data_4K7E # _entry.id 4K7E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4K7E RCSB RCSB078984 WWPDB D_1000078984 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4K7E _pdbx_database_status.recvd_initial_deposition_date 2013-04-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.J.' 1 'Li, L.' 2 'Liu, X.' 3 'Dong, S.S.' 4 'Wang, W.M.' 5 'Huo, T.' 6 'Rao, Z.H.' 7 'Yang, C.' 8 # _citation.id primary _citation.title 'Crystal structure of Junin virus nucleoprotein' _citation.journal_abbrev J.Gen.Virol. _citation.journal_volume 94 _citation.page_first 2175 _citation.page_last 2183 _citation.year 2013 _citation.journal_id_ASTM JGVIAY _citation.country US _citation.journal_id_ISSN 0022-1317 _citation.journal_id_CSD 2058 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23884367 _citation.pdbx_database_id_DOI 10.1099/vir.0.055053-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, Y.J.' 1 primary 'Li, L.' 2 primary 'Liu, X.' 3 primary 'Dong, S.S.' 4 primary 'Wang, W.M.' 5 primary 'Huo, T.' 6 primary 'Guo, Y.' 7 primary 'Rao, Z.H.' 8 primary 'Yang, C.' 9 # _cell.entry_id 4K7E _cell.length_a 40.415 _cell.length_b 78.472 _cell.length_c 136.010 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4K7E _symmetry.space_group_name_H-M 'I 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 24 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Nucleoprotein 26667.738 1 ? ? 'C-TERMINAL DOMAIN, residues 341-564' ? 2 water nat water 18.015 78 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nucleocapsid protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LEVLFQGPLGSMPRQPEKNGQNLRLANLTEIQEAVIREAVGKLDPTNTLWLDIEGPATDPVEMALFQPAGKQYIHCFRKP HDEKGFKNGSRHSHGILMKDIEDAMPGVLSYVIGLLPPDMVVTTQGSDDIRKLFDLHGRRDLKLVDVRLTSEQARQFDQQ VWEKYGHLCKYHNGVVVNKKKRDKDTPFKLASSEPHCALLDCIMFQSVLDGKLYEEELTPLLPSSLLFLPKAAYAL ; _entity_poly.pdbx_seq_one_letter_code_can ;LEVLFQGPLGSMPRQPEKNGQNLRLANLTEIQEAVIREAVGKLDPTNTLWLDIEGPATDPVEMALFQPAGKQYIHCFRKP HDEKGFKNGSRHSHGILMKDIEDAMPGVLSYVIGLLPPDMVVTTQGSDDIRKLFDLHGRRDLKLVDVRLTSEQARQFDQQ VWEKYGHLCKYHNGVVVNKKKRDKDTPFKLASSEPHCALLDCIMFQSVLDGKLYEEELTPLLPSSLLFLPKAAYAL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLU n 1 3 VAL n 1 4 LEU n 1 5 PHE n 1 6 GLN n 1 7 GLY n 1 8 PRO n 1 9 LEU n 1 10 GLY n 1 11 SER n 1 12 MET n 1 13 PRO n 1 14 ARG n 1 15 GLN n 1 16 PRO n 1 17 GLU n 1 18 LYS n 1 19 ASN n 1 20 GLY n 1 21 GLN n 1 22 ASN n 1 23 LEU n 1 24 ARG n 1 25 LEU n 1 26 ALA n 1 27 ASN n 1 28 LEU n 1 29 THR n 1 30 GLU n 1 31 ILE n 1 32 GLN n 1 33 GLU n 1 34 ALA n 1 35 VAL n 1 36 ILE n 1 37 ARG n 1 38 GLU n 1 39 ALA n 1 40 VAL n 1 41 GLY n 1 42 LYS n 1 43 LEU n 1 44 ASP n 1 45 PRO n 1 46 THR n 1 47 ASN n 1 48 THR n 1 49 LEU n 1 50 TRP n 1 51 LEU n 1 52 ASP n 1 53 ILE n 1 54 GLU n 1 55 GLY n 1 56 PRO n 1 57 ALA n 1 58 THR n 1 59 ASP n 1 60 PRO n 1 61 VAL n 1 62 GLU n 1 63 MET n 1 64 ALA n 1 65 LEU n 1 66 PHE n 1 67 GLN n 1 68 PRO n 1 69 ALA n 1 70 GLY n 1 71 LYS n 1 72 GLN n 1 73 TYR n 1 74 ILE n 1 75 HIS n 1 76 CYS n 1 77 PHE n 1 78 ARG n 1 79 LYS n 1 80 PRO n 1 81 HIS n 1 82 ASP n 1 83 GLU n 1 84 LYS n 1 85 GLY n 1 86 PHE n 1 87 LYS n 1 88 ASN n 1 89 GLY n 1 90 SER n 1 91 ARG n 1 92 HIS n 1 93 SER n 1 94 HIS n 1 95 GLY n 1 96 ILE n 1 97 LEU n 1 98 MET n 1 99 LYS n 1 100 ASP n 1 101 ILE n 1 102 GLU n 1 103 ASP n 1 104 ALA n 1 105 MET n 1 106 PRO n 1 107 GLY n 1 108 VAL n 1 109 LEU n 1 110 SER n 1 111 TYR n 1 112 VAL n 1 113 ILE n 1 114 GLY n 1 115 LEU n 1 116 LEU n 1 117 PRO n 1 118 PRO n 1 119 ASP n 1 120 MET n 1 121 VAL n 1 122 VAL n 1 123 THR n 1 124 THR n 1 125 GLN n 1 126 GLY n 1 127 SER n 1 128 ASP n 1 129 ASP n 1 130 ILE n 1 131 ARG n 1 132 LYS n 1 133 LEU n 1 134 PHE n 1 135 ASP n 1 136 LEU n 1 137 HIS n 1 138 GLY n 1 139 ARG n 1 140 ARG n 1 141 ASP n 1 142 LEU n 1 143 LYS n 1 144 LEU n 1 145 VAL n 1 146 ASP n 1 147 VAL n 1 148 ARG n 1 149 LEU n 1 150 THR n 1 151 SER n 1 152 GLU n 1 153 GLN n 1 154 ALA n 1 155 ARG n 1 156 GLN n 1 157 PHE n 1 158 ASP n 1 159 GLN n 1 160 GLN n 1 161 VAL n 1 162 TRP n 1 163 GLU n 1 164 LYS n 1 165 TYR n 1 166 GLY n 1 167 HIS n 1 168 LEU n 1 169 CYS n 1 170 LYS n 1 171 TYR n 1 172 HIS n 1 173 ASN n 1 174 GLY n 1 175 VAL n 1 176 VAL n 1 177 VAL n 1 178 ASN n 1 179 LYS n 1 180 LYS n 1 181 LYS n 1 182 ARG n 1 183 ASP n 1 184 LYS n 1 185 ASP n 1 186 THR n 1 187 PRO n 1 188 PHE n 1 189 LYS n 1 190 LEU n 1 191 ALA n 1 192 SER n 1 193 SER n 1 194 GLU n 1 195 PRO n 1 196 HIS n 1 197 CYS n 1 198 ALA n 1 199 LEU n 1 200 LEU n 1 201 ASP n 1 202 CYS n 1 203 ILE n 1 204 MET n 1 205 PHE n 1 206 GLN n 1 207 SER n 1 208 VAL n 1 209 LEU n 1 210 ASP n 1 211 GLY n 1 212 LYS n 1 213 LEU n 1 214 TYR n 1 215 GLU n 1 216 GLU n 1 217 GLU n 1 218 LEU n 1 219 THR n 1 220 PRO n 1 221 LEU n 1 222 LEU n 1 223 PRO n 1 224 SER n 1 225 SER n 1 226 LEU n 1 227 LEU n 1 228 PHE n 1 229 LEU n 1 230 PRO n 1 231 LYS n 1 232 ALA n 1 233 ALA n 1 234 TYR n 1 235 ALA n 1 236 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene N _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Junin virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11619 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6p-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6IVU2_JUNIN _struct_ref.pdbx_db_accession Q6IVU2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PRQPEKNGQNLRLANLTEIQEAVIREAVGKLDPTNTLWLDIEGPATDPVEMALFQPAGKQYIHCFRKPHDEKGFKNGSRH SHGILMKDIEDAMPGVLSYVIGLLPPDMVVTTQGSDDIRKLFDLHGRRDLKLVDVRLTSEQARQFDQQVWEKYGHLCKYH NGVVVNKKKRDKDTPFKLASSEPHCALLDCIMFQSVLDGKLYEEELTPLLPSSLLFLPKAAYAL ; _struct_ref.pdbx_align_begin 341 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4K7E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6IVU2 _struct_ref_seq.db_align_beg 341 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 564 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 341 _struct_ref_seq.pdbx_auth_seq_align_end 564 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4K7E LEU A 1 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 329 1 1 4K7E GLU A 2 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 330 2 1 4K7E VAL A 3 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 331 3 1 4K7E LEU A 4 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 332 4 1 4K7E PHE A 5 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 333 5 1 4K7E GLN A 6 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 334 6 1 4K7E GLY A 7 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 335 7 1 4K7E PRO A 8 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 336 8 1 4K7E LEU A 9 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 337 9 1 4K7E GLY A 10 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 338 10 1 4K7E SER A 11 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 339 11 1 4K7E MET A 12 ? UNP Q6IVU2 ? ? 'EXPRESSION TAG' 340 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4K7E _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_percent_sol 39.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '0.1M Tris, 2.2M ammonium sulfate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.pdbx_collection_date 2012-12-18 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.000 # _reflns.entry_id 4K7E _reflns.observed_criterion_sigma_I 3.0 _reflns.observed_criterion_sigma_F 3.0 _reflns.d_resolution_low 39.26 _reflns.d_resolution_high 2.2 _reflns.number_obs 11370 _reflns.number_all 11382 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 32.110 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.24 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs 0.083 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 53.5 _reflns_shell.pdbx_redundancy 10.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 11382 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4K7E _refine.ls_number_reflns_obs 11370 _refine.ls_number_reflns_all 11382 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.256 _refine.ls_d_res_high 2.200 _refine.ls_percent_reflns_obs 99.65 _refine.ls_R_factor_obs 0.1979 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1965 _refine.ls_R_factor_R_free 0.2239 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.78 _refine.ls_number_reflns_R_free 544 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 41.8034 _refine.aniso_B[1][1] -17.1704 _refine.aniso_B[2][2] 24.6504 _refine.aniso_B[3][3] -7.4801 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.373 _refine.solvent_model_param_bsol 45.851 _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.83 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.23 _refine.overall_FOM_work_R_set 0.8133 _refine.B_iso_max 88.720 _refine.B_iso_min 20.000 _refine.pdbx_overall_phase_error 24.2200 _refine.occupancy_max 1.000 _refine.occupancy_min 0.390 _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1198 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 1276 _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 39.256 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1229 0.006 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1668 1.004 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 190 0.064 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 216 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 465 14.837 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.redundancy_reflns_obs 2.1997 2.4210 4 100.0000 2636 . 0.2133 0.2620 . 139 . 2775 . 'X-RAY DIFFRACTION' . 2.4210 2.7712 4 100.0000 2677 . 0.2178 0.3077 . 137 . 2814 . 'X-RAY DIFFRACTION' . 2.7712 3.4911 4 100.0000 2692 . 0.2046 0.2465 . 135 . 2827 . 'X-RAY DIFFRACTION' . 3.4911 39.2623 4 99.0000 2821 . 0.1825 0.1745 . 133 . 2954 . 'X-RAY DIFFRACTION' . # _struct.entry_id 4K7E _struct.title 'Crystal structure of Junin virus nucleoprotein' _struct.pdbx_descriptor Nucleoprotein _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4K7E _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'alpha/beta/alpha sandwich, nucleoprotein, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 29 ? LYS A 42 ? THR A 357 LYS A 370 1 ? 14 HELX_P HELX_P2 2 MET A 105 ? LEU A 116 ? MET A 433 LEU A 444 1 ? 12 HELX_P HELX_P3 3 SER A 127 ? HIS A 137 ? SER A 455 HIS A 465 1 ? 11 HELX_P HELX_P4 4 THR A 150 ? ARG A 155 ? THR A 478 ARG A 483 1 ? 6 HELX_P HELX_P5 5 PHE A 157 ? GLY A 166 ? PHE A 485 GLY A 494 1 ? 10 HELX_P HELX_P6 6 HIS A 167 ? CYS A 169 ? HIS A 495 CYS A 497 5 ? 3 HELX_P HELX_P7 7 CYS A 197 ? GLY A 211 ? CYS A 525 GLY A 539 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 169 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id B _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 197 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 497 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 525 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.033 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 50 ? GLU A 54 ? TRP A 378 GLU A 382 A 2 GLU A 62 ? GLN A 67 ? GLU A 390 GLN A 395 A 3 GLN A 72 ? PHE A 77 ? GLN A 400 PHE A 405 A 4 THR A 219 ? PRO A 220 ? THR A 547 PRO A 548 B 1 VAL A 121 ? THR A 124 ? VAL A 449 THR A 452 B 2 LYS A 143 ? ASP A 146 ? LYS A 471 ASP A 474 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 50 ? N TRP A 378 O PHE A 66 ? O PHE A 394 A 2 3 N LEU A 65 ? N LEU A 393 O ILE A 74 ? O ILE A 402 A 3 4 N TYR A 73 ? N TYR A 401 O THR A 219 ? O THR A 547 B 1 2 N VAL A 122 ? N VAL A 450 O LYS A 143 ? O LYS A 471 # _database_PDB_matrix.entry_id 4K7E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4K7E _atom_sites.fract_transf_matrix[1][1] 0.024743 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012743 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007352 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 329 ? ? ? A . n A 1 2 GLU 2 330 ? ? ? A . n A 1 3 VAL 3 331 ? ? ? A . n A 1 4 LEU 4 332 ? ? ? A . n A 1 5 PHE 5 333 ? ? ? A . n A 1 6 GLN 6 334 ? ? ? A . n A 1 7 GLY 7 335 ? ? ? A . n A 1 8 PRO 8 336 ? ? ? A . n A 1 9 LEU 9 337 ? ? ? A . n A 1 10 GLY 10 338 ? ? ? A . n A 1 11 SER 11 339 ? ? ? A . n A 1 12 MET 12 340 ? ? ? A . n A 1 13 PRO 13 341 ? ? ? A . n A 1 14 ARG 14 342 ? ? ? A . n A 1 15 GLN 15 343 ? ? ? A . n A 1 16 PRO 16 344 ? ? ? A . n A 1 17 GLU 17 345 ? ? ? A . n A 1 18 LYS 18 346 ? ? ? A . n A 1 19 ASN 19 347 ? ? ? A . n A 1 20 GLY 20 348 ? ? ? A . n A 1 21 GLN 21 349 ? ? ? A . n A 1 22 ASN 22 350 ? ? ? A . n A 1 23 LEU 23 351 ? ? ? A . n A 1 24 ARG 24 352 ? ? ? A . n A 1 25 LEU 25 353 ? ? ? A . n A 1 26 ALA 26 354 ? ? ? A . n A 1 27 ASN 27 355 355 ASN ASN A . n A 1 28 LEU 28 356 356 LEU LEU A . n A 1 29 THR 29 357 357 THR THR A . n A 1 30 GLU 30 358 358 GLU GLU A . n A 1 31 ILE 31 359 359 ILE ILE A . n A 1 32 GLN 32 360 360 GLN GLN A . n A 1 33 GLU 33 361 361 GLU GLU A . n A 1 34 ALA 34 362 362 ALA ALA A . n A 1 35 VAL 35 363 363 VAL VAL A . n A 1 36 ILE 36 364 364 ILE ILE A . n A 1 37 ARG 37 365 365 ARG ARG A . n A 1 38 GLU 38 366 366 GLU GLU A . n A 1 39 ALA 39 367 367 ALA ALA A . n A 1 40 VAL 40 368 368 VAL VAL A . n A 1 41 GLY 41 369 369 GLY GLY A . n A 1 42 LYS 42 370 370 LYS LYS A . n A 1 43 LEU 43 371 371 LEU LEU A . n A 1 44 ASP 44 372 372 ASP ASP A . n A 1 45 PRO 45 373 373 PRO PRO A . n A 1 46 THR 46 374 374 THR THR A . n A 1 47 ASN 47 375 375 ASN ASN A . n A 1 48 THR 48 376 376 THR THR A . n A 1 49 LEU 49 377 377 LEU LEU A . n A 1 50 TRP 50 378 378 TRP TRP A . n A 1 51 LEU 51 379 379 LEU LEU A . n A 1 52 ASP 52 380 380 ASP ASP A . n A 1 53 ILE 53 381 381 ILE ILE A . n A 1 54 GLU 54 382 382 GLU GLU A . n A 1 55 GLY 55 383 383 GLY GLY A . n A 1 56 PRO 56 384 384 PRO PRO A . n A 1 57 ALA 57 385 385 ALA ALA A . n A 1 58 THR 58 386 386 THR THR A . n A 1 59 ASP 59 387 387 ASP ASP A . n A 1 60 PRO 60 388 388 PRO PRO A . n A 1 61 VAL 61 389 389 VAL VAL A . n A 1 62 GLU 62 390 390 GLU GLU A . n A 1 63 MET 63 391 391 MET MET A . n A 1 64 ALA 64 392 392 ALA ALA A . n A 1 65 LEU 65 393 393 LEU LEU A . n A 1 66 PHE 66 394 394 PHE PHE A . n A 1 67 GLN 67 395 395 GLN GLN A . n A 1 68 PRO 68 396 396 PRO PRO A . n A 1 69 ALA 69 397 397 ALA ALA A . n A 1 70 GLY 70 398 398 GLY GLY A . n A 1 71 LYS 71 399 399 LYS LYS A . n A 1 72 GLN 72 400 400 GLN GLN A . n A 1 73 TYR 73 401 401 TYR TYR A . n A 1 74 ILE 74 402 402 ILE ILE A . n A 1 75 HIS 75 403 403 HIS HIS A . n A 1 76 CYS 76 404 404 CYS CYS A . n A 1 77 PHE 77 405 405 PHE PHE A . n A 1 78 ARG 78 406 406 ARG ARG A . n A 1 79 LYS 79 407 ? ? ? A . n A 1 80 PRO 80 408 ? ? ? A . n A 1 81 HIS 81 409 ? ? ? A . n A 1 82 ASP 82 410 ? ? ? A . n A 1 83 GLU 83 411 ? ? ? A . n A 1 84 LYS 84 412 ? ? ? A . n A 1 85 GLY 85 413 ? ? ? A . n A 1 86 PHE 86 414 ? ? ? A . n A 1 87 LYS 87 415 ? ? ? A . n A 1 88 ASN 88 416 ? ? ? A . n A 1 89 GLY 89 417 ? ? ? A . n A 1 90 SER 90 418 ? ? ? A . n A 1 91 ARG 91 419 ? ? ? A . n A 1 92 HIS 92 420 ? ? ? A . n A 1 93 SER 93 421 ? ? ? A . n A 1 94 HIS 94 422 ? ? ? A . n A 1 95 GLY 95 423 ? ? ? A . n A 1 96 ILE 96 424 ? ? ? A . n A 1 97 LEU 97 425 ? ? ? A . n A 1 98 MET 98 426 ? ? ? A . n A 1 99 LYS 99 427 ? ? ? A . n A 1 100 ASP 100 428 ? ? ? A . n A 1 101 ILE 101 429 ? ? ? A . n A 1 102 GLU 102 430 ? ? ? A . n A 1 103 ASP 103 431 ? ? ? A . n A 1 104 ALA 104 432 432 ALA ALA A . n A 1 105 MET 105 433 433 MET MET A . n A 1 106 PRO 106 434 434 PRO PRO A . n A 1 107 GLY 107 435 435 GLY GLY A . n A 1 108 VAL 108 436 436 VAL VAL A . n A 1 109 LEU 109 437 437 LEU LEU A . n A 1 110 SER 110 438 438 SER SER A . n A 1 111 TYR 111 439 439 TYR TYR A . n A 1 112 VAL 112 440 440 VAL VAL A . n A 1 113 ILE 113 441 441 ILE ILE A . n A 1 114 GLY 114 442 442 GLY GLY A . n A 1 115 LEU 115 443 443 LEU LEU A . n A 1 116 LEU 116 444 444 LEU LEU A . n A 1 117 PRO 117 445 445 PRO PRO A . n A 1 118 PRO 118 446 446 PRO PRO A . n A 1 119 ASP 119 447 447 ASP ASP A . n A 1 120 MET 120 448 448 MET MET A . n A 1 121 VAL 121 449 449 VAL VAL A . n A 1 122 VAL 122 450 450 VAL VAL A . n A 1 123 THR 123 451 451 THR THR A . n A 1 124 THR 124 452 452 THR THR A . n A 1 125 GLN 125 453 453 GLN GLN A . n A 1 126 GLY 126 454 454 GLY GLY A . n A 1 127 SER 127 455 455 SER SER A . n A 1 128 ASP 128 456 456 ASP ASP A . n A 1 129 ASP 129 457 457 ASP ASP A . n A 1 130 ILE 130 458 458 ILE ILE A . n A 1 131 ARG 131 459 459 ARG ARG A . n A 1 132 LYS 132 460 460 LYS LYS A . n A 1 133 LEU 133 461 461 LEU LEU A . n A 1 134 PHE 134 462 462 PHE PHE A . n A 1 135 ASP 135 463 463 ASP ASP A . n A 1 136 LEU 136 464 464 LEU LEU A . n A 1 137 HIS 137 465 465 HIS HIS A . n A 1 138 GLY 138 466 466 GLY GLY A . n A 1 139 ARG 139 467 467 ARG ARG A . n A 1 140 ARG 140 468 468 ARG ARG A . n A 1 141 ASP 141 469 469 ASP ASP A . n A 1 142 LEU 142 470 470 LEU LEU A . n A 1 143 LYS 143 471 471 LYS LYS A . n A 1 144 LEU 144 472 472 LEU LEU A . n A 1 145 VAL 145 473 473 VAL VAL A . n A 1 146 ASP 146 474 474 ASP ASP A . n A 1 147 VAL 147 475 475 VAL VAL A . n A 1 148 ARG 148 476 476 ARG ARG A . n A 1 149 LEU 149 477 477 LEU LEU A . n A 1 150 THR 150 478 478 THR THR A . n A 1 151 SER 151 479 479 SER SER A . n A 1 152 GLU 152 480 480 GLU GLU A . n A 1 153 GLN 153 481 481 GLN GLN A . n A 1 154 ALA 154 482 482 ALA ALA A . n A 1 155 ARG 155 483 483 ARG ARG A . n A 1 156 GLN 156 484 484 GLN GLN A . n A 1 157 PHE 157 485 485 PHE PHE A . n A 1 158 ASP 158 486 486 ASP ASP A . n A 1 159 GLN 159 487 487 GLN GLN A . n A 1 160 GLN 160 488 488 GLN GLN A . n A 1 161 VAL 161 489 489 VAL VAL A . n A 1 162 TRP 162 490 490 TRP TRP A . n A 1 163 GLU 163 491 491 GLU GLU A . n A 1 164 LYS 164 492 492 LYS LYS A . n A 1 165 TYR 165 493 493 TYR TYR A . n A 1 166 GLY 166 494 494 GLY GLY A . n A 1 167 HIS 167 495 495 HIS HIS A . n A 1 168 LEU 168 496 496 LEU LEU A . n A 1 169 CYS 169 497 497 CYS CYS A . n A 1 170 LYS 170 498 498 LYS LYS A . n A 1 171 TYR 171 499 ? ? ? A . n A 1 172 HIS 172 500 ? ? ? A . n A 1 173 ASN 173 501 ? ? ? A . n A 1 174 GLY 174 502 ? ? ? A . n A 1 175 VAL 175 503 ? ? ? A . n A 1 176 VAL 176 504 ? ? ? A . n A 1 177 VAL 177 505 ? ? ? A . n A 1 178 ASN 178 506 ? ? ? A . n A 1 179 LYS 179 507 ? ? ? A . n A 1 180 LYS 180 508 ? ? ? A . n A 1 181 LYS 181 509 ? ? ? A . n A 1 182 ARG 182 510 ? ? ? A . n A 1 183 ASP 183 511 ? ? ? A . n A 1 184 LYS 184 512 ? ? ? A . n A 1 185 ASP 185 513 ? ? ? A . n A 1 186 THR 186 514 ? ? ? A . n A 1 187 PRO 187 515 ? ? ? A . n A 1 188 PHE 188 516 ? ? ? A . n A 1 189 LYS 189 517 ? ? ? A . n A 1 190 LEU 190 518 ? ? ? A . n A 1 191 ALA 191 519 ? ? ? A . n A 1 192 SER 192 520 ? ? ? A . n A 1 193 SER 193 521 ? ? ? A . n A 1 194 GLU 194 522 522 GLU GLU A . n A 1 195 PRO 195 523 523 PRO PRO A . n A 1 196 HIS 196 524 524 HIS HIS A . n A 1 197 CYS 197 525 525 CYS CYS A . n A 1 198 ALA 198 526 526 ALA ALA A . n A 1 199 LEU 199 527 527 LEU LEU A . n A 1 200 LEU 200 528 528 LEU LEU A . n A 1 201 ASP 201 529 529 ASP ASP A . n A 1 202 CYS 202 530 530 CYS CYS A . n A 1 203 ILE 203 531 531 ILE ILE A . n A 1 204 MET 204 532 532 MET MET A . n A 1 205 PHE 205 533 533 PHE PHE A . n A 1 206 GLN 206 534 534 GLN GLN A . n A 1 207 SER 207 535 535 SER SER A . n A 1 208 VAL 208 536 536 VAL VAL A . n A 1 209 LEU 209 537 537 LEU LEU A . n A 1 210 ASP 210 538 538 ASP ASP A . n A 1 211 GLY 211 539 539 GLY GLY A . n A 1 212 LYS 212 540 540 LYS LYS A . n A 1 213 LEU 213 541 541 LEU LEU A . n A 1 214 TYR 214 542 542 TYR TYR A . n A 1 215 GLU 215 543 543 GLU GLU A . n A 1 216 GLU 216 544 544 GLU GLU A . n A 1 217 GLU 217 545 545 GLU GLU A . n A 1 218 LEU 218 546 546 LEU LEU A . n A 1 219 THR 219 547 547 THR THR A . n A 1 220 PRO 220 548 548 PRO PRO A . n A 1 221 LEU 221 549 549 LEU LEU A . n A 1 222 LEU 222 550 550 LEU LEU A . n A 1 223 PRO 223 551 551 PRO PRO A . n A 1 224 SER 224 552 552 SER SER A . n A 1 225 SER 225 553 553 SER SER A . n A 1 226 LEU 226 554 ? ? ? A . n A 1 227 LEU 227 555 ? ? ? A . n A 1 228 PHE 228 556 ? ? ? A . n A 1 229 LEU 229 557 ? ? ? A . n A 1 230 PRO 230 558 ? ? ? A . n A 1 231 LYS 231 559 ? ? ? A . n A 1 232 ALA 232 560 ? ? ? A . n A 1 233 ALA 233 561 ? ? ? A . n A 1 234 TYR 234 562 ? ? ? A . n A 1 235 ALA 235 563 ? ? ? A . n A 1 236 LEU 236 564 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1470 ? 2 MORE -3 ? 2 'SSA (A^2)' 14930 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 -x+1/2,y,-z -1.0000000000 0.0000000000 0.0000000000 20.2075000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-07 2 'Structure model' 1 1 2013-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal StructureStudio 'data collection' . ? 1 MOLREP phasing . ? 2 PHENIX refinement '(phenix.refine: 1.7_650)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 476 ? ? -99.49 56.10 2 1 GLU A 543 ? ? -142.35 38.73 3 1 SER A 552 ? ? -21.55 108.79 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 329 ? A LEU 1 2 1 Y 1 A GLU 330 ? A GLU 2 3 1 Y 1 A VAL 331 ? A VAL 3 4 1 Y 1 A LEU 332 ? A LEU 4 5 1 Y 1 A PHE 333 ? A PHE 5 6 1 Y 1 A GLN 334 ? A GLN 6 7 1 Y 1 A GLY 335 ? A GLY 7 8 1 Y 1 A PRO 336 ? A PRO 8 9 1 Y 1 A LEU 337 ? A LEU 9 10 1 Y 1 A GLY 338 ? A GLY 10 11 1 Y 1 A SER 339 ? A SER 11 12 1 Y 1 A MET 340 ? A MET 12 13 1 Y 1 A PRO 341 ? A PRO 13 14 1 Y 1 A ARG 342 ? A ARG 14 15 1 Y 1 A GLN 343 ? A GLN 15 16 1 Y 1 A PRO 344 ? A PRO 16 17 1 Y 1 A GLU 345 ? A GLU 17 18 1 Y 1 A LYS 346 ? A LYS 18 19 1 Y 1 A ASN 347 ? A ASN 19 20 1 Y 1 A GLY 348 ? A GLY 20 21 1 Y 1 A GLN 349 ? A GLN 21 22 1 Y 1 A ASN 350 ? A ASN 22 23 1 Y 1 A LEU 351 ? A LEU 23 24 1 Y 1 A ARG 352 ? A ARG 24 25 1 Y 1 A LEU 353 ? A LEU 25 26 1 Y 1 A ALA 354 ? A ALA 26 27 1 Y 1 A LYS 407 ? A LYS 79 28 1 Y 1 A PRO 408 ? A PRO 80 29 1 Y 1 A HIS 409 ? A HIS 81 30 1 Y 1 A ASP 410 ? A ASP 82 31 1 Y 1 A GLU 411 ? A GLU 83 32 1 Y 1 A LYS 412 ? A LYS 84 33 1 Y 1 A GLY 413 ? A GLY 85 34 1 Y 1 A PHE 414 ? A PHE 86 35 1 Y 1 A LYS 415 ? A LYS 87 36 1 Y 1 A ASN 416 ? A ASN 88 37 1 Y 1 A GLY 417 ? A GLY 89 38 1 Y 1 A SER 418 ? A SER 90 39 1 Y 1 A ARG 419 ? A ARG 91 40 1 Y 1 A HIS 420 ? A HIS 92 41 1 Y 1 A SER 421 ? A SER 93 42 1 Y 1 A HIS 422 ? A HIS 94 43 1 Y 1 A GLY 423 ? A GLY 95 44 1 Y 1 A ILE 424 ? A ILE 96 45 1 Y 1 A LEU 425 ? A LEU 97 46 1 Y 1 A MET 426 ? A MET 98 47 1 Y 1 A LYS 427 ? A LYS 99 48 1 Y 1 A ASP 428 ? A ASP 100 49 1 Y 1 A ILE 429 ? A ILE 101 50 1 Y 1 A GLU 430 ? A GLU 102 51 1 Y 1 A ASP 431 ? A ASP 103 52 1 Y 1 A TYR 499 ? A TYR 171 53 1 Y 1 A HIS 500 ? A HIS 172 54 1 Y 1 A ASN 501 ? A ASN 173 55 1 Y 1 A GLY 502 ? A GLY 174 56 1 Y 1 A VAL 503 ? A VAL 175 57 1 Y 1 A VAL 504 ? A VAL 176 58 1 Y 1 A VAL 505 ? A VAL 177 59 1 Y 1 A ASN 506 ? A ASN 178 60 1 Y 1 A LYS 507 ? A LYS 179 61 1 Y 1 A LYS 508 ? A LYS 180 62 1 Y 1 A LYS 509 ? A LYS 181 63 1 Y 1 A ARG 510 ? A ARG 182 64 1 Y 1 A ASP 511 ? A ASP 183 65 1 Y 1 A LYS 512 ? A LYS 184 66 1 Y 1 A ASP 513 ? A ASP 185 67 1 Y 1 A THR 514 ? A THR 186 68 1 Y 1 A PRO 515 ? A PRO 187 69 1 Y 1 A PHE 516 ? A PHE 188 70 1 Y 1 A LYS 517 ? A LYS 189 71 1 Y 1 A LEU 518 ? A LEU 190 72 1 Y 1 A ALA 519 ? A ALA 191 73 1 Y 1 A SER 520 ? A SER 192 74 1 Y 1 A SER 521 ? A SER 193 75 1 Y 1 A LEU 554 ? A LEU 226 76 1 Y 1 A LEU 555 ? A LEU 227 77 1 Y 1 A PHE 556 ? A PHE 228 78 1 Y 1 A LEU 557 ? A LEU 229 79 1 Y 1 A PRO 558 ? A PRO 230 80 1 Y 1 A LYS 559 ? A LYS 231 81 1 Y 1 A ALA 560 ? A ALA 232 82 1 Y 1 A ALA 561 ? A ALA 233 83 1 Y 1 A TYR 562 ? A TYR 234 84 1 Y 1 A ALA 563 ? A ALA 235 85 1 Y 1 A LEU 564 ? A LEU 236 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 601 1 HOH HOH A . B 2 HOH 2 602 2 HOH HOH A . B 2 HOH 3 603 3 HOH HOH A . B 2 HOH 4 604 4 HOH HOH A . B 2 HOH 5 605 5 HOH HOH A . B 2 HOH 6 606 6 HOH HOH A . B 2 HOH 7 607 7 HOH HOH A . B 2 HOH 8 608 8 HOH HOH A . B 2 HOH 9 609 9 HOH HOH A . B 2 HOH 10 610 10 HOH HOH A . B 2 HOH 11 611 11 HOH HOH A . B 2 HOH 12 612 12 HOH HOH A . B 2 HOH 13 613 13 HOH HOH A . B 2 HOH 14 614 14 HOH HOH A . B 2 HOH 15 615 15 HOH HOH A . B 2 HOH 16 616 16 HOH HOH A . B 2 HOH 17 617 17 HOH HOH A . B 2 HOH 18 618 18 HOH HOH A . B 2 HOH 19 619 19 HOH HOH A . B 2 HOH 20 620 20 HOH HOH A . B 2 HOH 21 621 21 HOH HOH A . B 2 HOH 22 622 22 HOH HOH A . B 2 HOH 23 623 23 HOH HOH A . B 2 HOH 24 624 24 HOH HOH A . B 2 HOH 25 625 25 HOH HOH A . B 2 HOH 26 626 26 HOH HOH A . B 2 HOH 27 627 27 HOH HOH A . B 2 HOH 28 628 28 HOH HOH A . B 2 HOH 29 629 29 HOH HOH A . B 2 HOH 30 630 30 HOH HOH A . B 2 HOH 31 631 31 HOH HOH A . B 2 HOH 32 632 32 HOH HOH A . B 2 HOH 33 633 33 HOH HOH A . B 2 HOH 34 634 34 HOH HOH A . B 2 HOH 35 635 35 HOH HOH A . B 2 HOH 36 636 36 HOH HOH A . B 2 HOH 37 637 37 HOH HOH A . B 2 HOH 38 638 38 HOH HOH A . B 2 HOH 39 639 39 HOH HOH A . B 2 HOH 40 640 40 HOH HOH A . B 2 HOH 41 641 41 HOH HOH A . B 2 HOH 42 642 42 HOH HOH A . B 2 HOH 43 643 43 HOH HOH A . B 2 HOH 44 644 44 HOH HOH A . B 2 HOH 45 645 45 HOH HOH A . B 2 HOH 46 646 46 HOH HOH A . B 2 HOH 47 647 47 HOH HOH A . B 2 HOH 48 648 48 HOH HOH A . B 2 HOH 49 649 49 HOH HOH A . B 2 HOH 50 650 50 HOH HOH A . B 2 HOH 51 651 51 HOH HOH A . B 2 HOH 52 652 52 HOH HOH A . B 2 HOH 53 653 53 HOH HOH A . B 2 HOH 54 654 54 HOH HOH A . B 2 HOH 55 655 55 HOH HOH A . B 2 HOH 56 656 56 HOH HOH A . B 2 HOH 57 657 57 HOH HOH A . B 2 HOH 58 658 58 HOH HOH A . B 2 HOH 59 659 59 HOH HOH A . B 2 HOH 60 660 60 HOH HOH A . B 2 HOH 61 661 61 HOH HOH A . B 2 HOH 62 662 62 HOH HOH A . B 2 HOH 63 663 63 HOH HOH A . B 2 HOH 64 664 64 HOH HOH A . B 2 HOH 65 665 65 HOH HOH A . B 2 HOH 66 666 66 HOH HOH A . B 2 HOH 67 667 67 HOH HOH A . B 2 HOH 68 668 68 HOH HOH A . B 2 HOH 69 669 69 HOH HOH A . B 2 HOH 70 670 70 HOH HOH A . B 2 HOH 71 671 71 HOH HOH A . B 2 HOH 72 672 72 HOH HOH A . B 2 HOH 73 673 73 HOH HOH A . B 2 HOH 74 674 74 HOH HOH A . B 2 HOH 75 675 75 HOH HOH A . B 2 HOH 76 676 76 HOH HOH A . B 2 HOH 77 677 77 HOH HOH A . B 2 HOH 78 678 78 HOH HOH A . #