168 VAL 168 183 183 VAL VAL A . n A 1 169 GLY 169 184 184 GLY GLY A . n A 1 170 ASN 170 185 185 ASN ASN A . n A 1 171 PRO 171 185 185 PRO PRO A A n A 1 172 ARG 172 185 185 ARG ARG A B n A 1 173 LYS 173 186 186 LYS LYS A . n A 1 174 THR 174 187 187 THR THR A . n A 1 175 LYS 175 188 188 LYS LYS A . n A 1 176 SER 176 189 189 SER SER A . n A 1 177 ALA 177 190 190 ALA ALA A . n A 1 178 PHE 178 191 191 PHE PHE A . n A 1 179 LYS 179 192 192 LYS LYS A . n A 1 180 GLY 180 193 193 GLY GLY A . n A 1 181 ASP 181 194 194 ASP ASP A . n A 1 182 SER 182 195 195 SER SER A . n A 1 183 GLY 183 196 196 GLY GLY A . n A 1 184 GLY 184 197 197 GLY GLY A . n A 1 185 PRO 185 198 198 PRO PRO A . n A 1 186 LEU 186 199 199 LEU LEU A . n A 1 187 LEU 187 200 200 LEU LEU A . n A 1 188 CYS 188 201 201 CYS CYS A . n A 1 189 ALA 189 202 202 ALA ALA A . n A 1 190 GLY 190 207 207 GLY GLY A . n A 1 191 ALA 191 208 208 ALA ALA A . n A 1 192 ALA 192 209 209 ALA ALA A . n A 1 193 GLN 193 210 210 GLN GLN A . n A 1 194 GLY 194 211 211 GLY GLY A . n A 1 195 ILE 195 212 212 ILE ILE A . n A 1 196 VAL 196 213 213 VAL VAL A . n A 1 197 SER 197 214 214 SER SER A . n A 1 198 TYR 198 215 215 TYR TYR A . n A 1 199 GLY 199 216 216 GLY GLY A . n A 1 200 ARG 200 217 217 ARG ARG A . n A 1 201 SER 201 218 218 SER SER A . n A 1 202 ASP 202 219 219 ASP ASP A . n A 1 203 ALA 203 220 220 ALA ALA A . n A 1 204 LYS 204 221 221 LYS LYS A . n A 1 205 PRO 205 224 224 PRO PRO A . n A 1 206 PRO 206 225 225 PRO PRO A . n A 1 207 ALA 207 226 226 ALA ALA A . n A 1 208 VAL 208 227 227 VAL VAL A . n A 1 209 PHE 209 228 228 PHE PHE A . n A 1 210 THR 210 229 229 THR THR A . n A 1 211 ARG 211 230 230 ARG ARG A . n A 1 212 ILE 212 231 231 ILE ILE A . n A 1 213 SER 213 232 232 SER SER A . n A 1 214 HIS 214 233 233 HIS HIS A . n A 1 215 TYR 215 234 234 TYR TYR A . n A 1 216 GLN 216 235 235 GLN GLN A . n A 1 217 PRO 217 236 236 PRO PRO A . n A 1 218 TRP 218 237 237 TRP TRP A . n A 1 219 ILE 219 238 238 ILE ILE A . n A 1 220 ASN 220 239 239 ASN ASN A . n A 1 221 GLN 221 240 240 GLN GLN A . n A 1 222 ILE 222 241 241 ILE ILE A . n A 1 223 LEU 223 242 242 LEU LEU A . n A 1 224 GLN 224 243 243 GLN GLN A . n A 1 225 ALA 225 244 244 ALA ALA A . n A 1 226 ASN 226 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 701 701 NAG NAG A . C 3 ZN 1 702 800 ZN ZN2 A . D 4 1P7 1 703 990 1P7 LIG A . E 5 HOH 1 801 1 HOH HOH A . E 5 HOH 2 802 2 HOH HOH A . E 5 HOH 3 803 3 HOH HOH A . E 5 HOH 4 804 4 HOH HOH A . E 5 HOH 5 805 5 HOH HOH A . E 5 HOH 6 806 6 HOH HOH A . E 5 HOH 7 807 7 HOH HOH A . E 5 HOH 8 808 8 HOH HOH A . E 5 HOH 9 809 9 HOH HOH A . E 5 HOH 10 810 10 HOH HOH A . E 5 HOH 11 811 11 HOH HOH A . E 5 HOH 12 812 12 HOH HOH A . E 5 HOH 13 813 13 HOH HOH A . E 5 HOH 14 814 14 HOH HOH A . E 5 HOH 15 815 15 HOH HOH A . E 5 HOH 16 816 16 HOH HOH A . E 5 HOH 17 817 17 HOH HOH A . E 5 HOH 18 818 18 HOH HOH A . E 5 HOH 19 819 19 HOH HOH A . E 5 HOH 20 820 20 HOH HOH A . E 5 HOH 21 821 21 HOH HOH A . E 5 HOH 22 822 22 HOH HOH A . E 5 HOH 23 823 23 HOH HOH A . E 5 HOH 24 824 24 HOH HOH A . E 5 HOH 25 825 25 HOH HOH A . E 5 HOH 26 826 26 HOH HOH A . E 5 HOH 27 827 27 HOH HOH A . E 5 HOH 28 828 28 HOH HOH A . E 5 HOH 29 829 29 HOH HOH A . E 5 HOH 30 830 30 HOH HOH A . E 5 HOH 31 831 31 HOH HOH A . E 5 HOH 32 832 32 HOH HOH A . E 5 HOH 33 833 33 HOH HOH A . E 5 HOH 34 834 34 HOH HOH A . E 5 HOH 35 835 35 HOH HOH A . E 5 HOH 36 836 36 HOH HOH A . E 5 HOH 37 837 37 HOH HOH A . E 5 HOH 38 838 38 HOH HOH A . E 5 HOH 39 839 39 HOH HOH A . E 5 HOH 40 840 40 HOH HOH A . E 5 HOH 41 841 41 HOH HOH A . E 5 HOH 42 842 42 HOH HOH A . E 5 HOH 43 843 43 HOH HOH A . E 5 HOH 44 844 44 HOH HOH A . E 5 HOH 45 845 45 HOH HOH A . E 5 HOH 46 846 46 HOH HOH A . E 5 HOH 47 847 47 HOH HOH A . E 5 HOH 48 848 48 HOH HOH A . E 5 HOH 49 849 49 HOH HOH A . E 5 HOH 50 850 50 HOH HOH A . E 5 HOH 51 851 51 HOH HOH A . E 5 HOH 52 852 52 HOH HOH A . E 5 HOH 53 853 53 HOH HOH A . E 5 HOH 54 854 54 HOH HOH A . E 5 HOH 55 855 55 HOH HOH A . E 5 HOH 56 856 56 HOH HOH A . E 5 HOH 57 857 57 HOH HOH A . E 5 HOH 58 858 58 HOH HOH A . E 5 HOH 59 859 59 HOH HOH A . E 5 HOH 60 860 60 HOH HOH A . E 5 HOH 61 861 61 HOH HOH A . E 5 HOH 62 862 62 HOH HOH A . E 5 HOH 63 863 63 HOH HOH A . E 5 HOH 64 864 64 HOH HOH A . E 5 HOH 65 865 65 HOH HOH A . E 5 HOH 66 866 66 HOH HOH A . E 5 HOH 67 867 67 HOH HOH A . E 5 HOH 68 868 68 HOH HOH A . E 5 HOH 69 869 69 HOH HOH A . E 5 HOH 70 870 70 HOH HOH A . E 5 HOH 71 871 71 HOH HOH A . E 5 HOH 72 872 72 HOH HOH A . E 5 HOH 73 873 73 HOH HOH A . E 5 HOH 74 874 74 HOH HOH A . E 5 HOH 75 875 75 HOH HOH A . E 5 HOH 76 876 76 HOH HOH A . E 5 HOH 77 877 77 HOH HOH A . E 5 HOH 78 878 78 HOH HOH A . E 5 HOH 79 879 79 HOH HOH A . E 5 HOH 80 880 80 HOH HOH A . E 5 HOH 81 881 81 HOH HOH A . E 5 HOH 82 882 82 HOH HOH A . E 5 HOH 83 883 83 HOH HOH A . E 5 HOH 84 884 84 HOH HOH A . E 5 HOH 85 885 85 HOH HOH A . E 5 HOH 86 886 86 HOH HOH A . E 5 HOH 87 887 87 HOH HOH A . E 5 HOH 88 888 88 HOH HOH A . E 5 HOH 89 889 89 HOH HOH A . E 5 HOH 90 890 90 HOH HOH A . E 5 HOH 91 891 91 HOH HOH A . E 5 HOH 92 892 92 HOH HOH A . E 5 HOH 93 893 93 HOH HOH A . E 5 HOH 94 894 94 HOH HOH A . E 5 HOH 95 895 95 HOH HOH A . E 5 HOH 96 896 96 HOH HOH A . E 5 HOH 97 897 97 HOH HOH A . E 5 HOH 98 898 98 HOH HOH A . E 5 HOH 99 899 99 HOH HOH A . E 5 HOH 100 900 100 HOH HOH A . E 5 HOH 101 901 101 HOH HOH A . E 5 HOH 102 902 102 HOH HOH A . E 5 HOH 103 903 103 HOH HOH A . E 5 HOH 104 904 104 HOH HOH A . E 5 HOH 105 905 105 HOH HOH A . E 5 HOH 106 906 106 HOH HOH A . E 5 HOH 107 907 107 HOH HOH A . E 5 HOH 108 908 108 HOH HOH A . E 5 HOH 109 909 109 HOH HOH A . E 5 HOH 110 910 110 HOH HOH A . E 5 HOH 111 911 111 HOH HOH A . E 5 HOH 112 912 112 HOH HOH A . E 5 HOH 113 913 113 HOH HOH A . E 5 HOH 114 914 114 HOH HOH A . E 5 HOH 115 915 115 HOH HOH A . E 5 HOH 116 916 116 HOH HOH A . E 5 HOH 117 917 117 HOH HOH A . E 5 HOH 118 918 118 HOH HOH A . E 5 HOH 119 919 119 HOH HOH A . E 5 HOH 120 920 120 HOH HOH A . E 5 HOH 121 921 121 HOH HOH A . E 5 HOH 122 922 122 HOH HOH A . E 5 HOH 123 923 123 HOH HOH A . E 5 HOH 124 924 124 HOH HOH A . E 5 HOH 125 925 125 HOH HOH A . E 5 HOH 126 926 126 HOH HOH A . E 5 HOH 127 927 127 HOH HOH A . E 5 HOH 128 928 128 HOH HOH A . E 5 HOH 129 929 129 HOH HOH A . E 5 HOH 130 930 130 HOH HOH A . E 5 HOH 131 931 131 HOH HOH A . E 5 HOH 132 932 132 HOH HOH A . E 5 HOH 133 933 133 HOH HOH A . E 5 HOH 134 934 134 HOH HOH A . E 5 HOH 135 935 135 HOH HOH A . E 5 HOH 136 936 136 HOH HOH A . E 5 HOH 137 937 137 HOH HOH A . E 5 HOH 138 938 138 HOH HOH A . E 5 HOH 139 939 139 HOH HOH A . E 5 HOH 140 940 140 HOH HOH A . E 5 HOH 141 941 141 HOH HOH A . E 5 HOH 142 942 142 HOH HOH A . E 5 HOH 143 943 143 HOH HOH A . E 5 HOH 144 944 144 HOH HOH A . E 5 HOH 145 945 145 HOH HOH A . E 5 HOH 146 946 146 HOH HOH A . E 5 HOH 147 947 147 HOH HOH A . E 5 HOH 148 948 148 HOH HOH A . E 5 HOH 149 949 149 HOH HOH A . E 5 HOH 150 950 150 HOH HOH A . E 5 HOH 151 951 151 HOH HOH A . E 5 HOH 152 952 152 HOH HOH A . E 5 HOH 153 953 153 HOH HOH A . E 5 HOH 154 954 154 HOH HOH A . E 5 HOH 155 955 155 HOH HOH A . E 5 HOH 156 956 156 HOH HOH A . E 5 HOH 157 957 157 HOH HOH A . E 5 HOH 158 958 158 HOH HOH A . E 5 HOH 159 959 159 HOH HOH A . E 5 HOH 160 960 160 HOH HOH A . E 5 HOH 161 961 161 HOH HOH A . E 5 HOH 162 962 162 HOH HOH A . E 5 HOH 163 963 163 HOH HOH A . E 5 HOH 164 964 164 HOH HOH A . E 5 HOH 165 965 165 HOH HOH A . E 5 HOH 166 966 166 HOH HOH A . E 5 HOH 167 967 167 HOH HOH A . E 5 HOH 168 968 168 HOH HOH A . E 5 HOH 169 969 169 HOH HOH A . E 5 HOH 170 970 170 HOH HOH A . E 5 HOH 171 971 171 HOH HOH A . E 5 HOH 172 972 172 HOH HOH A . E 5 HOH 173 973 173 HOH HOH A . E 5 HOH 174 974 174 HOH HOH A . E 5 HOH 175 975 175 HOH HOH A . E 5 HOH 176 976 176 HOH HOH A . E 5 HOH 177 977 177 HOH HOH A . E 5 HOH 178 978 178 HOH HOH A . E 5 HOH 179 979 179 HOH HOH A . E 5 HOH 180 980 180 HOH HOH A . E 5 HOH 181 981 181 HOH HOH A . E 5 HOH 182 982 182 HOH HOH A . E 5 HOH 183 983 183 HOH HOH A . E 5 HOH 184 984 184 HOH HOH A . E 5 HOH 185 985 185 HOH HOH A . E 5 HOH 186 986 186 HOH HOH A . E 5 HOH 187 987 187 HOH HOH A . E 5 HOH 188 988 188 HOH HOH A . E 5 HOH 189 989 189 HOH HOH A . E 5 HOH 190 990 190 HOH HOH A . E 5 HOH 191 991 191 HOH HOH A . E 5 HOH 192 992 192 HOH HOH A . E 5 HOH 193 993 193 HOH HOH A . E 5 HOH 194 994 194 HOH HOH A . E 5 HOH 195 995 195 HOH HOH A . E 5 HOH 196 996 196 HOH HOH A . E 5 HOH 197 997 197 HOH HOH A . E 5 HOH 198 998 198 HOH HOH A . E 5 HOH 199 999 199 HOH HOH A . E 5 HOH 200 1000 200 HOH HOH A . E 5 HOH 201 1001 201 HOH HOH A . E 5 HOH 202 1002 202 HOH HOH A . E 5 HOH 203 1003 203 HOH HOH A . E 5 HOH 204 1004 204 HOH HOH A . E 5 HOH 205 1005 205 HOH HOH A . E 5 HOH 206 1006 206 HOH HOH A . E 5 HOH 207 1007 207 HOH HOH A . E 5 HOH 208 1008 208 HOH HOH A . E 5 HOH 209 1009 209 HOH HOH A . E 5 HOH 210 1010 210 HOH HOH A . E 5 HOH 211 1011 211 HOH HOH A . E 5 HOH 212 1012 212 HOH HOH A . E 5 HOH 213 1013 213 HOH HOH A . E 5 HOH 214 1014 214 HOH HOH A . E 5 HOH 215 1015 215 HOH HOH A . E 5 HOH 216 1016 216 HOH HOH A . E 5 HOH 217 1017 217 HOH HOH A . E 5 HOH 218 1018 218 HOH HOH A . E 5 HOH 219 1019 219 HOH HOH A . E 5 HOH 220 1020 220 HOH HOH A . E 5 HOH 221 1021 221 HOH HOH A . E 5 HOH 222 1022 222 HOH HOH A . E 5 HOH 223 1023 223 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ASN _pdbx_struct_mod_residue.label_seq_id 59 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ASN _pdbx_struct_mod_residue.auth_seq_id 72 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASN _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 10 ? A HIS 25 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 OE1 ? A GLU 64 ? A GLU 78 ? 1_555 113.7 ? 2 NE2 ? A HIS 10 ? A HIS 25 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? E HOH . ? A HOH 982 ? 1_555 94.8 ? 3 OE1 ? A GLU 64 ? A GLU 78 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? E HOH . ? A HOH 982 ? 1_555 118.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-29 2 'Structure model' 1 1 2013-07-03 3 'Structure model' 1 2 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp 2 3 'Structure model' entity 3 3 'Structure model' pdbx_chem_comp_identifier 4 3 'Structure model' pdbx_entity_nonpoly 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 3 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_chem_comp.name' 2 3 'Structure model' '_chem_comp.type' 3 3 'Structure model' '_entity.pdbx_description' 4 3 'Structure model' '_pdbx_entity_nonpoly.name' 5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 3 'Structure model' '_struct_conn.pdbx_role' 7 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 d*TREK 9.5L 'Jan 9 2006' package 'Jim W. Pflugrath' Jim.Pflugrath@Rigaku.com 'data reduction' http://www.rigaku.com/software/dtrek.html ? ? 2 PHENIX 1.8.2_1309 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 3 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 StructureStudio . ? ? ? ? 'data collection' ? ? ? 5 d*TREK . ? ? ? ? 'data scaling' ? ? ? 6 CNX . ? ? ? ? phasing ? ? ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 72 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O5 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 NAG _pdbx_validate_close_contact.auth_seq_id_2 701 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.98 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 71 ? ? -121.27 -74.08 2 1 SER A 214 ? ? -123.68 -75.74 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 124 ? A PRO 111 2 1 Y 1 A SER 125 ? A SER 112 3 1 Y 1 A GLN 126 ? A GLN 113 4 1 Y 1 A LYS 127 ? A LYS 114 5 1 Y 1 A ASN 128 ? A ASN 115 6 1 Y 1 A PHE 129 ? A PHE 116 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'ZINC ION' ZN 4 6-chloro-2,3-dihydro-1H-isoindol-1-one 1P7 5 water HOH #