data_4LHF # _entry.id 4LHF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4LHF RCSB RCSB080633 WWPDB D_1000080633 # _pdbx_database_status.entry_id 4LHF _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-07-01 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Berntsson, R.P.-A.' 1 'Odegrip, R.' 2 'Sehlen, W.' 3 'Skaar, K.' 4 'Svensson, L.M.' 5 'Massad, T.' 6 'Haggard-Ljungquist, E.' 7 'Stenmark, P.' 8 # _citation.id primary _citation.title 'Structural insight into DNA binding and oligomerization of the multifunctional Cox protein of bacteriophage P2.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 42 _citation.page_first 2725 _citation.page_last 2735 _citation.year 2014 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24259428 _citation.pdbx_database_id_DOI 10.1093/nar/gkt1119 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Berntsson, R.P.' 1 primary 'Odegrip, R.' 2 primary 'Sehlen, W.' 3 primary 'Skaar, K.' 4 primary 'Svensson, L.M.' 5 primary 'Massad, T.' 6 primary 'Hogbom, M.' 7 primary 'Haggard-Ljungquist, E.' 8 primary 'Stenmark, P.' 9 # _cell.length_a 66.254 _cell.length_b 66.254 _cell.length_c 33.802 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4LHF _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 65' _symmetry.entry_id 4LHF _symmetry.Int_Tables_number 170 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Regulatory protein cox' _entity.formula_weight 10313.957 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSKQVTLMTDAIPYQEFAKLIGKSTGAVRRMIDKGKLPVIDMTDPQSASGRAGEYWVYLPAWNNGLKLAYESRPKEIRDG WLMWLGLGEPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKQVTLMTDAIPYQEFAKLIGKSTGAVRRMIDKGKLPVIDMTDPQSASGRAGEYWVYLPAWNNGLKLAYESRPKEIRDG WLMWLGLGEPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 GLN n 1 5 VAL n 1 6 THR n 1 7 LEU n 1 8 MET n 1 9 THR n 1 10 ASP n 1 11 ALA n 1 12 ILE n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 GLU n 1 17 PHE n 1 18 ALA n 1 19 LYS n 1 20 LEU n 1 21 ILE n 1 22 GLY n 1 23 LYS n 1 24 SER n 1 25 THR n 1 26 GLY n 1 27 ALA n 1 28 VAL n 1 29 ARG n 1 30 ARG n 1 31 MET n 1 32 ILE n 1 33 ASP n 1 34 LYS n 1 35 GLY n 1 36 LYS n 1 37 LEU n 1 38 PRO n 1 39 VAL n 1 40 ILE n 1 41 ASP n 1 42 MET n 1 43 THR n 1 44 ASP n 1 45 PRO n 1 46 GLN n 1 47 SER n 1 48 ALA n 1 49 SER n 1 50 GLY n 1 51 ARG n 1 52 ALA n 1 53 GLY n 1 54 GLU n 1 55 TYR n 1 56 TRP n 1 57 VAL n 1 58 TYR n 1 59 LEU n 1 60 PRO n 1 61 ALA n 1 62 TRP n 1 63 ASN n 1 64 ASN n 1 65 GLY n 1 66 LEU n 1 67 LYS n 1 68 LEU n 1 69 ALA n 1 70 TYR n 1 71 GLU n 1 72 SER n 1 73 ARG n 1 74 PRO n 1 75 LYS n 1 76 GLU n 1 77 ILE n 1 78 ARG n 1 79 ASP n 1 80 GLY n 1 81 TRP n 1 82 LEU n 1 83 MET n 1 84 TRP n 1 85 LEU n 1 86 GLY n 1 87 LEU n 1 88 GLY n 1 89 GLU n 1 90 PRO n 1 91 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene cox _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage P2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10679 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VCOX_BPP2 _struct_ref.pdbx_db_accession P07695 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKQVTLMTDAIPYQEFAKLIGKSTGAVRRMIDKGKLPVIDMTDPQSASGRAGEYWVYLPAWNNGLKLAYESRPKEIRDG WLMWLGLGEPR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4LHF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07695 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 2 _exptl.entry_id 4LHF _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 40.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.2 M Na-citrate pH 5.0, 24% PEG 4000, 20% isopropanol, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 100 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD 'MARMOSAIC 225 mm CCD' 2010-03-05 ? 2 PIXEL 'DECTRIS PILATUS 6M' 2012-03-26 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.monochromator _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_scattering_type 1 1 'SINGLE WAVELENGTH' ? M x-ray 2 1 'SINGLE WAVELENGTH' ? M x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.8726 1.0 2 0.9793 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline 1 SYNCHROTRON 'ESRF BEAMLINE ID23-1' ? 0.8726 ESRF ID23-1 2 SYNCHROTRON 'SLS BEAMLINE X06SA' ? 0.9793 SLS X06SA # _reflns.entry_id 4LHF _reflns.d_resolution_high 2.401 _reflns.d_resolution_low 57.378 _reflns.number_all 3108 _reflns.number_obs 3108 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_netI_over_sigmaI 17.300 _reflns.pdbx_Rsym_value 0.077 _reflns.pdbx_redundancy 6.000 _reflns.percent_possible_obs 92.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1,2 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.400 2.530 ? 1447 ? 0.479 1.600 0.479 ? 3.600 ? 403 86.100 1 1,2 2.530 2.680 ? 1748 ? 0.294 2.600 0.294 ? 4.400 ? 401 87.600 2 1,2 2.680 2.870 ? 1609 ? 0.157 4.800 0.157 ? 4.300 ? 377 88.600 3 1,2 2.870 3.100 ? 1909 ? 0.160 4.000 0.160 ? 5.300 ? 361 91.300 4 1,2 3.100 3.390 ? 2851 ? 0.156 4.300 0.156 ? 7.600 ? 376 99.400 5 1,2 3.390 3.790 ? 2567 ? 0.092 7.200 0.092 ? 7.600 ? 336 99.400 6 1,2 3.790 4.380 ? 2319 ? 0.064 10.000 0.064 ? 7.700 ? 302 98.500 7 1,2 4.380 5.370 ? 1962 ? 0.059 11.000 0.059 ? 7.900 ? 248 97.900 8 1,2 5.370 7.590 ? 1499 ? 0.063 9.900 0.063 ? 7.700 ? 194 97.000 9 1,2 7.590 33.847 ? 827 ? 0.042 12.700 0.042 ? 7.500 ? 110 92.700 10 1,2 # _refine.entry_id 4LHF _refine.ls_d_res_high 2.4010 _refine.ls_d_res_low 33.1270 _refine.pdbx_ls_sigma_F 1.400 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 90.7400 _refine.ls_number_reflns_obs 3097 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details random _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2110 _refine.ls_R_factor_R_work 0.2089 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2528 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.2600 _refine.ls_number_reflns_R_free 132 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 90.6137 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.0000 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.6817 _refine.B_iso_max 148.750 _refine.B_iso_min 57.700 _refine.pdbx_overall_phase_error 35.9200 _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1,2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 631 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 631 _refine_hist.d_res_high 2.4010 _refine_hist.d_res_low 33.1270 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 647 0.003 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 875 0.733 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 92 0.051 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 108 0.003 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 240 13.716 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.401 _refine_ls_shell.d_res_low 2.487 _refine_ls_shell.pdbx_total_number_of_bins_used 1 _refine_ls_shell.percent_reflns_obs 91.0000 _refine_ls_shell.number_reflns_R_work 2965 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2089 _refine_ls_shell.R_factor_R_free 0.2528 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 132 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 3097 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4LHF _struct.title 'Crystal structure of a DNA binding protein from phage P2' _struct.pdbx_descriptor 'Regulatory protein cox' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4LHF _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'helix-turn-helix, DNA binding, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ;It is oligomeric, but its exact oligomeric state is dependant on the concentration of the protein, something also reflected in the functionality of the protein ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 14 ? GLY A 22 ? TYR A 14 GLY A 22 1 ? 9 HELX_P HELX_P2 2 SER A 24 ? GLY A 35 ? SER A 24 GLY A 35 1 ? 12 HELX_P HELX_P3 3 LEU A 59 ? ARG A 73 ? LEU A 59 ARG A 73 1 ? 15 HELX_P HELX_P4 4 PRO A 74 ? TRP A 81 ? PRO A 74 TRP A 81 1 ? 8 HELX_P HELX_P5 5 LEU A 82 ? GLY A 86 ? LEU A 82 GLY A 86 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 11 ? PRO A 13 ? ALA A 11 PRO A 13 A 2 GLU A 54 ? TYR A 58 ? GLU A 54 TYR A 58 A 3 VAL A 39 ? MET A 42 ? VAL A 39 MET A 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 12 ? N ILE A 12 O VAL A 57 ? O VAL A 57 A 2 3 O GLU A 54 ? O GLU A 54 N MET A 42 ? N MET A 42 # _atom_sites.entry_id 4LHF _atom_sites.fract_transf_matrix[1][1] 0.015093 _atom_sites.fract_transf_matrix[1][2] 0.008714 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017428 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029584 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLY 50 50 ? ? ? A . n A 1 51 ARG 51 51 ? ? ? A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLY 88 88 ? ? ? A . n A 1 89 GLU 89 89 ? ? ? A . n A 1 90 PRO 90 90 ? ? ? A . n A 1 91 ARG 91 91 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-05 2 'Structure model' 1 1 2014-03-12 3 'Structure model' 1 2 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category audit_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_audit_author.name' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALA 3.2.25 21/9/2006 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 2 PHENIX 1.8_1069 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 3 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 SOLVE . ? ? ? ? phasing ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A GLY 50 ? A GLY 50 8 1 Y 1 A ARG 51 ? A ARG 51 9 1 Y 1 A GLY 88 ? A GLY 88 10 1 Y 1 A GLU 89 ? A GLU 89 11 1 Y 1 A PRO 90 ? A PRO 90 12 1 Y 1 A ARG 91 ? A ARG 91 #