data_4LPF # _entry.id 4LPF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4LPF pdb_00004lpf 10.2210/pdb4lpf/pdb RCSB RCSB080920 ? ? WWPDB D_1000080920 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4GQU 'The native structure of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase' unspecified PDB 4LOM . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4LPF _pdbx_database_status.recvd_initial_deposition_date 2013-07-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ahangar, M.S.' 1 'Vyas, R.' 2 'Nasir, N.' 3 'Biswal, B.K.' 4 # _citation.id primary _citation.title ;Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase ; _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2013 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ahangar, M.S.' 1 ? primary 'Vyas, R.' 2 ? primary 'Nasir, N.' 3 ? primary 'Biswal, B.K.' 4 ? # _cell.entry_id 4LPF _cell.length_a 112.211 _cell.length_b 112.211 _cell.length_c 112.211 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4LPF _symmetry.space_group_name_H-M 'P 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 207 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Imidazoleglycerol-phosphate dehydratase' 23633.516 1 4.2.1.19 ? 'UNP residues 2-210' ? 2 non-polymer syn 3-AMINO-1,2,4-TRIAZOLE 84.080 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 3 ? ? ? ? 4 water nat water 18.015 71 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IGPD # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHH TIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVF ESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHH TIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVF ESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 THR n 1 9 THR n 1 10 THR n 1 11 GLN n 1 12 THR n 1 13 ALA n 1 14 LYS n 1 15 ALA n 1 16 SER n 1 17 ARG n 1 18 ARG n 1 19 ALA n 1 20 ARG n 1 21 ILE n 1 22 GLU n 1 23 ARG n 1 24 ARG n 1 25 THR n 1 26 ARG n 1 27 GLU n 1 28 SER n 1 29 ASP n 1 30 ILE n 1 31 VAL n 1 32 ILE n 1 33 GLU n 1 34 LEU n 1 35 ASP n 1 36 LEU n 1 37 ASP n 1 38 GLY n 1 39 THR n 1 40 GLY n 1 41 GLN n 1 42 VAL n 1 43 ALA n 1 44 VAL n 1 45 ASP n 1 46 THR n 1 47 GLY n 1 48 VAL n 1 49 PRO n 1 50 PHE n 1 51 TYR n 1 52 ASP n 1 53 HIS n 1 54 MET n 1 55 LEU n 1 56 THR n 1 57 ALA n 1 58 LEU n 1 59 GLY n 1 60 SER n 1 61 HIS n 1 62 ALA n 1 63 SER n 1 64 PHE n 1 65 ASP n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 ARG n 1 70 ALA n 1 71 THR n 1 72 GLY n 1 73 ASP n 1 74 VAL n 1 75 GLU n 1 76 ILE n 1 77 GLU n 1 78 ALA n 1 79 HIS n 1 80 HIS n 1 81 THR n 1 82 ILE n 1 83 GLU n 1 84 ASP n 1 85 THR n 1 86 ALA n 1 87 ILE n 1 88 ALA n 1 89 LEU n 1 90 GLY n 1 91 THR n 1 92 ALA n 1 93 LEU n 1 94 GLY n 1 95 GLN n 1 96 ALA n 1 97 LEU n 1 98 GLY n 1 99 ASP n 1 100 LYS n 1 101 ARG n 1 102 GLY n 1 103 ILE n 1 104 ARG n 1 105 ARG n 1 106 PHE n 1 107 GLY n 1 108 ASP n 1 109 ALA n 1 110 PHE n 1 111 ILE n 1 112 PRO n 1 113 MET n 1 114 ASP n 1 115 GLU n 1 116 THR n 1 117 LEU n 1 118 ALA n 1 119 HIS n 1 120 ALA n 1 121 ALA n 1 122 VAL n 1 123 ASP n 1 124 LEU n 1 125 SER n 1 126 GLY n 1 127 ARG n 1 128 PRO n 1 129 TYR n 1 130 CYS n 1 131 VAL n 1 132 HIS n 1 133 THR n 1 134 GLY n 1 135 GLU n 1 136 PRO n 1 137 ASP n 1 138 HIS n 1 139 LEU n 1 140 GLN n 1 141 HIS n 1 142 THR n 1 143 THR n 1 144 ILE n 1 145 ALA n 1 146 GLY n 1 147 SER n 1 148 SER n 1 149 VAL n 1 150 PRO n 1 151 TYR n 1 152 HIS n 1 153 THR n 1 154 VAL n 1 155 ILE n 1 156 ASN n 1 157 ARG n 1 158 HIS n 1 159 VAL n 1 160 PHE n 1 161 GLU n 1 162 SER n 1 163 LEU n 1 164 ALA n 1 165 ALA n 1 166 ASN n 1 167 ALA n 1 168 ARG n 1 169 ILE n 1 170 ALA n 1 171 LEU n 1 172 HIS n 1 173 VAL n 1 174 ARG n 1 175 VAL n 1 176 LEU n 1 177 TYR n 1 178 GLY n 1 179 ARG n 1 180 ASP n 1 181 PRO n 1 182 HIS n 1 183 HIS n 1 184 ILE n 1 185 THR n 1 186 GLU n 1 187 ALA n 1 188 GLN n 1 189 TYR n 1 190 LYS n 1 191 ALA n 1 192 VAL n 1 193 ALA n 1 194 ARG n 1 195 ALA n 1 196 LEU n 1 197 ARG n 1 198 GLN n 1 199 ALA n 1 200 VAL n 1 201 GLU n 1 202 PRO n 1 203 ASP n 1 204 PRO n 1 205 ARG n 1 206 VAL n 1 207 SER n 1 208 GLY n 1 209 VAL n 1 210 PRO n 1 211 SER n 1 212 THR n 1 213 LYS n 1 214 GLY n 1 215 ALA n 1 216 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'hisB, RVBD_1601' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis H37Rv' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Mycobacterium smegmatis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1772 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'mc2(4517)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pYUB1062 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I6XBW5_MYCTU _struct_ref.pdbx_db_accession I6XBW5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAI ALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANA RIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4LPF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 216 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I6XBW5 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 210 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4LPF MET A 1 ? UNP I6XBW5 ? ? 'expression tag' -5 1 1 4LPF HIS A 2 ? UNP I6XBW5 ? ? 'expression tag' -4 2 1 4LPF HIS A 3 ? UNP I6XBW5 ? ? 'expression tag' -3 3 1 4LPF HIS A 4 ? UNP I6XBW5 ? ? 'expression tag' -2 4 1 4LPF HIS A 5 ? UNP I6XBW5 ? ? 'expression tag' -1 5 1 4LPF HIS A 6 ? UNP I6XBW5 ? ? 'expression tag' 0 6 1 4LPF HIS A 7 ? UNP I6XBW5 ? ? 'expression tag' 1 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3TR non-polymer . 3-AMINO-1,2,4-TRIAZOLE AMITROLE 'C2 H4 N4' 84.080 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4LPF _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_percent_sol 50.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details '20% PEG1500, 0.2M SODIUM CITRATE, 0.1M TRIS HCL, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2011-08-24 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-E+ DW' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 4LPF _reflns.observed_criterion_sigma_I 0.00 _reflns.observed_criterion_sigma_F 0.00 _reflns.d_resolution_low 31.2 _reflns.d_resolution_high 2.30 _reflns.number_obs 11018 _reflns.number_all ? _reflns.percent_possible_obs 97.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_all 89.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4LPF _refine.ls_number_reflns_obs 10495 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 31.12 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 97.43 _refine.ls_R_factor_obs 0.18772 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18603 _refine.ls_R_factor_R_free 0.22111 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 523 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.921 _refine.B_iso_mean 24.374 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model 4GQU _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.263 _refine.pdbx_overall_ESU_R_Free 0.200 _refine.overall_SU_ML 0.143 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 6.057 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1469 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 1549 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 31.12 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.006 0.019 ? 1505 ? 'X-RAY DIFFRACTION' r_bond_other_d ? ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.236 1.941 ? 2045 ? 'X-RAY DIFFRACTION' r_angle_other_deg ? ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 5.972 5.000 ? 189 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 39.125 22.027 ? 74 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 18.074 15.000 ? 233 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 19.628 15.000 ? 18 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.078 0.200 ? 233 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.004 0.021 ? 1169 ? 'X-RAY DIFFRACTION' r_gen_planes_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.359 _refine_ls_shell.number_reflns_R_work 680 _refine_ls_shell.R_factor_R_work 0.224 _refine_ls_shell.percent_reflns_obs 89.35 _refine_ls_shell.R_factor_R_free 0.237 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 33 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 4LPF _struct.title 'Crystal structure of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4LPF _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'Dehydratase, LYASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 48 ? ALA A 62 ? VAL A 42 ALA A 56 1 ? 15 HELX_P HELX_P2 2 ALA A 78 ? GLY A 98 ? ALA A 72 GLY A 92 1 ? 21 HELX_P HELX_P3 3 PRO A 136 ? HIS A 141 ? PRO A 130 HIS A 135 5 ? 6 HELX_P HELX_P4 4 VAL A 154 ? ARG A 168 ? VAL A 148 ARG A 162 1 ? 15 HELX_P HELX_P5 5 ASP A 180 ? GLU A 201 ? ASP A 174 GLU A 195 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 53 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 47 A MN 303 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc2 metalc ? ? A HIS 79 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 73 A MN 302 1_555 ? ? ? ? ? ? ? 2.198 ? ? metalc3 metalc ? ? A GLU 83 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 77 A MN 302 1_555 ? ? ? ? ? ? ? 2.258 ? ? metalc4 metalc ? ? A HIS 158 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 152 A MN 302 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc5 metalc ? ? A HIS 182 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 176 A MN 303 1_555 ? ? ? ? ? ? ? 2.168 ? ? metalc6 metalc ? ? A GLU 186 OE1 ? ? ? 1_555 D MN . MN ? ? A GLU 180 A MN 303 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc7 metalc ? ? B 3TR . N4 ? ? ? 1_555 C MN . MN ? ? A 3TR 301 A MN 302 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc8 metalc ? ? C MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 302 A HOH 525 1_555 ? ? ? ? ? ? ? 2.155 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 18 ? ARG A 24 ? ARG A 12 ARG A 18 A 2 SER A 28 ? ASP A 35 ? SER A 22 ASP A 29 A 3 ASP A 65 ? GLY A 72 ? ASP A 59 GLY A 66 A 4 VAL A 42 ? ASP A 45 ? VAL A 36 ASP A 39 B 1 PHE A 106 ? MET A 113 ? PHE A 100 MET A 107 B 2 THR A 116 ? ASP A 123 ? THR A 110 ASP A 117 B 3 ALA A 170 ? TYR A 177 ? ALA A 164 TYR A 171 B 4 TYR A 129 ? THR A 133 ? TYR A 123 THR A 127 C 1 THR A 143 ? ILE A 144 ? THR A 137 ILE A 138 C 2 TYR A 151 ? HIS A 152 ? TYR A 145 HIS A 146 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 21 ? N ILE A 15 O ILE A 32 ? O ILE A 26 A 2 3 N ASP A 29 ? N ASP A 23 O THR A 71 ? O THR A 65 A 3 4 O ALA A 70 ? O ALA A 64 N ASP A 45 ? N ASP A 39 B 1 2 N GLY A 107 ? N GLY A 101 O VAL A 122 ? O VAL A 116 B 2 3 N HIS A 119 ? N HIS A 113 O ARG A 174 ? O ARG A 168 B 3 4 O LEU A 171 ? O LEU A 165 N TYR A 129 ? N TYR A 123 C 1 2 N ILE A 144 ? N ILE A 138 O TYR A 151 ? O TYR A 145 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 3TR 301 ? 12 'BINDING SITE FOR RESIDUE 3TR A 301' AC2 Software A MN 302 ? 6 'BINDING SITE FOR RESIDUE MN A 302' AC3 Software A MN 303 ? 6 'BINDING SITE FOR RESIDUE MN A 303' AC4 Software A MN 304 ? 3 'BINDING SITE FOR RESIDUE MN A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 HIS A 79 ? HIS A 73 . ? 1_555 ? 2 AC1 12 HIS A 80 ? HIS A 74 . ? 1_555 ? 3 AC1 12 GLU A 83 ? GLU A 77 . ? 1_555 ? 4 AC1 12 MET A 113 ? MET A 107 . ? 16_555 ? 5 AC1 12 ARG A 127 ? ARG A 121 . ? 24_555 ? 6 AC1 12 HIS A 182 ? HIS A 176 . ? 16_555 ? 7 AC1 12 HIS A 183 ? HIS A 177 . ? 16_555 ? 8 AC1 12 GLU A 186 ? GLU A 180 . ? 16_555 ? 9 AC1 12 MN C . ? MN A 302 . ? 1_555 ? 10 AC1 12 MN D . ? MN A 303 . ? 16_555 ? 11 AC1 12 HOH F . ? HOH A 525 . ? 1_555 ? 12 AC1 12 HOH F . ? HOH A 550 . ? 1_555 ? 13 AC2 6 HIS A 79 ? HIS A 73 . ? 1_555 ? 14 AC2 6 GLU A 83 ? GLU A 77 . ? 1_555 ? 15 AC2 6 HIS A 158 ? HIS A 152 . ? 1_555 ? 16 AC2 6 HIS A 183 ? HIS A 177 . ? 16_555 ? 17 AC2 6 3TR B . ? 3TR A 301 . ? 1_555 ? 18 AC2 6 HOH F . ? HOH A 525 . ? 1_555 ? 19 AC3 6 HIS A 53 ? HIS A 47 . ? 1_555 ? 20 AC3 6 HIS A 80 ? HIS A 74 . ? 15_555 ? 21 AC3 6 HIS A 182 ? HIS A 176 . ? 1_555 ? 22 AC3 6 GLU A 186 ? GLU A 180 . ? 1_555 ? 23 AC3 6 3TR B . ? 3TR A 301 . ? 15_555 ? 24 AC3 6 HOH F . ? HOH A 550 . ? 15_555 ? 25 AC4 3 ARG A 174 ? ARG A 168 . ? 1_555 ? 26 AC4 3 ARG A 174 ? ARG A 168 . ? 7_555 ? 27 AC4 3 ARG A 174 ? ARG A 168 . ? 10_555 ? # _database_PDB_matrix.entry_id 4LPF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4LPF _atom_sites.fract_transf_matrix[1][1] 0.008912 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008912 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008912 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 HIS 2 -4 ? ? ? A . n A 1 3 HIS 3 -3 ? ? ? A . n A 1 4 HIS 4 -2 ? ? ? A . n A 1 5 HIS 5 -1 ? ? ? A . n A 1 6 HIS 6 0 ? ? ? A . n A 1 7 HIS 7 1 ? ? ? A . n A 1 8 THR 8 2 ? ? ? A . n A 1 9 THR 9 3 ? ? ? A . n A 1 10 THR 10 4 ? ? ? A . n A 1 11 GLN 11 5 ? ? ? A . n A 1 12 THR 12 6 ? ? ? A . n A 1 13 ALA 13 7 ? ? ? A . n A 1 14 LYS 14 8 ? ? ? A . n A 1 15 ALA 15 9 ? ? ? A . n A 1 16 SER 16 10 10 SER SER A . n A 1 17 ARG 17 11 11 ARG ARG A . n A 1 18 ARG 18 12 12 ARG ARG A . n A 1 19 ALA 19 13 13 ALA ALA A . n A 1 20 ARG 20 14 14 ARG ARG A . n A 1 21 ILE 21 15 15 ILE ILE A . n A 1 22 GLU 22 16 16 GLU GLU A . n A 1 23 ARG 23 17 17 ARG ARG A . n A 1 24 ARG 24 18 18 ARG ARG A . n A 1 25 THR 25 19 19 THR THR A . n A 1 26 ARG 26 20 20 ARG ARG A . n A 1 27 GLU 27 21 21 GLU GLU A . n A 1 28 SER 28 22 22 SER SER A . n A 1 29 ASP 29 23 23 ASP ASP A . n A 1 30 ILE 30 24 24 ILE ILE A . n A 1 31 VAL 31 25 25 VAL VAL A . n A 1 32 ILE 32 26 26 ILE ILE A . n A 1 33 GLU 33 27 27 GLU GLU A . n A 1 34 LEU 34 28 28 LEU LEU A . n A 1 35 ASP 35 29 29 ASP ASP A . n A 1 36 LEU 36 30 30 LEU LEU A . n A 1 37 ASP 37 31 31 ASP ASP A . n A 1 38 GLY 38 32 32 GLY GLY A . n A 1 39 THR 39 33 33 THR THR A . n A 1 40 GLY 40 34 34 GLY GLY A . n A 1 41 GLN 41 35 35 GLN GLN A . n A 1 42 VAL 42 36 36 VAL VAL A . n A 1 43 ALA 43 37 37 ALA ALA A . n A 1 44 VAL 44 38 38 VAL VAL A . n A 1 45 ASP 45 39 39 ASP ASP A . n A 1 46 THR 46 40 40 THR THR A . n A 1 47 GLY 47 41 41 GLY GLY A . n A 1 48 VAL 48 42 42 VAL VAL A . n A 1 49 PRO 49 43 43 PRO PRO A . n A 1 50 PHE 50 44 44 PHE PHE A . n A 1 51 TYR 51 45 45 TYR TYR A . n A 1 52 ASP 52 46 46 ASP ASP A . n A 1 53 HIS 53 47 47 HIS HIS A . n A 1 54 MET 54 48 48 MET MET A . n A 1 55 LEU 55 49 49 LEU LEU A . n A 1 56 THR 56 50 50 THR THR A . n A 1 57 ALA 57 51 51 ALA ALA A . n A 1 58 LEU 58 52 52 LEU LEU A . n A 1 59 GLY 59 53 53 GLY GLY A . n A 1 60 SER 60 54 54 SER SER A . n A 1 61 HIS 61 55 55 HIS HIS A . n A 1 62 ALA 62 56 56 ALA ALA A . n A 1 63 SER 63 57 57 SER SER A . n A 1 64 PHE 64 58 58 PHE PHE A . n A 1 65 ASP 65 59 59 ASP ASP A . n A 1 66 LEU 66 60 60 LEU LEU A . n A 1 67 THR 67 61 61 THR THR A . n A 1 68 VAL 68 62 62 VAL VAL A . n A 1 69 ARG 69 63 63 ARG ARG A . n A 1 70 ALA 70 64 64 ALA ALA A . n A 1 71 THR 71 65 65 THR THR A . n A 1 72 GLY 72 66 66 GLY GLY A . n A 1 73 ASP 73 67 67 ASP ASP A . n A 1 74 VAL 74 68 68 VAL VAL A . n A 1 75 GLU 75 69 69 GLU GLU A . n A 1 76 ILE 76 70 70 ILE ILE A . n A 1 77 GLU 77 71 71 GLU GLU A . n A 1 78 ALA 78 72 72 ALA ALA A . n A 1 79 HIS 79 73 73 HIS HIS A . n A 1 80 HIS 80 74 74 HIS HIS A . n A 1 81 THR 81 75 75 THR THR A . n A 1 82 ILE 82 76 76 ILE ILE A . n A 1 83 GLU 83 77 77 GLU GLU A . n A 1 84 ASP 84 78 78 ASP ASP A . n A 1 85 THR 85 79 79 THR THR A . n A 1 86 ALA 86 80 80 ALA ALA A . n A 1 87 ILE 87 81 81 ILE ILE A . n A 1 88 ALA 88 82 82 ALA ALA A . n A 1 89 LEU 89 83 83 LEU LEU A . n A 1 90 GLY 90 84 84 GLY GLY A . n A 1 91 THR 91 85 85 THR THR A . n A 1 92 ALA 92 86 86 ALA ALA A . n A 1 93 LEU 93 87 87 LEU LEU A . n A 1 94 GLY 94 88 88 GLY GLY A . n A 1 95 GLN 95 89 89 GLN GLN A . n A 1 96 ALA 96 90 90 ALA ALA A . n A 1 97 LEU 97 91 91 LEU LEU A . n A 1 98 GLY 98 92 92 GLY GLY A . n A 1 99 ASP 99 93 93 ASP ASP A . n A 1 100 LYS 100 94 94 LYS LYS A . n A 1 101 ARG 101 95 95 ARG ARG A . n A 1 102 GLY 102 96 96 GLY GLY A . n A 1 103 ILE 103 97 97 ILE ILE A . n A 1 104 ARG 104 98 98 ARG ARG A . n A 1 105 ARG 105 99 99 ARG ARG A . n A 1 106 PHE 106 100 100 PHE PHE A . n A 1 107 GLY 107 101 101 GLY GLY A . n A 1 108 ASP 108 102 102 ASP ASP A . n A 1 109 ALA 109 103 103 ALA ALA A . n A 1 110 PHE 110 104 104 PHE PHE A . n A 1 111 ILE 111 105 105 ILE ILE A . n A 1 112 PRO 112 106 106 PRO PRO A . n A 1 113 MET 113 107 107 MET MET A . n A 1 114 ASP 114 108 108 ASP ASP A . n A 1 115 GLU 115 109 109 GLU GLU A . n A 1 116 THR 116 110 110 THR THR A . n A 1 117 LEU 117 111 111 LEU LEU A . n A 1 118 ALA 118 112 112 ALA ALA A . n A 1 119 HIS 119 113 113 HIS HIS A . n A 1 120 ALA 120 114 114 ALA ALA A . n A 1 121 ALA 121 115 115 ALA ALA A . n A 1 122 VAL 122 116 116 VAL VAL A . n A 1 123 ASP 123 117 117 ASP ASP A . n A 1 124 LEU 124 118 118 LEU LEU A . n A 1 125 SER 125 119 119 SER SER A . n A 1 126 GLY 126 120 120 GLY GLY A . n A 1 127 ARG 127 121 121 ARG ARG A . n A 1 128 PRO 128 122 122 PRO PRO A . n A 1 129 TYR 129 123 123 TYR TYR A . n A 1 130 CYS 130 124 124 CYS CYS A . n A 1 131 VAL 131 125 125 VAL VAL A . n A 1 132 HIS 132 126 126 HIS HIS A . n A 1 133 THR 133 127 127 THR THR A . n A 1 134 GLY 134 128 128 GLY GLY A . n A 1 135 GLU 135 129 129 GLU GLU A . n A 1 136 PRO 136 130 130 PRO PRO A . n A 1 137 ASP 137 131 131 ASP ASP A . n A 1 138 HIS 138 132 132 HIS HIS A . n A 1 139 LEU 139 133 133 LEU LEU A . n A 1 140 GLN 140 134 134 GLN GLN A . n A 1 141 HIS 141 135 135 HIS HIS A . n A 1 142 THR 142 136 136 THR THR A . n A 1 143 THR 143 137 137 THR THR A . n A 1 144 ILE 144 138 138 ILE ILE A . n A 1 145 ALA 145 139 139 ALA ALA A . n A 1 146 GLY 146 140 140 GLY GLY A . n A 1 147 SER 147 141 141 SER SER A . n A 1 148 SER 148 142 142 SER SER A . n A 1 149 VAL 149 143 143 VAL VAL A . n A 1 150 PRO 150 144 144 PRO PRO A . n A 1 151 TYR 151 145 145 TYR TYR A . n A 1 152 HIS 152 146 146 HIS HIS A . n A 1 153 THR 153 147 147 THR THR A . n A 1 154 VAL 154 148 148 VAL VAL A . n A 1 155 ILE 155 149 149 ILE ILE A . n A 1 156 ASN 156 150 150 ASN ASN A . n A 1 157 ARG 157 151 151 ARG ARG A . n A 1 158 HIS 158 152 152 HIS HIS A . n A 1 159 VAL 159 153 153 VAL VAL A . n A 1 160 PHE 160 154 154 PHE PHE A . n A 1 161 GLU 161 155 155 GLU GLU A . n A 1 162 SER 162 156 156 SER SER A . n A 1 163 LEU 163 157 157 LEU LEU A . n A 1 164 ALA 164 158 158 ALA ALA A . n A 1 165 ALA 165 159 159 ALA ALA A . n A 1 166 ASN 166 160 160 ASN ASN A . n A 1 167 ALA 167 161 161 ALA ALA A . n A 1 168 ARG 168 162 162 ARG ARG A . n A 1 169 ILE 169 163 163 ILE ILE A . n A 1 170 ALA 170 164 164 ALA ALA A . n A 1 171 LEU 171 165 165 LEU LEU A . n A 1 172 HIS 172 166 166 HIS HIS A . n A 1 173 VAL 173 167 167 VAL VAL A . n A 1 174 ARG 174 168 168 ARG ARG A . n A 1 175 VAL 175 169 169 VAL VAL A . n A 1 176 LEU 176 170 170 LEU LEU A . n A 1 177 TYR 177 171 171 TYR TYR A . n A 1 178 GLY 178 172 172 GLY GLY A . n A 1 179 ARG 179 173 173 ARG ARG A . n A 1 180 ASP 180 174 174 ASP ASP A . n A 1 181 PRO 181 175 175 PRO PRO A . n A 1 182 HIS 182 176 176 HIS HIS A . n A 1 183 HIS 183 177 177 HIS HIS A . n A 1 184 ILE 184 178 178 ILE ILE A . n A 1 185 THR 185 179 179 THR THR A . n A 1 186 GLU 186 180 180 GLU GLU A . n A 1 187 ALA 187 181 181 ALA ALA A . n A 1 188 GLN 188 182 182 GLN GLN A . n A 1 189 TYR 189 183 183 TYR TYR A . n A 1 190 LYS 190 184 184 LYS LYS A . n A 1 191 ALA 191 185 185 ALA ALA A . n A 1 192 VAL 192 186 186 VAL VAL A . n A 1 193 ALA 193 187 187 ALA ALA A . n A 1 194 ARG 194 188 188 ARG ARG A . n A 1 195 ALA 195 189 189 ALA ALA A . n A 1 196 LEU 196 190 190 LEU LEU A . n A 1 197 ARG 197 191 191 ARG ARG A . n A 1 198 GLN 198 192 192 GLN GLN A . n A 1 199 ALA 199 193 193 ALA ALA A . n A 1 200 VAL 200 194 194 VAL VAL A . n A 1 201 GLU 201 195 195 GLU GLU A . n A 1 202 PRO 202 196 196 PRO PRO A . n A 1 203 ASP 203 197 197 ASP ASP A . n A 1 204 PRO 204 198 198 PRO PRO A . n A 1 205 ARG 205 199 199 ARG ARG A . n A 1 206 VAL 206 200 ? ? ? A . n A 1 207 SER 207 201 ? ? ? A . n A 1 208 GLY 208 202 ? ? ? A . n A 1 209 VAL 209 203 ? ? ? A . n A 1 210 PRO 210 204 ? ? ? A . n A 1 211 SER 211 205 ? ? ? A . n A 1 212 THR 212 206 ? ? ? A . n A 1 213 LYS 213 207 ? ? ? A . n A 1 214 GLY 214 208 ? ? ? A . n A 1 215 ALA 215 209 ? ? ? A . n A 1 216 LEU 216 210 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 3TR 1 301 300 3TR 3TR A . C 3 MN 1 302 401 MN MN A . D 3 MN 1 303 402 MN MN A . E 3 MN 1 304 403 MN MN A . F 4 HOH 1 501 501 HOH HOH A . F 4 HOH 2 502 502 HOH HOH A . F 4 HOH 3 503 504 HOH HOH A . F 4 HOH 4 504 505 HOH HOH A . F 4 HOH 5 505 506 HOH HOH A . F 4 HOH 6 506 507 HOH HOH A . F 4 HOH 7 507 508 HOH HOH A . F 4 HOH 8 508 509 HOH HOH A . F 4 HOH 9 509 510 HOH HOH A . F 4 HOH 10 510 511 HOH HOH A . F 4 HOH 11 511 512 HOH HOH A . F 4 HOH 12 512 513 HOH HOH A . F 4 HOH 13 513 514 HOH HOH A . F 4 HOH 14 514 515 HOH HOH A . F 4 HOH 15 515 516 HOH HOH A . F 4 HOH 16 516 517 HOH HOH A . F 4 HOH 17 517 518 HOH HOH A . F 4 HOH 18 518 519 HOH HOH A . F 4 HOH 19 519 520 HOH HOH A . F 4 HOH 20 520 521 HOH HOH A . F 4 HOH 21 521 522 HOH HOH A . F 4 HOH 22 522 523 HOH HOH A . F 4 HOH 23 523 524 HOH HOH A . F 4 HOH 24 524 525 HOH HOH A . F 4 HOH 25 525 526 HOH HOH A . F 4 HOH 26 526 527 HOH HOH A . F 4 HOH 27 527 528 HOH HOH A . F 4 HOH 28 528 529 HOH HOH A . F 4 HOH 29 529 530 HOH HOH A . F 4 HOH 30 530 531 HOH HOH A . F 4 HOH 31 531 532 HOH HOH A . F 4 HOH 32 532 533 HOH HOH A . F 4 HOH 33 533 534 HOH HOH A . F 4 HOH 34 534 535 HOH HOH A . F 4 HOH 35 535 536 HOH HOH A . F 4 HOH 36 536 537 HOH HOH A . F 4 HOH 37 537 538 HOH HOH A . F 4 HOH 38 538 540 HOH HOH A . F 4 HOH 39 539 542 HOH HOH A . F 4 HOH 40 540 543 HOH HOH A . F 4 HOH 41 541 544 HOH HOH A . F 4 HOH 42 542 545 HOH HOH A . F 4 HOH 43 543 546 HOH HOH A . F 4 HOH 44 544 547 HOH HOH A . F 4 HOH 45 545 548 HOH HOH A . F 4 HOH 46 546 549 HOH HOH A . F 4 HOH 47 547 550 HOH HOH A . F 4 HOH 48 548 551 HOH HOH A . F 4 HOH 49 549 552 HOH HOH A . F 4 HOH 50 550 553 HOH HOH A . F 4 HOH 51 551 554 HOH HOH A . F 4 HOH 52 552 555 HOH HOH A . F 4 HOH 53 553 556 HOH HOH A . F 4 HOH 54 554 557 HOH HOH A . F 4 HOH 55 555 560 HOH HOH A . F 4 HOH 56 556 561 HOH HOH A . F 4 HOH 57 557 562 HOH HOH A . F 4 HOH 58 558 563 HOH HOH A . F 4 HOH 59 559 564 HOH HOH A . F 4 HOH 60 560 565 HOH HOH A . F 4 HOH 61 561 566 HOH HOH A . F 4 HOH 62 562 567 HOH HOH A . F 4 HOH 63 563 568 HOH HOH A . F 4 HOH 64 564 570 HOH HOH A . F 4 HOH 65 565 571 HOH HOH A . F 4 HOH 66 566 572 HOH HOH A . F 4 HOH 67 567 573 HOH HOH A . F 4 HOH 68 568 574 HOH HOH A . F 4 HOH 69 569 575 HOH HOH A . F 4 HOH 70 570 576 HOH HOH A . F 4 HOH 71 571 577 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 82570 ? 1 MORE -155 ? 1 'SSA (A^2)' 136540 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MN 304 ? E MN . 2 1 A HOH 506 ? F HOH . 3 1 A HOH 560 ? F HOH . 4 1 A HOH 566 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 53 ? A HIS 47 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 NE2 ? A HIS 182 ? A HIS 176 ? 1_555 104.5 ? 2 NE2 ? A HIS 53 ? A HIS 47 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 OE1 ? A GLU 186 ? A GLU 180 ? 1_555 91.6 ? 3 NE2 ? A HIS 182 ? A HIS 176 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 OE1 ? A GLU 186 ? A GLU 180 ? 1_555 83.2 ? 4 NE2 ? A HIS 79 ? A HIS 73 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE1 ? A GLU 83 ? A GLU 77 ? 1_555 90.6 ? 5 NE2 ? A HIS 79 ? A HIS 73 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 158 ? A HIS 152 ? 1_555 91.9 ? 6 OE1 ? A GLU 83 ? A GLU 77 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 NE2 ? A HIS 158 ? A HIS 152 ? 1_555 87.2 ? 7 NE2 ? A HIS 79 ? A HIS 73 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 N4 ? B 3TR . ? A 3TR 301 ? 1_555 92.3 ? 8 OE1 ? A GLU 83 ? A GLU 77 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 N4 ? B 3TR . ? A 3TR 301 ? 1_555 88.3 ? 9 NE2 ? A HIS 158 ? A HIS 152 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 N4 ? B 3TR . ? A 3TR 301 ? 1_555 173.9 ? 10 NE2 ? A HIS 79 ? A HIS 73 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 174.8 ? 11 OE1 ? A GLU 83 ? A GLU 77 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 84.8 ? 12 NE2 ? A HIS 158 ? A HIS 152 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 85.6 ? 13 N4 ? B 3TR . ? A 3TR 301 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 525 ? 1_555 89.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-28 2 'Structure model' 1 1 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_ref_seq_dif 8 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 2 'Structure model' '_struct_ref_seq_dif.details' 31 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal StructureStudio 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.7.0029 ? 3 HKL-2000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 11 ? ? -113.86 72.50 2 1 ASP A 31 ? ? -105.45 55.29 3 1 GLU A 71 ? ? 163.87 -178.67 4 1 ARG A 99 ? ? 73.18 -48.05 5 1 ASP A 108 ? ? 53.16 -120.31 6 1 HIS A 135 ? ? -142.60 16.42 7 1 SER A 142 ? ? -126.40 -150.25 8 1 ARG A 173 ? ? -124.52 -53.06 9 1 PRO A 198 ? ? -79.54 30.99 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A HIS -4 ? A HIS 2 3 1 Y 1 A HIS -3 ? A HIS 3 4 1 Y 1 A HIS -2 ? A HIS 4 5 1 Y 1 A HIS -1 ? A HIS 5 6 1 Y 1 A HIS 0 ? A HIS 6 7 1 Y 1 A HIS 1 ? A HIS 7 8 1 Y 1 A THR 2 ? A THR 8 9 1 Y 1 A THR 3 ? A THR 9 10 1 Y 1 A THR 4 ? A THR 10 11 1 Y 1 A GLN 5 ? A GLN 11 12 1 Y 1 A THR 6 ? A THR 12 13 1 Y 1 A ALA 7 ? A ALA 13 14 1 Y 1 A LYS 8 ? A LYS 14 15 1 Y 1 A ALA 9 ? A ALA 15 16 1 Y 1 A VAL 200 ? A VAL 206 17 1 Y 1 A SER 201 ? A SER 207 18 1 Y 1 A GLY 202 ? A GLY 208 19 1 Y 1 A VAL 203 ? A VAL 209 20 1 Y 1 A PRO 204 ? A PRO 210 21 1 Y 1 A SER 205 ? A SER 211 22 1 Y 1 A THR 206 ? A THR 212 23 1 Y 1 A LYS 207 ? A LYS 213 24 1 Y 1 A GLY 208 ? A GLY 214 25 1 Y 1 A ALA 209 ? A ALA 215 26 1 Y 1 A LEU 210 ? A LEU 216 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 3TR N1 N Y N 1 3TR N2 N Y N 2 3TR C3 C Y N 3 3TR N4 N Y N 4 3TR C5 C Y N 5 3TR N3A N N N 6 3TR HN1 H N N 7 3TR H5 H N N 8 3TR H3A1 H N N 9 3TR H3A2 H N N 10 ALA N N N N 11 ALA CA C N S 12 ALA C C N N 13 ALA O O N N 14 ALA CB C N N 15 ALA OXT O N N 16 ALA H H N N 17 ALA H2 H N N 18 ALA HA H N N 19 ALA HB1 H N N 20 ALA HB2 H N N 21 ALA HB3 H N N 22 ALA HXT H N N 23 ARG N N N N 24 ARG CA C N S 25 ARG C C N N 26 ARG O O N N 27 ARG CB C N N 28 ARG CG C N N 29 ARG CD C N N 30 ARG NE N N N 31 ARG CZ C N N 32 ARG NH1 N N N 33 ARG NH2 N N N 34 ARG OXT O N N 35 ARG H H N N 36 ARG H2 H N N 37 ARG HA H N N 38 ARG HB2 H N N 39 ARG HB3 H N N 40 ARG HG2 H N N 41 ARG HG3 H N N 42 ARG HD2 H N N 43 ARG HD3 H N N 44 ARG HE H N N 45 ARG HH11 H N N 46 ARG HH12 H N N 47 ARG HH21 H N N 48 ARG HH22 H N N 49 ARG HXT H N N 50 ASN N N N N 51 ASN CA C N S 52 ASN C C N N 53 ASN O O N N 54 ASN CB C N N 55 ASN CG C N N 56 ASN OD1 O N N 57 ASN ND2 N N N 58 ASN OXT O N N 59 ASN H H N N 60 ASN H2 H N N 61 ASN HA H N N 62 ASN HB2 H N N 63 ASN HB3 H N N 64 ASN HD21 H N N 65 ASN HD22 H N N 66 ASN HXT H N N 67 ASP N N N N 68 ASP CA C N S 69 ASP C C N N 70 ASP O O N N 71 ASP CB C N N 72 ASP CG C N N 73 ASP OD1 O N N 74 ASP OD2 O N N 75 ASP OXT O N N 76 ASP H H N N 77 ASP H2 H N N 78 ASP HA H N N 79 ASP HB2 H N N 80 ASP HB3 H N N 81 ASP HD2 H N N 82 ASP HXT H N N 83 CYS N N N N 84 CYS CA C N R 85 CYS C C N N 86 CYS O O N N 87 CYS CB C N N 88 CYS SG S N N 89 CYS OXT O N N 90 CYS H H N N 91 CYS H2 H N N 92 CYS HA H N N 93 CYS HB2 H N N 94 CYS HB3 H N N 95 CYS HG H N N 96 CYS HXT H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 MN MN MN N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 3TR N1 N2 sing Y N 1 3TR N1 C5 sing Y N 2 3TR N1 HN1 sing N N 3 3TR N2 C3 doub Y N 4 3TR C3 N4 sing Y N 5 3TR C3 N3A sing N N 6 3TR N4 C5 doub Y N 7 3TR C5 H5 sing N N 8 3TR N3A H3A1 sing N N 9 3TR N3A H3A2 sing N N 10 ALA N CA sing N N 11 ALA N H sing N N 12 ALA N H2 sing N N 13 ALA CA C sing N N 14 ALA CA CB sing N N 15 ALA CA HA sing N N 16 ALA C O doub N N 17 ALA C OXT sing N N 18 ALA CB HB1 sing N N 19 ALA CB HB2 sing N N 20 ALA CB HB3 sing N N 21 ALA OXT HXT sing N N 22 ARG N CA sing N N 23 ARG N H sing N N 24 ARG N H2 sing N N 25 ARG CA C sing N N 26 ARG CA CB sing N N 27 ARG CA HA sing N N 28 ARG C O doub N N 29 ARG C OXT sing N N 30 ARG CB CG sing N N 31 ARG CB HB2 sing N N 32 ARG CB HB3 sing N N 33 ARG CG CD sing N N 34 ARG CG HG2 sing N N 35 ARG CG HG3 sing N N 36 ARG CD NE sing N N 37 ARG CD HD2 sing N N 38 ARG CD HD3 sing N N 39 ARG NE CZ sing N N 40 ARG NE HE sing N N 41 ARG CZ NH1 sing N N 42 ARG CZ NH2 doub N N 43 ARG NH1 HH11 sing N N 44 ARG NH1 HH12 sing N N 45 ARG NH2 HH21 sing N N 46 ARG NH2 HH22 sing N N 47 ARG OXT HXT sing N N 48 ASN N CA sing N N 49 ASN N H sing N N 50 ASN N H2 sing N N 51 ASN CA C sing N N 52 ASN CA CB sing N N 53 ASN CA HA sing N N 54 ASN C O doub N N 55 ASN C OXT sing N N 56 ASN CB CG sing N N 57 ASN CB HB2 sing N N 58 ASN CB HB3 sing N N 59 ASN CG OD1 doub N N 60 ASN CG ND2 sing N N 61 ASN ND2 HD21 sing N N 62 ASN ND2 HD22 sing N N 63 ASN OXT HXT sing N N 64 ASP N CA sing N N 65 ASP N H sing N N 66 ASP N H2 sing N N 67 ASP CA C sing N N 68 ASP CA CB sing N N 69 ASP CA HA sing N N 70 ASP C O doub N N 71 ASP C OXT sing N N 72 ASP CB CG sing N N 73 ASP CB HB2 sing N N 74 ASP CB HB3 sing N N 75 ASP CG OD1 doub N N 76 ASP CG OD2 sing N N 77 ASP OD2 HD2 sing N N 78 ASP OXT HXT sing N N 79 CYS N CA sing N N 80 CYS N H sing N N 81 CYS N H2 sing N N 82 CYS CA C sing N N 83 CYS CA CB sing N N 84 CYS CA HA sing N N 85 CYS C O doub N N 86 CYS C OXT sing N N 87 CYS CB SG sing N N 88 CYS CB HB2 sing N N 89 CYS CB HB3 sing N N 90 CYS SG HG sing N N 91 CYS OXT HXT sing N N 92 GLN N CA sing N N 93 GLN N H sing N N 94 GLN N H2 sing N N 95 GLN CA C sing N N 96 GLN CA CB sing N N 97 GLN CA HA sing N N 98 GLN C O doub N N 99 GLN C OXT sing N N 100 GLN CB CG sing N N 101 GLN CB HB2 sing N N 102 GLN CB HB3 sing N N 103 GLN CG CD sing N N 104 GLN CG HG2 sing N N 105 GLN CG HG3 sing N N 106 GLN CD OE1 doub N N 107 GLN CD NE2 sing N N 108 GLN NE2 HE21 sing N N 109 GLN NE2 HE22 sing N N 110 GLN OXT HXT sing N N 111 GLU N CA sing N N 112 GLU N H sing N N 113 GLU N H2 sing N N 114 GLU CA C sing N N 115 GLU CA CB sing N N 116 GLU CA HA sing N N 117 GLU C O doub N N 118 GLU C OXT sing N N 119 GLU CB CG sing N N 120 GLU CB HB2 sing N N 121 GLU CB HB3 sing N N 122 GLU CG CD sing N N 123 GLU CG HG2 sing N N 124 GLU CG HG3 sing N N 125 GLU CD OE1 doub N N 126 GLU CD OE2 sing N N 127 GLU OE2 HE2 sing N N 128 GLU OXT HXT sing N N 129 GLY N CA sing N N 130 GLY N H sing N N 131 GLY N H2 sing N N 132 GLY CA C sing N N 133 GLY CA HA2 sing N N 134 GLY CA HA3 sing N N 135 GLY C O doub N N 136 GLY C OXT sing N N 137 GLY OXT HXT sing N N 138 HIS N CA sing N N 139 HIS N H sing N N 140 HIS N H2 sing N N 141 HIS CA C sing N N 142 HIS CA CB sing N N 143 HIS CA HA sing N N 144 HIS C O doub N N 145 HIS C OXT sing N N 146 HIS CB CG sing N N 147 HIS CB HB2 sing N N 148 HIS CB HB3 sing N N 149 HIS CG ND1 sing Y N 150 HIS CG CD2 doub Y N 151 HIS ND1 CE1 doub Y N 152 HIS ND1 HD1 sing N N 153 HIS CD2 NE2 sing Y N 154 HIS CD2 HD2 sing N N 155 HIS CE1 NE2 sing Y N 156 HIS CE1 HE1 sing N N 157 HIS NE2 HE2 sing N N 158 HIS OXT HXT sing N N 159 HOH O H1 sing N N 160 HOH O H2 sing N N 161 ILE N CA sing N N 162 ILE N H sing N N 163 ILE N H2 sing N N 164 ILE CA C sing N N 165 ILE CA CB sing N N 166 ILE CA HA sing N N 167 ILE C O doub N N 168 ILE C OXT sing N N 169 ILE CB CG1 sing N N 170 ILE CB CG2 sing N N 171 ILE CB HB sing N N 172 ILE CG1 CD1 sing N N 173 ILE CG1 HG12 sing N N 174 ILE CG1 HG13 sing N N 175 ILE CG2 HG21 sing N N 176 ILE CG2 HG22 sing N N 177 ILE CG2 HG23 sing N N 178 ILE CD1 HD11 sing N N 179 ILE CD1 HD12 sing N N 180 ILE CD1 HD13 sing N N 181 ILE OXT HXT sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 VAL N CA sing N N 340 VAL N H sing N N 341 VAL N H2 sing N N 342 VAL CA C sing N N 343 VAL CA CB sing N N 344 VAL CA HA sing N N 345 VAL C O doub N N 346 VAL C OXT sing N N 347 VAL CB CG1 sing N N 348 VAL CB CG2 sing N N 349 VAL CB HB sing N N 350 VAL CG1 HG11 sing N N 351 VAL CG1 HG12 sing N N 352 VAL CG1 HG13 sing N N 353 VAL CG2 HG21 sing N N 354 VAL CG2 HG22 sing N N 355 VAL CG2 HG23 sing N N 356 VAL OXT HXT sing N N 357 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 3-AMINO-1,2,4-TRIAZOLE 3TR 3 'MANGANESE (II) ION' MN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4GQU _pdbx_initial_refinement_model.details ? #