data_4KXJ # _entry.id 4KXJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4KXJ RCSB RCSB079919 WWPDB D_1000079919 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4KXJ _pdbx_database_status.recvd_initial_deposition_date 2013-05-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lin, S.Y.' 1 'Hou, M.H.' 2 # _citation.id primary _citation.title 'Structural basis for the identification of the N-terminal domain of coronavirus nucleocapsid protein as an antiviral target' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 57 _citation.page_first 2247 _citation.page_last 2257 _citation.year 2014 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24564608 _citation.pdbx_database_id_DOI 10.1021/jm500089r # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lin, S.Y.' 1 primary 'Liu, C.L.' 2 primary 'Chang, Y.M.' 3 primary 'Zhao, J.' 4 primary 'Perlman, S.' 5 primary 'Hou, M.H.' 6 # _cell.entry_id 4KXJ _cell.length_a 81.684 _cell.length_b 81.684 _cell.length_c 42.950 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4KXJ _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Nucleoprotein 15437.901 1 ? ? 'UNP residues 55-188' ? 2 non-polymer syn 'N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE' 295.336 1 ? ? ? ? 3 water nat water 18.015 49 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EFNVVPYYSWFSGITQFQKGKEFEFVEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAK DQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGS ; _entity_poly.pdbx_seq_one_letter_code_can ;EFNVVPYYSWFSGITQFQKGKEFEFVEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAK DQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PHE n 1 3 ASN n 1 4 VAL n 1 5 VAL n 1 6 PRO n 1 7 TYR n 1 8 TYR n 1 9 SER n 1 10 TRP n 1 11 PHE n 1 12 SER n 1 13 GLY n 1 14 ILE n 1 15 THR n 1 16 GLN n 1 17 PHE n 1 18 GLN n 1 19 LYS n 1 20 GLY n 1 21 LYS n 1 22 GLU n 1 23 PHE n 1 24 GLU n 1 25 PHE n 1 26 VAL n 1 27 GLU n 1 28 GLY n 1 29 GLN n 1 30 GLY n 1 31 VAL n 1 32 PRO n 1 33 ILE n 1 34 ALA n 1 35 PRO n 1 36 GLY n 1 37 VAL n 1 38 PRO n 1 39 ALA n 1 40 THR n 1 41 GLU n 1 42 ALA n 1 43 LYS n 1 44 GLY n 1 45 TYR n 1 46 TRP n 1 47 TYR n 1 48 ARG n 1 49 HIS n 1 50 ASN n 1 51 ARG n 1 52 ARG n 1 53 SER n 1 54 PHE n 1 55 LYS n 1 56 THR n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 GLN n 1 62 ARG n 1 63 GLN n 1 64 LEU n 1 65 LEU n 1 66 PRO n 1 67 ARG n 1 68 TRP n 1 69 TYR n 1 70 PHE n 1 71 TYR n 1 72 TYR n 1 73 LEU n 1 74 GLY n 1 75 THR n 1 76 GLY n 1 77 PRO n 1 78 HIS n 1 79 ALA n 1 80 LYS n 1 81 ASP n 1 82 GLN n 1 83 TYR n 1 84 GLY n 1 85 THR n 1 86 ASP n 1 87 ILE n 1 88 ASP n 1 89 GLY n 1 90 VAL n 1 91 TYR n 1 92 TRP n 1 93 VAL n 1 94 ALA n 1 95 SER n 1 96 ASN n 1 97 GLN n 1 98 ALA n 1 99 ASP n 1 100 VAL n 1 101 ASN n 1 102 THR n 1 103 PRO n 1 104 ALA n 1 105 ASP n 1 106 ILE n 1 107 VAL n 1 108 ASP n 1 109 ARG n 1 110 ASP n 1 111 PRO n 1 112 SER n 1 113 SER n 1 114 ASP n 1 115 GLU n 1 116 ALA n 1 117 ILE n 1 118 PRO n 1 119 THR n 1 120 ARG n 1 121 PHE n 1 122 PRO n 1 123 PRO n 1 124 GLY n 1 125 THR n 1 126 VAL n 1 127 LEU n 1 128 PRO n 1 129 GLN n 1 130 GLY n 1 131 TYR n 1 132 TYR n 1 133 ILE n 1 134 GLU n 1 135 GLY n 1 136 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HCoV-OC43 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene N _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain OC43 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human coronavirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 31631 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6SA23_CVHOC _struct_ref.pdbx_db_accession Q6SA23 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NVVPYYSWFSGITQFQKGKEFEFVEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQ YGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGS ; _struct_ref.pdbx_align_begin 55 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4KXJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 136 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6SA23 _struct_ref_seq.db_align_beg 55 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 188 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 58 _struct_ref_seq.pdbx_auth_seq_align_end 191 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4KXJ GLU A 1 ? UNP Q6SA23 ? ? 'EXPRESSION TAG' 56 1 1 4KXJ PHE A 2 ? UNP Q6SA23 ? ? 'EXPRESSION TAG' 57 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 P34 non-polymer . 'N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE' ? 'C17 H17 N3 O2' 295.336 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4KXJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_percent_sol 54.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '25% PEG1500, 0.25M SPG, 225mM NaCl, 50mM Tris-HCl, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2013-05-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'LN2-Cooled, Fixed-Exit Double Crystal Monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.pdbx_synchrotron_site NSRRC _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1 # _reflns.entry_id 4KXJ _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.65 _reflns.number_obs 33506 _reflns.number_all 33506 _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all 99.7 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4KXJ _refine.ls_number_reflns_obs 4233 _refine.ls_number_reflns_all 4822 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30 _refine.ls_d_res_high 2.65 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.18 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18 _refine.ls_R_factor_R_free 0.22 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 231 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1091 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 1162 _refine_hist.d_res_high 2.65 _refine_hist.d_res_low 30 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id c_angle_deg 2.032 ? ? ? ? 'X-RAY DIFFRACTION' c_bond_d 0.013 ? ? ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 4KXJ _struct.title 'Crystal structure of HCoV-OC43 N-NTD complexed with PJ34' _struct.pdbx_descriptor Nucleoprotein _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4KXJ _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'HCoV-OC43 N-NTD, RNA BINDING PROTEIN, N-protein ligand' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 75 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 79 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 130 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 134 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 90 ? ALA A 94 ? VAL A 145 ALA A 149 A 2 LYS A 43 ? HIS A 49 ? LYS A 98 HIS A 104 A 3 ARG A 67 ? TYR A 72 ? ARG A 122 TYR A 127 A 4 ILE A 14 ? GLN A 16 ? ILE A 69 GLN A 71 A 5 TYR A 131 ? ILE A 133 ? TYR A 186 ILE A 188 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 93 ? O VAL A 148 N GLY A 44 ? N GLY A 99 A 2 3 N TYR A 45 ? N TYR A 100 O TYR A 71 ? O TYR A 126 A 3 4 O TRP A 68 ? O TRP A 123 N ILE A 14 ? N ILE A 69 A 4 5 N THR A 15 ? N THR A 70 O TYR A 132 ? O TYR A 187 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE P34 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 PRO A 6 ? PRO A 61 . ? 1_555 ? 2 AC1 10 TYR A 7 ? TYR A 62 . ? 1_555 ? 3 AC1 10 TYR A 8 ? TYR A 63 . ? 1_555 ? 4 AC1 10 SER A 9 ? SER A 64 . ? 1_555 ? 5 AC1 10 HIS A 49 ? HIS A 104 . ? 1_555 ? 6 AC1 10 ASN A 50 ? ASN A 105 . ? 1_555 ? 7 AC1 10 TYR A 69 ? TYR A 124 . ? 1_555 ? 8 AC1 10 TYR A 71 ? TYR A 126 . ? 1_555 ? 9 AC1 10 HOH C . ? HOH A 312 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 331 . ? 1_555 ? # _database_PDB_matrix.entry_id 4KXJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4KXJ _atom_sites.fract_transf_matrix[1][1] 0.012242 _atom_sites.fract_transf_matrix[1][2] 0.007068 _atom_sites.fract_transf_matrix[1][3] -0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014136 _atom_sites.fract_transf_matrix[2][3] -0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023283 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 56 56 GLU GLU A . n A 1 2 PHE 2 57 57 PHE PHE A . n A 1 3 ASN 3 58 58 ASN ASN A . n A 1 4 VAL 4 59 59 VAL VAL A . n A 1 5 VAL 5 60 60 VAL VAL A . n A 1 6 PRO 6 61 61 PRO PRO A . n A 1 7 TYR 7 62 62 TYR TYR A . n A 1 8 TYR 8 63 63 TYR TYR A . n A 1 9 SER 9 64 64 SER SER A . n A 1 10 TRP 10 65 65 TRP TRP A . n A 1 11 PHE 11 66 66 PHE PHE A . n A 1 12 SER 12 67 67 SER SER A . n A 1 13 GLY 13 68 68 GLY GLY A . n A 1 14 ILE 14 69 69 ILE ILE A . n A 1 15 THR 15 70 70 THR THR A . n A 1 16 GLN 16 71 71 GLN GLN A . n A 1 17 PHE 17 72 72 PHE PHE A . n A 1 18 GLN 18 73 73 GLN GLN A . n A 1 19 LYS 19 74 74 LYS LYS A . n A 1 20 GLY 20 75 75 GLY GLY A . n A 1 21 LYS 21 76 76 LYS LYS A . n A 1 22 GLU 22 77 77 GLU GLU A . n A 1 23 PHE 23 78 78 PHE PHE A . n A 1 24 GLU 24 79 79 GLU GLU A . n A 1 25 PHE 25 80 80 PHE PHE A . n A 1 26 VAL 26 81 81 VAL VAL A . n A 1 27 GLU 27 82 82 GLU GLU A . n A 1 28 GLY 28 83 83 GLY GLY A . n A 1 29 GLN 29 84 84 GLN GLN A . n A 1 30 GLY 30 85 85 GLY GLY A . n A 1 31 VAL 31 86 86 VAL VAL A . n A 1 32 PRO 32 87 87 PRO PRO A . n A 1 33 ILE 33 88 88 ILE ILE A . n A 1 34 ALA 34 89 89 ALA ALA A . n A 1 35 PRO 35 90 90 PRO PRO A . n A 1 36 GLY 36 91 91 GLY GLY A . n A 1 37 VAL 37 92 92 VAL VAL A . n A 1 38 PRO 38 93 93 PRO PRO A . n A 1 39 ALA 39 94 94 ALA ALA A . n A 1 40 THR 40 95 95 THR THR A . n A 1 41 GLU 41 96 96 GLU GLU A . n A 1 42 ALA 42 97 97 ALA ALA A . n A 1 43 LYS 43 98 98 LYS LYS A . n A 1 44 GLY 44 99 99 GLY GLY A . n A 1 45 TYR 45 100 100 TYR TYR A . n A 1 46 TRP 46 101 101 TRP TRP A . n A 1 47 TYR 47 102 102 TYR TYR A . n A 1 48 ARG 48 103 103 ARG ARG A . n A 1 49 HIS 49 104 104 HIS HIS A . n A 1 50 ASN 50 105 105 ASN ASN A . n A 1 51 ARG 51 106 106 ARG ARG A . n A 1 52 ARG 52 107 107 ARG ARG A . n A 1 53 SER 53 108 108 SER SER A . n A 1 54 PHE 54 109 109 PHE PHE A . n A 1 55 LYS 55 110 110 LYS LYS A . n A 1 56 THR 56 111 111 THR THR A . n A 1 57 ALA 57 112 112 ALA ALA A . n A 1 58 ASP 58 113 113 ASP ASP A . n A 1 59 GLY 59 114 114 GLY GLY A . n A 1 60 ASN 60 115 ? ? ? A . n A 1 61 GLN 61 116 116 GLN GLN A . n A 1 62 ARG 62 117 117 ARG ARG A . n A 1 63 GLN 63 118 118 GLN GLN A . n A 1 64 LEU 64 119 119 LEU LEU A . n A 1 65 LEU 65 120 120 LEU LEU A . n A 1 66 PRO 66 121 121 PRO PRO A . n A 1 67 ARG 67 122 122 ARG ARG A . n A 1 68 TRP 68 123 123 TRP TRP A . n A 1 69 TYR 69 124 124 TYR TYR A . n A 1 70 PHE 70 125 125 PHE PHE A . n A 1 71 TYR 71 126 126 TYR TYR A . n A 1 72 TYR 72 127 127 TYR TYR A . n A 1 73 LEU 73 128 128 LEU LEU A . n A 1 74 GLY 74 129 129 GLY GLY A . n A 1 75 THR 75 130 130 THR THR A . n A 1 76 GLY 76 131 131 GLY GLY A . n A 1 77 PRO 77 132 132 PRO PRO A . n A 1 78 HIS 78 133 133 HIS HIS A . n A 1 79 ALA 79 134 134 ALA ALA A . n A 1 80 LYS 80 135 135 LYS LYS A . n A 1 81 ASP 81 136 136 ASP ASP A . n A 1 82 GLN 82 137 137 GLN GLN A . n A 1 83 TYR 83 138 138 TYR TYR A . n A 1 84 GLY 84 139 139 GLY GLY A . n A 1 85 THR 85 140 140 THR THR A . n A 1 86 ASP 86 141 141 ASP ASP A . n A 1 87 ILE 87 142 142 ILE ILE A . n A 1 88 ASP 88 143 143 ASP ASP A . n A 1 89 GLY 89 144 144 GLY GLY A . n A 1 90 VAL 90 145 145 VAL VAL A . n A 1 91 TYR 91 146 146 TYR TYR A . n A 1 92 TRP 92 147 147 TRP TRP A . n A 1 93 VAL 93 148 148 VAL VAL A . n A 1 94 ALA 94 149 149 ALA ALA A . n A 1 95 SER 95 150 150 SER SER A . n A 1 96 ASN 96 151 151 ASN ASN A . n A 1 97 GLN 97 152 152 GLN GLN A . n A 1 98 ALA 98 153 153 ALA ALA A . n A 1 99 ASP 99 154 154 ASP ASP A . n A 1 100 VAL 100 155 155 VAL VAL A . n A 1 101 ASN 101 156 156 ASN ASN A . n A 1 102 THR 102 157 157 THR THR A . n A 1 103 PRO 103 158 158 PRO PRO A . n A 1 104 ALA 104 159 159 ALA ALA A . n A 1 105 ASP 105 160 160 ASP ASP A . n A 1 106 ILE 106 161 161 ILE ILE A . n A 1 107 VAL 107 162 162 VAL VAL A . n A 1 108 ASP 108 163 163 ASP ASP A . n A 1 109 ARG 109 164 164 ARG ARG A . n A 1 110 ASP 110 165 165 ASP ASP A . n A 1 111 PRO 111 166 166 PRO PRO A . n A 1 112 SER 112 167 167 SER SER A . n A 1 113 SER 113 168 168 SER SER A . n A 1 114 ASP 114 169 169 ASP ASP A . n A 1 115 GLU 115 170 170 GLU GLU A . n A 1 116 ALA 116 171 171 ALA ALA A . n A 1 117 ILE 117 172 172 ILE ILE A . n A 1 118 PRO 118 173 173 PRO PRO A . n A 1 119 THR 119 174 174 THR THR A . n A 1 120 ARG 120 175 175 ARG ARG A . n A 1 121 PHE 121 176 176 PHE PHE A . n A 1 122 PRO 122 177 177 PRO PRO A . n A 1 123 PRO 123 178 178 PRO PRO A . n A 1 124 GLY 124 179 179 GLY GLY A . n A 1 125 THR 125 180 180 THR THR A . n A 1 126 VAL 126 181 181 VAL VAL A . n A 1 127 LEU 127 182 182 LEU LEU A . n A 1 128 PRO 128 183 183 PRO PRO A . n A 1 129 GLN 129 184 184 GLN GLN A . n A 1 130 GLY 130 185 185 GLY GLY A . n A 1 131 TYR 131 186 186 TYR TYR A . n A 1 132 TYR 132 187 187 TYR TYR A . n A 1 133 ILE 133 188 188 ILE ILE A . n A 1 134 GLU 134 189 189 GLU GLU A . n A 1 135 GLY 135 190 190 GLY GLY A . n A 1 136 SER 136 191 191 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 P34 1 201 1 P34 DRG A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 13 HOH HOH A . C 3 HOH 14 314 14 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 16 HOH HOH A . C 3 HOH 17 317 17 HOH HOH A . C 3 HOH 18 318 18 HOH HOH A . C 3 HOH 19 319 19 HOH HOH A . C 3 HOH 20 320 20 HOH HOH A . C 3 HOH 21 321 21 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 23 HOH HOH A . C 3 HOH 24 324 24 HOH HOH A . C 3 HOH 25 325 25 HOH HOH A . C 3 HOH 26 326 26 HOH HOH A . C 3 HOH 27 327 27 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 29 HOH HOH A . C 3 HOH 30 330 30 HOH HOH A . C 3 HOH 31 331 31 HOH HOH A . C 3 HOH 32 332 32 HOH HOH A . C 3 HOH 33 333 33 HOH HOH A . C 3 HOH 34 334 34 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 36 HOH HOH A . C 3 HOH 37 337 37 HOH HOH A . C 3 HOH 38 338 41 HOH HOH A . C 3 HOH 39 339 42 HOH HOH A . C 3 HOH 40 340 45 HOH HOH A . C 3 HOH 41 341 46 HOH HOH A . C 3 HOH 42 342 47 HOH HOH A . C 3 HOH 43 343 48 HOH HOH A . C 3 HOH 44 344 49 HOH HOH A . C 3 HOH 45 345 51 HOH HOH A . C 3 HOH 46 346 52 HOH HOH A . C 3 HOH 47 347 53 HOH HOH A . C 3 HOH 48 348 54 HOH HOH A . C 3 HOH 49 349 55 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-05-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHENIX 'model building' . ? 2 CNS refinement . ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 PHENIX phasing . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 143 ? ? O A HOH 311 ? ? 2.02 2 1 NH2 A ARG 107 ? ? O A HOH 309 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 107 ? ? 48.40 138.66 2 1 SER A 108 ? ? -110.70 -161.56 3 1 ARG A 117 ? ? -124.93 -163.28 4 1 GLN A 118 ? ? 60.93 125.61 5 1 LEU A 119 ? ? -160.95 83.60 6 1 ASP A 163 ? ? -61.06 -176.51 7 1 PRO A 166 ? ? -59.34 11.05 8 1 ASP A 169 ? ? -170.96 134.74 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ASN _pdbx_unobs_or_zero_occ_residues.auth_seq_id 115 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ASN _pdbx_unobs_or_zero_occ_residues.label_seq_id 60 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE' P34 3 water HOH #