data_4L5E # _entry.id 4L5E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4L5E RCSB RCSB080202 WWPDB D_1000080202 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4L4U . unspecified PDB 2M8G . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4L5E _pdbx_database_status.recvd_initial_deposition_date 2013-06-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Young, A.' 1 'Maris, A.E.' 2 'Vidangos, N.K.' 3 'Hong, E.' 4 'Pelton, J.G.' 5 'Batchelor, J.D.' 6 'Wemmer, D.E.' 7 # _citation.id primary _citation.title 'Structure, function, and tethering of DNA-binding domains in sigma (54) transcriptional activators.' _citation.journal_abbrev Biopolymers _citation.journal_volume 99 _citation.page_first 1082 _citation.page_last 1096 _citation.year 2013 _citation.journal_id_ASTM BIPMAA _citation.country US _citation.journal_id_ISSN 0006-3525 _citation.journal_id_CSD 0161 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23818155 _citation.pdbx_database_id_DOI 10.1002/bip.22333 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vidangos, N.' 1 primary 'Maris, A.E.' 2 primary 'Young, A.' 3 primary 'Hong, E.' 4 primary 'Pelton, J.G.' 5 primary 'Batchelor, J.D.' 6 primary 'Wemmer, D.E.' 7 # _cell.entry_id 4L5E _cell.length_a 33.378 _cell.length_b 62.268 _cell.length_c 54.513 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4L5E _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator (NtrC family)' 5465.559 1 ? ? 'unp residues 393-438' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 82 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code HKSIKEIEKEEIIKVLKEVNFNKKLASEILGIPLRTLYKRLKEYGI _entity_poly.pdbx_seq_one_letter_code_can HKSIKEIEKEEIIKVLKEVNFNKKLASEILGIPLRTLYKRLKEYGI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 LYS n 1 3 SER n 1 4 ILE n 1 5 LYS n 1 6 GLU n 1 7 ILE n 1 8 GLU n 1 9 LYS n 1 10 GLU n 1 11 GLU n 1 12 ILE n 1 13 ILE n 1 14 LYS n 1 15 VAL n 1 16 LEU n 1 17 LYS n 1 18 GLU n 1 19 VAL n 1 20 ASN n 1 21 PHE n 1 22 ASN n 1 23 LYS n 1 24 LYS n 1 25 LEU n 1 26 ALA n 1 27 SER n 1 28 GLU n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 ILE n 1 33 PRO n 1 34 LEU n 1 35 ARG n 1 36 THR n 1 37 LEU n 1 38 TYR n 1 39 LYS n 1 40 ARG n 1 41 LEU n 1 42 LYS n 1 43 GLU n 1 44 TYR n 1 45 GLY n 1 46 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ntrC1, aq_1117' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain VF5 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aquifex aeolicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224324 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O67198_AQUAE _struct_ref.pdbx_db_accession O67198 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code HKSIKEIEKEEIIKVLKEVNFNKKLASEILGIPLRTLYRRLKEYGI _struct_ref.pdbx_align_begin 393 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4L5E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O67198 _struct_ref_seq.db_align_beg 393 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 438 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 393 _struct_ref_seq.pdbx_auth_seq_align_end 438 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4L5E _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 39 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O67198 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 431 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 431 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4L5E _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.59 _exptl_crystal.density_percent_sol 52.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 4L5E _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 27 _reflns.d_resolution_high 1.34 _reflns.number_obs 13005 _reflns.number_all 13122 _reflns.percent_possible_obs 99.11 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 4L5E _refine.ls_number_reflns_obs 13005 _refine.ls_number_reflns_all 13122 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27 _refine.ls_d_res_high 1.340 _refine.ls_percent_reflns_obs 99.11 _refine.ls_R_factor_obs 0.1764 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1730 _refine.ls_R_factor_R_free 0.2064 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.03 _refine.ls_number_reflns_R_free 1304 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -0.1167 _refine.aniso_B[2][2] -2.0668 _refine.aniso_B[3][3] 2.1907 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.439 _refine.solvent_model_param_bsol 65.410 _refine.pdbx_solvent_vdw_probe_radii 0.80 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.47 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.23 _refine.pdbx_overall_phase_error 18.10 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 385 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 477 _refine_hist.d_res_high 1.340 _refine_hist.d_res_low 27 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.005 ? ? 424 ? 'X-RAY DIFFRACTION' f_angle_d 0.865 ? ? 568 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 10.831 ? ? 174 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.060 ? ? 64 ? 'X-RAY DIFFRACTION' f_plane_restr 0.003 ? ? 67 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.3400 1.3937 1197 0.4169 93.00 0.4350 . . 143 . . . . 'X-RAY DIFFRACTION' . 1.3937 1.4571 1280 0.2963 100.00 0.3131 . . 143 . . . . 'X-RAY DIFFRACTION' . 1.4571 1.5339 1297 0.1924 100.00 0.2347 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.5339 1.6300 1292 0.1561 100.00 0.2003 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.6300 1.7558 1304 0.1551 100.00 0.1787 . . 155 . . . . 'X-RAY DIFFRACTION' . 1.7558 1.9325 1289 0.1456 100.00 0.1857 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.9325 2.2120 1326 0.1344 100.00 0.1813 . . 145 . . . . 'X-RAY DIFFRACTION' . 2.2120 2.7864 1332 0.1440 100.00 0.1888 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.7864 27.0409 1384 0.1856 99.00 0.2054 . . 148 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4L5E _struct.title 'Crystal structure of A. aeolicus NtrC1 DNA binding domain' _struct.pdbx_descriptor 'Transcriptional regulator (NtrC family)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4L5E _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Helix-turn-helix DNA binding domain, DNA binding, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? VAL A 19 ? SER A 395 VAL A 411 1 ? 17 HELX_P HELX_P2 2 ASN A 22 ? GLY A 31 ? ASN A 414 GLY A 423 1 ? 10 HELX_P HELX_P3 3 PRO A 33 ? GLY A 45 ? PRO A 425 GLY A 437 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 501' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 THR A 36 ? THR A 428 . ? 1_555 ? 2 AC1 7 LYS A 39 ? LYS A 431 . ? 1_555 ? 3 AC1 7 ARG A 40 ? ARG A 432 . ? 1_555 ? 4 AC1 7 HOH D . ? HOH A 614 . ? 1_555 ? 5 AC1 7 HOH D . ? HOH A 644 . ? 1_555 ? 6 AC1 7 HOH D . ? HOH A 676 . ? 3_554 ? 7 AC1 7 HOH D . ? HOH A 676 . ? 1_555 ? 8 AC2 6 LEU A 34 ? LEU A 426 . ? 1_555 ? 9 AC2 6 LEU A 34 ? LEU A 426 . ? 4_555 ? 10 AC2 6 ARG A 35 ? ARG A 427 . ? 4_555 ? 11 AC2 6 ARG A 35 ? ARG A 427 . ? 1_555 ? 12 AC2 6 HOH D . ? HOH A 669 . ? 1_555 ? 13 AC2 6 HOH D . ? HOH A 669 . ? 4_555 ? # _database_PDB_matrix.entry_id 4L5E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4L5E _atom_sites.fract_transf_matrix[1][1] 0.029960 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016060 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018344 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 393 393 HIS HIS A . n A 1 2 LYS 2 394 394 LYS LYS A . n A 1 3 SER 3 395 395 SER SER A . n A 1 4 ILE 4 396 396 ILE ILE A . n A 1 5 LYS 5 397 397 LYS LYS A . n A 1 6 GLU 6 398 398 GLU GLU A . n A 1 7 ILE 7 399 399 ILE ILE A . n A 1 8 GLU 8 400 400 GLU GLU A . n A 1 9 LYS 9 401 401 LYS LYS A . n A 1 10 GLU 10 402 402 GLU GLU A . n A 1 11 GLU 11 403 403 GLU GLU A . n A 1 12 ILE 12 404 404 ILE ILE A . n A 1 13 ILE 13 405 405 ILE ILE A . n A 1 14 LYS 14 406 406 LYS LYS A . n A 1 15 VAL 15 407 407 VAL VAL A . n A 1 16 LEU 16 408 408 LEU LEU A . n A 1 17 LYS 17 409 409 LYS LYS A . n A 1 18 GLU 18 410 410 GLU GLU A . n A 1 19 VAL 19 411 411 VAL VAL A . n A 1 20 ASN 20 412 412 ASN ASN A . n A 1 21 PHE 21 413 413 PHE PHE A . n A 1 22 ASN 22 414 414 ASN ASN A . n A 1 23 LYS 23 415 415 LYS LYS A . n A 1 24 LYS 24 416 416 LYS LYS A . n A 1 25 LEU 25 417 417 LEU LEU A . n A 1 26 ALA 26 418 418 ALA ALA A . n A 1 27 SER 27 419 419 SER SER A . n A 1 28 GLU 28 420 420 GLU GLU A . n A 1 29 ILE 29 421 421 ILE ILE A . n A 1 30 LEU 30 422 422 LEU LEU A . n A 1 31 GLY 31 423 423 GLY GLY A . n A 1 32 ILE 32 424 424 ILE ILE A . n A 1 33 PRO 33 425 425 PRO PRO A . n A 1 34 LEU 34 426 426 LEU LEU A . n A 1 35 ARG 35 427 427 ARG ARG A . n A 1 36 THR 36 428 428 THR THR A . n A 1 37 LEU 37 429 429 LEU LEU A . n A 1 38 TYR 38 430 430 TYR TYR A . n A 1 39 LYS 39 431 431 LYS LYS A . n A 1 40 ARG 40 432 432 ARG ARG A . n A 1 41 LEU 41 433 433 LEU LEU A . n A 1 42 LYS 42 434 434 LYS LYS A . n A 1 43 GLU 43 435 435 GLU GLU A . n A 1 44 TYR 44 436 436 TYR TYR A . n A 1 45 GLY 45 437 437 GLY GLY A . n A 1 46 ILE 46 438 438 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 501 401 SO4 SO4 A . C 2 SO4 1 502 402 SO4 SO4 A . D 3 HOH 1 601 1 HOH HOH A . D 3 HOH 2 602 2 HOH HOH A . D 3 HOH 3 603 3 HOH HOH A . D 3 HOH 4 604 4 HOH HOH A . D 3 HOH 5 605 5 HOH HOH A . D 3 HOH 6 606 6 HOH HOH A . D 3 HOH 7 607 7 HOH HOH A . D 3 HOH 8 608 8 HOH HOH A . D 3 HOH 9 609 9 HOH HOH A . D 3 HOH 10 610 10 HOH HOH A . D 3 HOH 11 611 11 HOH HOH A . D 3 HOH 12 612 12 HOH HOH A . D 3 HOH 13 613 13 HOH HOH A . D 3 HOH 14 614 14 HOH HOH A . D 3 HOH 15 615 15 HOH HOH A . D 3 HOH 16 616 16 HOH HOH A . D 3 HOH 17 617 17 HOH HOH A . D 3 HOH 18 618 18 HOH HOH A . D 3 HOH 19 619 19 HOH HOH A . D 3 HOH 20 620 20 HOH HOH A . D 3 HOH 21 621 21 HOH HOH A . D 3 HOH 22 622 22 HOH HOH A . D 3 HOH 23 623 23 HOH HOH A . D 3 HOH 24 624 24 HOH HOH A . D 3 HOH 25 625 25 HOH HOH A . D 3 HOH 26 626 26 HOH HOH A . D 3 HOH 27 627 27 HOH HOH A . D 3 HOH 28 628 28 HOH HOH A . D 3 HOH 29 629 29 HOH HOH A . D 3 HOH 30 630 30 HOH HOH A . D 3 HOH 31 631 31 HOH HOH A . D 3 HOH 32 632 32 HOH HOH A . D 3 HOH 33 633 33 HOH HOH A . D 3 HOH 34 634 34 HOH HOH A . D 3 HOH 35 635 35 HOH HOH A . D 3 HOH 36 636 36 HOH HOH A . D 3 HOH 37 637 37 HOH HOH A . D 3 HOH 38 638 38 HOH HOH A . D 3 HOH 39 639 39 HOH HOH A . D 3 HOH 40 640 40 HOH HOH A . D 3 HOH 41 641 41 HOH HOH A . D 3 HOH 42 642 42 HOH HOH A . D 3 HOH 43 643 43 HOH HOH A . D 3 HOH 44 644 44 HOH HOH A . D 3 HOH 45 645 45 HOH HOH A . D 3 HOH 46 646 46 HOH HOH A . D 3 HOH 47 647 47 HOH HOH A . D 3 HOH 48 648 48 HOH HOH A . D 3 HOH 49 649 49 HOH HOH A . D 3 HOH 50 650 50 HOH HOH A . D 3 HOH 51 651 51 HOH HOH A . D 3 HOH 52 652 52 HOH HOH A . D 3 HOH 53 653 53 HOH HOH A . D 3 HOH 54 654 54 HOH HOH A . D 3 HOH 55 655 55 HOH HOH A . D 3 HOH 56 656 56 HOH HOH A . D 3 HOH 57 657 57 HOH HOH A . D 3 HOH 58 658 58 HOH HOH A . D 3 HOH 59 659 59 HOH HOH A . D 3 HOH 60 660 60 HOH HOH A . D 3 HOH 61 661 61 HOH HOH A . D 3 HOH 62 662 62 HOH HOH A . D 3 HOH 63 663 63 HOH HOH A . D 3 HOH 64 664 64 HOH HOH A . D 3 HOH 65 665 65 HOH HOH A . D 3 HOH 66 666 66 HOH HOH A . D 3 HOH 67 667 67 HOH HOH A . D 3 HOH 68 668 68 HOH HOH A . D 3 HOH 69 669 69 HOH HOH A . D 3 HOH 70 670 70 HOH HOH A . D 3 HOH 71 671 71 HOH HOH A . D 3 HOH 72 672 72 HOH HOH A . D 3 HOH 73 673 74 HOH HOH A . D 3 HOH 74 674 75 HOH HOH A . D 3 HOH 75 675 76 HOH HOH A . D 3 HOH 76 676 77 HOH HOH A . D 3 HOH 77 677 78 HOH HOH A . D 3 HOH 78 678 81 HOH HOH A . D 3 HOH 79 679 82 HOH HOH A . D 3 HOH 80 680 83 HOH HOH A . D 3 HOH 81 681 84 HOH HOH A . D 3 HOH 82 682 85 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1320 ? 1 MORE -65 ? 1 'SSA (A^2)' 6570 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 502 ? C SO4 . 2 1 A HOH 676 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-28 2 'Structure model' 1 1 2013-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _software.name PHENIX _software.classification refinement _software.version '(phenix.refine: 1.7.3_928)' _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 409 ? NZ ? A LYS 17 NZ 2 1 Y 0 A LYS 434 ? NZ ? A LYS 42 NZ # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #