data_4LID # _entry.id 4LID # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4LID RCSB RCSB080667 WWPDB D_1000080667 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4LID _pdbx_database_status.recvd_initial_deposition_date 2013-07-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eilers, B.J.' 1 'Wagner, C.' 2 'Thomas, M.M.' 3 'Lawrence, C.M.' 4 'Young, M.J.' 5 # _citation.id primary _citation.title 'A100, A DNA binding scaffold from Sulfolobus spindle-shape virus 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Eilers, B.J.' 1 primary 'Wagner, C.' 2 primary 'Thomas, M.M.' 3 primary 'Lawrence, C.M.' 4 primary 'Young, M.J.' 5 # _cell.entry_id 4LID _cell.length_a 152.999 _cell.length_b 152.999 _cell.length_c 61.727 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4LID _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description A-100 _entity.formula_weight 12696.460 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVSPQTRKEEELLEKQNSVFYLLTLGRKPYGSYLHIKIELDEDEKLEKEIYADNIKLENELRQLKRLYEVYQSVEIDDAQ KAIQKEALLTIAKILSVFDFHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSPQTRKEEELLEKQNSVFYLLTLGRKPYGSYLHIKIELDEDEKLEKEIYADNIKLENELRQLKRLYEVYQSVEIDDAQ KAIQKEALLTIAKILSVFDFHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 PRO n 1 5 GLN n 1 6 THR n 1 7 ARG n 1 8 LYS n 1 9 GLU n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 LEU n 1 14 GLU n 1 15 LYS n 1 16 GLN n 1 17 ASN n 1 18 SER n 1 19 VAL n 1 20 PHE n 1 21 TYR n 1 22 LEU n 1 23 LEU n 1 24 THR n 1 25 LEU n 1 26 GLY n 1 27 ARG n 1 28 LYS n 1 29 PRO n 1 30 TYR n 1 31 GLY n 1 32 SER n 1 33 TYR n 1 34 LEU n 1 35 HIS n 1 36 ILE n 1 37 LYS n 1 38 ILE n 1 39 GLU n 1 40 LEU n 1 41 ASP n 1 42 GLU n 1 43 ASP n 1 44 GLU n 1 45 LYS n 1 46 LEU n 1 47 GLU n 1 48 LYS n 1 49 GLU n 1 50 ILE n 1 51 TYR n 1 52 ALA n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 LYS n 1 57 LEU n 1 58 GLU n 1 59 ASN n 1 60 GLU n 1 61 LEU n 1 62 ARG n 1 63 GLN n 1 64 LEU n 1 65 LYS n 1 66 ARG n 1 67 LEU n 1 68 TYR n 1 69 GLU n 1 70 VAL n 1 71 TYR n 1 72 GLN n 1 73 SER n 1 74 VAL n 1 75 GLU n 1 76 ILE n 1 77 ASP n 1 78 ASP n 1 79 ALA n 1 80 GLN n 1 81 LYS n 1 82 ALA n 1 83 ILE n 1 84 GLN n 1 85 LYS n 1 86 GLU n 1 87 ALA n 1 88 LEU n 1 89 LEU n 1 90 THR n 1 91 ILE n 1 92 ALA n 1 93 LYS n 1 94 ILE n 1 95 LEU n 1 96 SER n 1 97 VAL n 1 98 PHE n 1 99 ASP n 1 100 PHE n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name SSV1 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene a100 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus spindle-shaped virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 244589 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pDest14 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A100_SSV1 _struct_ref.pdbx_db_accession P20194 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVSPQTRKEEELLEKQNSVFYLLTLGRKPYGSYLHIKIELDEDEKLEKEIYADNIKLENELRQLKRLYEVYQSVEIDDAQ KAIQKEALLTIAKILSVFDF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4LID A 1 ? 100 ? P20194 1 ? 100 ? 1 100 2 1 4LID B 1 ? 100 ? P20194 1 ? 100 ? 1 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4LID HIS A 101 ? UNP P20194 ? ? 'EXPRESSION TAG' 101 1 1 4LID HIS A 102 ? UNP P20194 ? ? 'EXPRESSION TAG' 102 2 1 4LID HIS A 103 ? UNP P20194 ? ? 'EXPRESSION TAG' 103 3 1 4LID HIS A 104 ? UNP P20194 ? ? 'EXPRESSION TAG' 104 4 1 4LID HIS A 105 ? UNP P20194 ? ? 'EXPRESSION TAG' 105 5 1 4LID HIS A 106 ? UNP P20194 ? ? 'EXPRESSION TAG' 106 6 2 4LID HIS B 101 ? UNP P20194 ? ? 'EXPRESSION TAG' 101 7 2 4LID HIS B 102 ? UNP P20194 ? ? 'EXPRESSION TAG' 102 8 2 4LID HIS B 103 ? UNP P20194 ? ? 'EXPRESSION TAG' 103 9 2 4LID HIS B 104 ? UNP P20194 ? ? 'EXPRESSION TAG' 104 10 2 4LID HIS B 105 ? UNP P20194 ? ? 'EXPRESSION TAG' 105 11 2 4LID HIS B 106 ? UNP P20194 ? ? 'EXPRESSION TAG' 106 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4LID _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # loop_ _exptl_crystal.id _exptl_crystal.density_meas _exptl_crystal.density_Matthews _exptl_crystal.density_percent_sol _exptl_crystal.description _exptl_crystal.F_000 _exptl_crystal.preparation 1 ? 4.11 70.05 ? ? ? 2 ? ? ? ? ? ? # loop_ _exptl_crystal_grow.crystal_id _exptl_crystal_grow.method _exptl_crystal_grow.temp _exptl_crystal_grow.temp_details _exptl_crystal_grow.pH _exptl_crystal_grow.pdbx_details _exptl_crystal_grow.pdbx_pH_range 1 'VAPOR DIFFUSION, HANGING DROP' 296 ? 5.6 ;10mg/ml A100, 0.6-0.9M Ammonium dihydrogen phosphate, 20-30% Glycerol, 0.7M MES, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 296K ; ? 2 'VAPOR DIFFUSION, HANGING DROP' 296 ? 5.6 ;10mg/ml selenomethionine incorporated A100,0.6-0.9M Ammonium dihydrogen phosphate, 20-30% Glycerol, 0.7M MES, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 296K ; ? # _diffrn.id 1 _diffrn.ambient_temp 102.5 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2013-04-14 _diffrn_detector.details 'K-B focusing mirrors' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Liquid nitrogen-cooled double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9795 # _reflns.entry_id 4LID _reflns.observed_criterion_sigma_I 1 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 38.25 _reflns.d_resolution_high 3.0 _reflns.number_obs 8953 _reflns.number_all 8956 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.014 _reflns.pdbx_Rsym_value 0.047 _reflns.pdbx_netI_over_sigmaI 7.93 _reflns.B_iso_Wilson_estimate 94.1 _reflns.pdbx_redundancy 12.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.16 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs .688 _reflns_shell.pdbx_Rsym_value 0.200 _reflns_shell.meanI_over_sigI_obs 5.2 _reflns_shell.pdbx_redundancy 12.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1263 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4LID _refine.ls_number_reflns_obs 8488 _refine.ls_number_reflns_all 8957 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 21.00 _refine.ls_d_res_high 3.00 _refine.ls_percent_reflns_obs 99.50 _refine.ls_R_factor_obs 0.23767 _refine.ls_R_factor_all 0.2857 _refine.ls_R_factor_R_work 0.23707 _refine.ls_R_factor_R_free 0.25062 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 423 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.B_iso_mean 122.806 _refine.aniso_B[1][1] 0.25 _refine.aniso_B[2][2] 0.25 _refine.aniso_B[3][3] -0.80 _refine.aniso_B[1][2] 0.25 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model Isotropic _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.525 _refine.pdbx_overall_ESU_R_Free 0.315 _refine.overall_SU_ML 0.243 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 29.633 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1438 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1438 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 21.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.015 0.019 ? 1455 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 1454 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.743 2.000 ? 1953 ? 'X-RAY DIFFRACTION' r_angle_other_deg 2.960 3.000 ? 3358 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.546 5.000 ? 169 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 33.516 26.133 ? 75 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.320 15.000 ? 302 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 9.045 15.000 ? 5 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.083 0.200 ? 225 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.006 0.020 ? 1587 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.005 0.020 ? 302 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.000 _refine_ls_shell.d_res_low 3.076 _refine_ls_shell.number_reflns_R_work 591 _refine_ls_shell.R_factor_R_work 0.312 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.273 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] 1 given ? 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 2 given ? 0.997449 0.024832 0.066928 0.022809 -0.999264 0.030831 0.067645 -0.029226 -0.997281 -1.79538 86.53544 27.88598 # _struct.entry_id 4LID _struct.title 'A100, A DNA binding scaffold from Sulfolobus spindle-shape virus 1' _struct.pdbx_descriptor A-100 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4LID _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text ;VIRAL PROTEIN, Hyperthermophilic viral protein, SSV1, Sulfolobus spindle-shape virus 1, Archaea, A100, DNA binding scaffold, A DNA binding scaffold ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ;The biological assembly is a dodecamer generated from the dimer in the asymmetric unit by the operations: x,y,z ; -y+1,-x+1,-z+1/2 ; -y+1,x-y,z ; x,x-y,-z+1/2 ; -x+y+1,-x+1,z ; and -x+y+1,y,-z+1/2 REMARK 350 REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: DODECAMERIC REMARK 350 SOFTWARE USED: PISA v1.47 [21/3/2013] REMARK 350 TOTAL BURIED SURFACE AREA: 29840 ANGSTROM**2 REMARK 350 SURFACE AREA FOR THE COMPLEX: 49380 ANGSTROM**2 REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -180 KCAL/MOL REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000 REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000 REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000 REMARK 350 BIOMT1 2 0.500000 -0.866025 0.000000 76.49950 REMARK 350 BIOMT2 2 -0.866025 -0.500000 0.000000 132.50102 REMARK 350 BIOMT3 2 0.000000 0.000000 -1.000000 30.86350 REMARK 350 BIOMT1 3 -0.500000 -0.866025 0.000000 152.99900 REMARK 350 BIOMT2 3 0.866025 -0.500000 0.000000 0.00000 REMARK 350 BIOMT3 3 0.000000 0.000000 1.000000 0.00000 REMARK 350 BIOMT1 4 0.500000 0.866025 0.000000 0.00000 REMARK 350 BIOMT2 4 0.866025 -0.500000 0.000000 0.00000 REMARK 350 BIOMT3 4 0.000000 0.000000 -1.000000 30.86350 REMARK 350 BIOMT1 5 -0.500000 0.866025 0.000000 76.49950 REMARK 350 BIOMT2 5 -0.866025 -0.500000 0.000000 132.50102 REMARK 350 BIOMT3 5 0.000000 0.000000 1.000000 0.00000 REMARK 350 BIOMT1 6 -1.000000 0.000000 0.000000 152.99900 REMARK 350 BIOMT2 6 0.000000 1.000000 0.000000 0.00000 REMARK 350 BIOMT3 6 0.000000 0.000000 -1.000000 30.86350 ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 56 ? GLN A 72 ? LYS A 56 GLN A 72 1 ? 17 HELX_P HELX_P2 2 ASP A 78 ? PHE A 100 ? ASP A 78 PHE A 100 1 ? 23 HELX_P HELX_P3 3 LYS B 56 ? GLN B 72 ? LYS B 56 GLN B 72 1 ? 17 HELX_P HELX_P4 4 ASP B 78 ? PHE B 100 ? ASP B 78 PHE B 100 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 44 ? TYR A 51 ? GLU A 44 TYR A 51 A 2 TYR A 33 ? LEU A 40 ? TYR A 33 LEU A 40 A 3 LEU A 12 ? THR A 24 ? LEU A 12 THR A 24 A 4 GLN B 16 ? LYS B 28 ? GLN B 16 LYS B 28 A 5 GLY B 31 ? LEU B 40 ? GLY B 31 LEU B 40 A 6 GLU B 44 ? TYR B 51 ? GLU B 44 TYR B 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 48 ? O LYS A 48 N ILE A 36 ? N ILE A 36 A 2 3 O LYS A 37 ? O LYS A 37 N LEU A 22 ? N LEU A 22 A 3 4 N TYR A 21 ? N TYR A 21 O VAL B 19 ? O VAL B 19 A 4 5 N THR B 24 ? N THR B 24 O HIS B 35 ? O HIS B 35 A 5 6 N ILE B 38 ? N ILE B 38 O LEU B 46 ? O LEU B 46 # _database_PDB_matrix.entry_id 4LID _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4LID _atom_sites.fract_transf_matrix[1][1] 0.006536 _atom_sites.fract_transf_matrix[1][2] 0.003774 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007547 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016200 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 ? ? ? A . n A 1 27 ARG 27 27 ? ? ? A . n A 1 28 LYS 28 28 ? ? ? A . n A 1 29 PRO 29 29 ? ? ? A . n A 1 30 TYR 30 30 ? ? ? A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 HIS 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 VAL 2 2 ? ? ? B . n B 1 3 SER 3 3 ? ? ? B . n B 1 4 PRO 4 4 ? ? ? B . n B 1 5 GLN 5 5 ? ? ? B . n B 1 6 THR 6 6 ? ? ? B . n B 1 7 ARG 7 7 ? ? ? B . n B 1 8 LYS 8 8 ? ? ? B . n B 1 9 GLU 9 9 ? ? ? B . n B 1 10 GLU 10 10 ? ? ? B . n B 1 11 GLU 11 11 ? ? ? B . n B 1 12 LEU 12 12 ? ? ? B . n B 1 13 LEU 13 13 ? ? ? B . n B 1 14 GLU 14 14 ? ? ? B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 GLN 16 16 16 GLN GLN B . n B 1 17 ASN 17 17 17 ASN ASN B . n B 1 18 SER 18 18 18 SER SER B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 PHE 20 20 20 PHE PHE B . n B 1 21 TYR 21 21 21 TYR TYR B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 THR 24 24 24 THR THR B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 GLY 26 26 26 GLY GLY B . n B 1 27 ARG 27 27 27 ARG ARG B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 PRO 29 29 29 PRO PRO B . n B 1 30 TYR 30 30 30 TYR TYR B . n B 1 31 GLY 31 31 31 GLY GLY B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 TYR 33 33 33 TYR TYR B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 HIS 35 35 35 HIS HIS B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 LYS 37 37 37 LYS LYS B . n B 1 38 ILE 38 38 38 ILE ILE B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 ASP 41 41 41 ASP ASP B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 ASP 43 43 43 ASP ASP B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 GLU 47 47 47 GLU GLU B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 ILE 50 50 50 ILE ILE B . n B 1 51 TYR 51 51 51 TYR TYR B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 ASP 53 53 53 ASP ASP B . n B 1 54 ASN 54 54 54 ASN ASN B . n B 1 55 ILE 55 55 55 ILE ILE B . n B 1 56 LYS 56 56 56 LYS LYS B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 ASN 59 59 59 ASN ASN B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 LEU 61 61 61 LEU LEU B . n B 1 62 ARG 62 62 62 ARG ARG B . n B 1 63 GLN 63 63 63 GLN GLN B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 LYS 65 65 65 LYS LYS B . n B 1 66 ARG 66 66 66 ARG ARG B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 TYR 68 68 68 TYR TYR B . n B 1 69 GLU 69 69 69 GLU GLU B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 TYR 71 71 71 TYR TYR B . n B 1 72 GLN 72 72 72 GLN GLN B . n B 1 73 SER 73 73 73 SER SER B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 GLU 75 75 75 GLU GLU B . n B 1 76 ILE 76 76 76 ILE ILE B . n B 1 77 ASP 77 77 77 ASP ASP B . n B 1 78 ASP 78 78 78 ASP ASP B . n B 1 79 ALA 79 79 79 ALA ALA B . n B 1 80 GLN 80 80 80 GLN GLN B . n B 1 81 LYS 81 81 81 LYS LYS B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 ILE 83 83 83 ILE ILE B . n B 1 84 GLN 84 84 84 GLN GLN B . n B 1 85 LYS 85 85 85 LYS LYS B . n B 1 86 GLU 86 86 86 GLU GLU B . n B 1 87 ALA 87 87 87 ALA ALA B . n B 1 88 LEU 88 88 88 LEU LEU B . n B 1 89 LEU 89 89 89 LEU LEU B . n B 1 90 THR 90 90 90 THR THR B . n B 1 91 ILE 91 91 91 ILE ILE B . n B 1 92 ALA 92 92 92 ALA ALA B . n B 1 93 LYS 93 93 93 LYS LYS B . n B 1 94 ILE 94 94 94 ILE ILE B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 SER 96 96 96 SER SER B . n B 1 97 VAL 97 97 97 VAL VAL B . n B 1 98 PHE 98 98 98 PHE PHE B . n B 1 99 ASP 99 99 99 ASP ASP B . n B 1 100 PHE 100 100 100 PHE PHE B . n B 1 101 HIS 101 101 ? ? ? B . n B 1 102 HIS 102 102 ? ? ? B . n B 1 103 HIS 103 103 ? ? ? B . n B 1 104 HIS 104 104 ? ? ? B . n B 1 105 HIS 105 105 ? ? ? B . n B 1 106 HIS 106 106 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 29840 ? 1 MORE -180 ? 1 'SSA (A^2)' 49380 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 152.9990000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 76.4995000000 -0.8660254038 -0.5000000000 0.0000000000 132.5010207536 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/2 0.5000000000 -0.8660254038 0.0000000000 76.4995000000 -0.8660254038 -0.5000000000 0.0000000000 132.5010207536 0.0000000000 0.0000000000 -1.0000000000 30.8635000000 5 'crystal symmetry operation' 11_655 -x+y+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 152.9990000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 30.8635000000 6 'crystal symmetry operation' 12_555 x,x-y,-z+1/2 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 30.8635000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-09-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 31.7766 46.3208 23.6143 0.3745 0.4028 0.4312 0.1139 -0.0174 -0.0801 9.5096 3.1863 21.7427 1.4825 -1.0492 -0.2372 0.0073 0.2676 -0.1459 -0.0478 0.0994 0.0590 -0.2823 -0.3504 -0.1067 'X-RAY DIFFRACTION' 2 ? refined 35.6458 47.2297 1.6690 1.0749 2.2635 0.3193 -0.0092 0.0274 -0.1157 12.9715 11.8003 14.4056 -2.7303 -12.9940 6.5746 -0.3664 3.5838 -0.0889 -1.4567 0.3981 -0.2679 -0.2266 -3.4828 -0.0316 'X-RAY DIFFRACTION' 3 ? refined 42.0820 49.2474 5.5185 0.9156 1.4507 0.2769 -0.1485 0.0413 -0.0528 8.4212 9.2640 10.6814 0.0379 -4.6856 1.5123 -0.4747 2.3109 -0.2257 -1.2621 0.3627 -0.4117 -0.4015 -1.2290 0.1119 'X-RAY DIFFRACTION' 4 ? refined 45.3111 52.4299 14.9975 0.4652 0.5505 0.2244 0.0443 0.0340 0.0639 10.8701 11.5743 6.1130 4.9203 -0.0494 4.0949 -0.2803 0.6482 0.4684 -0.0201 0.0278 0.0822 -0.3145 -0.5007 0.2525 'X-RAY DIFFRACTION' 5 ? refined 32.7607 38.9154 3.3526 0.6957 1.4214 0.6855 -0.2794 -0.0266 -0.7302 14.5284 8.5392 21.7725 0.3980 16.7285 2.9887 0.9232 1.2178 -0.3192 -0.0159 -1.4426 1.1404 1.4033 0.3704 0.5194 'X-RAY DIFFRACTION' 6 ? refined 35.2844 43.5011 30.5199 0.4035 0.4357 0.4036 0.1769 0.0556 0.0338 6.6223 5.8805 17.5065 0.8651 -1.3872 0.4940 -0.4751 -0.5936 -0.2563 0.8733 0.3045 -0.0909 -0.2975 0.5286 0.1706 'X-RAY DIFFRACTION' 7 ? refined 33.7546 36.5654 22.0683 0.2760 0.3486 0.5927 0.0434 0.1862 -0.1168 14.6499 8.0981 28.9417 4.5764 12.0445 5.9282 -0.4288 0.6432 -1.5564 0.0458 0.5486 0.7015 0.1851 -0.4947 -0.1197 'X-RAY DIFFRACTION' 8 ? refined 50.5132 36.5182 16.5270 0.4012 0.4438 0.9679 -0.0142 0.4165 -0.2176 3.7979 10.8601 5.3979 -1.6466 2.6617 3.8301 -0.2818 0.3634 -0.6882 -0.5170 0.7116 -1.2179 -0.0516 0.7124 -0.4298 'X-RAY DIFFRACTION' 9 ? refined 41.0617 28.0286 11.4994 0.8640 1.0774 1.4070 -0.2479 0.3590 -0.6732 1.8446 40.5368 1.2009 0.0934 1.3278 2.6391 0.2015 -0.3817 -0.9589 -1.7599 0.0993 1.0623 0.0619 -0.5568 -0.3008 'X-RAY DIFFRACTION' 10 ? refined 41.7042 44.0075 20.9118 0.4122 0.4397 0.3599 0.0396 0.0342 -0.0046 13.1408 6.4830 4.7259 0.5082 -4.8189 1.8187 -0.5278 0.1359 -0.4902 0.1643 0.4404 -0.3889 -0.1854 0.1144 0.0874 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 10 ? ? A 23 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 24 ? ? A 41 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 42 ? ? A 61 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 62 ? ? A 100 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 B 15 ? ? B 19 ? ? ? ? 'X-RAY DIFFRACTION' 6 6 B 20 ? ? B 33 ? ? ? ? 'X-RAY DIFFRACTION' 7 7 B 34 ? ? B 52 ? ? ? ? 'X-RAY DIFFRACTION' 8 8 B 53 ? ? B 76 ? ? ? ? 'X-RAY DIFFRACTION' 9 9 B 77 ? ? B 85 ? ? ? ? 'X-RAY DIFFRACTION' 10 10 B 86 ? ? B 100 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal Blu-Ice 'data collection' . ? 1 PHENIX 'model building' . ? 2 REFMAC refinement 5.7.0029 ? 3 autoXDS 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 PHENIX phasing . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CE1 A TYR 33 ? ? CE1 A TYR 51 ? ? 2.07 2 1 OD2 A ASP 99 ? ? ND2 B ASN 17 ? ? 2.08 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE1 A GLU 75 ? ? 1_555 OE2 A GLU 86 ? ? 10_665 1.51 2 1 OE1 A GLU 75 ? ? 1_555 CD A GLU 86 ? ? 10_665 2.00 3 1 OE1 A GLU 75 ? ? 1_555 OE1 A GLU 86 ? ? 10_665 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 42 ? ? 54.06 16.11 2 1 ASN A 54 ? ? -95.71 52.27 3 1 GLN A 80 ? ? -38.82 -34.42 4 1 GLU B 42 ? ? 52.83 15.68 5 1 ASN B 54 ? ? -119.26 50.44 6 1 ASP B 78 ? ? -109.42 -78.83 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A GLY 26 ? A GLY 26 11 1 Y 1 A ARG 27 ? A ARG 27 12 1 Y 1 A LYS 28 ? A LYS 28 13 1 Y 1 A PRO 29 ? A PRO 29 14 1 Y 1 A TYR 30 ? A TYR 30 15 1 Y 1 A HIS 101 ? A HIS 101 16 1 Y 1 A HIS 102 ? A HIS 102 17 1 Y 1 A HIS 103 ? A HIS 103 18 1 Y 1 A HIS 104 ? A HIS 104 19 1 Y 1 A HIS 105 ? A HIS 105 20 1 Y 1 A HIS 106 ? A HIS 106 21 1 Y 1 B MET 1 ? B MET 1 22 1 Y 1 B VAL 2 ? B VAL 2 23 1 Y 1 B SER 3 ? B SER 3 24 1 Y 1 B PRO 4 ? B PRO 4 25 1 Y 1 B GLN 5 ? B GLN 5 26 1 Y 1 B THR 6 ? B THR 6 27 1 Y 1 B ARG 7 ? B ARG 7 28 1 Y 1 B LYS 8 ? B LYS 8 29 1 Y 1 B GLU 9 ? B GLU 9 30 1 Y 1 B GLU 10 ? B GLU 10 31 1 Y 1 B GLU 11 ? B GLU 11 32 1 Y 1 B LEU 12 ? B LEU 12 33 1 Y 1 B LEU 13 ? B LEU 13 34 1 Y 1 B GLU 14 ? B GLU 14 35 1 Y 1 B HIS 101 ? B HIS 101 36 1 Y 1 B HIS 102 ? B HIS 102 37 1 Y 1 B HIS 103 ? B HIS 103 38 1 Y 1 B HIS 104 ? B HIS 104 39 1 Y 1 B HIS 105 ? B HIS 105 40 1 Y 1 B HIS 106 ? B HIS 106 #