data_4LQE # _entry.id 4LQE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4LQE RCSB RCSB080954 WWPDB D_1000080954 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4LQE _pdbx_database_status.recvd_initial_deposition_date 2013-07-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Faham, S.' 1 'Agah, S.' 2 # _citation.id primary _citation.title 'Structural characterization of MepB from Staphylococcus aureus reveals homology to endonucleases.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 23 _citation.page_first 594 _citation.page_last 602 _citation.year 2014 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24501097 _citation.pdbx_database_id_DOI 10.1002/pro.2438 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Agah, S.' 1 primary 'Poulos, S.' 2 primary 'Banchs, C.' 3 primary 'Faham, S.' 4 # _cell.entry_id 4LQE _cell.length_a 44.645 _cell.length_b 91.139 _cell.length_c 100.004 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4LQE _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man MepB 19258.934 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 74 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MYKSKILLKYIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKAGYFVTCWTKDENNCNQPYSKEAFADY LMIIVIDEELSGYFLFPRELLVEKGILTTFEHKGKMAFRVYPKW(CME)NQLNKTAGQTQKWQCKYFLNTNKKSYGLEHH HHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MYKSKILLKYIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKAGYFVTCWTKDENNCNQPYSKEAFADY LMIIVIDEELSGYFLFPRELLVEKGILTTFEHKGKMAFRVYPKWCNQLNKTAGQTQKWQCKYFLNTNKKSYGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TYR n 1 3 LYS n 1 4 SER n 1 5 LYS n 1 6 ILE n 1 7 LEU n 1 8 LEU n 1 9 LYS n 1 10 TYR n 1 11 ILE n 1 12 PHE n 1 13 SER n 1 14 GLU n 1 15 GLU n 1 16 SER n 1 17 GLU n 1 18 VAL n 1 19 LYS n 1 20 ASP n 1 21 LEU n 1 22 THR n 1 23 GLU n 1 24 GLU n 1 25 LYS n 1 26 TYR n 1 27 ASN n 1 28 GLN n 1 29 ASP n 1 30 TYR n 1 31 GLU n 1 32 ALA n 1 33 LEU n 1 34 THR n 1 35 PHE n 1 36 SER n 1 37 PHE n 1 38 LYS n 1 39 GLU n 1 40 GLU n 1 41 THR n 1 42 TYR n 1 43 GLN n 1 44 SER n 1 45 ARG n 1 46 LEU n 1 47 ALA n 1 48 LYS n 1 49 LYS n 1 50 THR n 1 51 PRO n 1 52 THR n 1 53 LYS n 1 54 ALA n 1 55 GLY n 1 56 TYR n 1 57 PHE n 1 58 VAL n 1 59 THR n 1 60 CYS n 1 61 TRP n 1 62 THR n 1 63 LYS n 1 64 ASP n 1 65 GLU n 1 66 ASN n 1 67 ASN n 1 68 CYS n 1 69 ASN n 1 70 GLN n 1 71 PRO n 1 72 TYR n 1 73 SER n 1 74 LYS n 1 75 GLU n 1 76 ALA n 1 77 PHE n 1 78 ALA n 1 79 ASP n 1 80 TYR n 1 81 LEU n 1 82 MET n 1 83 ILE n 1 84 ILE n 1 85 VAL n 1 86 ILE n 1 87 ASP n 1 88 GLU n 1 89 GLU n 1 90 LEU n 1 91 SER n 1 92 GLY n 1 93 TYR n 1 94 PHE n 1 95 LEU n 1 96 PHE n 1 97 PRO n 1 98 ARG n 1 99 GLU n 1 100 LEU n 1 101 LEU n 1 102 VAL n 1 103 GLU n 1 104 LYS n 1 105 GLY n 1 106 ILE n 1 107 LEU n 1 108 THR n 1 109 THR n 1 110 PHE n 1 111 GLU n 1 112 HIS n 1 113 LYS n 1 114 GLY n 1 115 LYS n 1 116 MET n 1 117 ALA n 1 118 PHE n 1 119 ARG n 1 120 VAL n 1 121 TYR n 1 122 PRO n 1 123 LYS n 1 124 TRP n 1 125 CME n 1 126 ASN n 1 127 GLN n 1 128 LEU n 1 129 ASN n 1 130 LYS n 1 131 THR n 1 132 ALA n 1 133 GLY n 1 134 GLN n 1 135 THR n 1 136 GLN n 1 137 LYS n 1 138 TRP n 1 139 GLN n 1 140 CYS n 1 141 LYS n 1 142 TYR n 1 143 PHE n 1 144 LEU n 1 145 ASN n 1 146 THR n 1 147 ASN n 1 148 LYS n 1 149 LYS n 1 150 SER n 1 151 TYR n 1 152 GLY n 1 153 LEU n 1 154 GLU n 1 155 HIS n 1 156 HIS n 1 157 HIS n 1 158 HIS n 1 159 HIS n 1 160 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MepB, SAV0335' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Mu50 / ATCC 700699' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158878 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBAD _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99WP1_STAAM _struct_ref.pdbx_db_accession Q99WP1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MYKSKILLKYIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKAGYFVTCWTKDENNCNQPYSKEAFADY LMIIVIDEELSGYFLFPRELLVEKGILTTFEHKGKMAFRVYPKWCNQLNKTAGQTQKWQCKYFLNTNKKSYG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4LQE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99WP1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 152 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 152 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4LQE LEU A 153 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 153 1 1 4LQE GLU A 154 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 154 2 1 4LQE HIS A 155 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 155 3 1 4LQE HIS A 156 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 156 4 1 4LQE HIS A 157 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 157 5 1 4LQE HIS A 158 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 158 6 1 4LQE HIS A 159 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 159 7 1 4LQE HIS A 160 ? UNP Q99WP1 ? ? 'EXPRESSION TAG' 160 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4LQE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_percent_sol 53.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pdbx_details '100 mM Bis-tris, pH 5.0, 2.3 M NH4SO4, 1% MPD, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 108 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 4LQE _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.1 _reflns.number_obs 12092 _reflns.number_all ? _reflns.percent_possible_obs 98.4 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 24.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 8.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.16 _reflns_shell.percent_possible_all 95.6 _reflns_shell.Rmerge_I_obs 0.253 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.0 _reflns_shell.pdbx_redundancy 6.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 969 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4LQE _refine.ls_number_reflns_obs 11449 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 23.04 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 98.01 _refine.ls_R_factor_obs 0.23804 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23587 _refine.ls_R_factor_R_free 0.27938 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 595 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.915 _refine.B_iso_mean 40.861 _refine.aniso_B[1][1] -4.64 _refine.aniso_B[2][2] 5.77 _refine.aniso_B[3][3] -1.12 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.231 _refine.pdbx_overall_ESU_R_Free 0.203 _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1217 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 1296 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 23.04 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.011 0.022 ? 1258 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.336 1.952 ? 1705 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.235 5.000 ? 150 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 34.925 25.000 ? 62 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 15.892 15.000 ? 210 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 15.596 15.000 ? 3 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.096 0.200 ? 181 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.006 0.021 ? 957 ? 'X-RAY DIFFRACTION' r_mcbond_it 0.658 1.500 ? 746 ? 'X-RAY DIFFRACTION' r_mcangle_it 1.221 2.000 ? 1198 ? 'X-RAY DIFFRACTION' r_scbond_it 1.875 3.000 ? 512 ? 'X-RAY DIFFRACTION' r_scangle_it 2.648 4.500 ? 506 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.154 _refine_ls_shell.number_reflns_R_work 799 _refine_ls_shell.R_factor_R_work 0.345 _refine_ls_shell.percent_reflns_obs 95.05 _refine_ls_shell.R_factor_R_free 0.326 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 45 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4LQE _struct.title 'Crystal Structure of MepB' _struct.pdbx_descriptor MepB _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4LQE _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'Endonuclease, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 3 ? PHE A 12 ? LYS A 3 PHE A 12 1 ? 10 HELX_P HELX_P2 2 ASN A 27 ? GLU A 31 ? ASN A 27 GLU A 31 5 ? 5 HELX_P HELX_P3 3 ARG A 98 ? LYS A 104 ? ARG A 98 LYS A 104 1 ? 7 HELX_P HELX_P4 4 ASN A 129 ? LYS A 141 ? ASN A 129 LYS A 141 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A TRP 124 C ? ? ? 1_555 A CME 125 N ? ? A TRP 124 A CME 125 1_555 ? ? ? ? ? ? ? 1.343 ? covale2 covale ? ? A CME 125 C ? ? ? 1_555 A ASN 126 N ? ? A CME 125 A ASN 126 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 19 ? GLU A 23 ? LYS A 19 GLU A 23 A 2 LEU A 33 ? PHE A 37 ? LEU A 33 PHE A 37 A 3 GLU A 40 ? LEU A 46 ? GLU A 40 LEU A 46 A 4 TYR A 80 ? ASP A 87 ? TYR A 80 ASP A 87 A 5 LEU A 90 ? PRO A 97 ? LEU A 90 PRO A 97 A 6 PHE A 143 ? ASN A 145 ? PHE A 143 ASN A 145 B 1 TYR A 56 ? THR A 59 ? TYR A 56 THR A 59 B 2 ALA A 117 ? VAL A 120 ? ALA A 117 VAL A 120 C 1 THR A 62 ? LYS A 63 ? THR A 62 LYS A 63 C 2 ASN A 69 ? GLN A 70 ? ASN A 69 GLN A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 22 ? N THR A 22 O THR A 34 ? O THR A 34 A 2 3 N PHE A 35 ? N PHE A 35 O TYR A 42 ? O TYR A 42 A 3 4 N GLN A 43 ? N GLN A 43 O MET A 82 ? O MET A 82 A 4 5 N ASP A 87 ? N ASP A 87 O LEU A 90 ? O LEU A 90 A 5 6 N TYR A 93 ? N TYR A 93 O LEU A 144 ? O LEU A 144 B 1 2 N VAL A 58 ? N VAL A 58 O PHE A 118 ? O PHE A 118 C 1 2 N THR A 62 ? N THR A 62 O GLN A 70 ? O GLN A 70 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LYS A 53 ? LYS A 53 . ? 1_555 ? 2 AC1 6 PHE A 57 ? PHE A 57 . ? 1_555 ? 3 AC1 6 ARG A 119 ? ARG A 119 . ? 1_555 ? 4 AC1 6 GLN A 127 ? GLN A 127 . ? 3_656 ? 5 AC1 6 HOH C . ? HOH A 311 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 349 . ? 1_555 ? # _database_PDB_matrix.entry_id 4LQE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4LQE _atom_sites.fract_transf_matrix[1][1] 0.022399 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010972 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 TRP 124 124 124 TRP TRP A . n A 1 125 CME 125 125 125 CME CME A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 CYS 140 140 140 CYS CYS A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 SER 150 150 ? ? ? A . n A 1 151 TYR 151 151 ? ? ? A . n A 1 152 GLY 152 152 ? ? ? A . n A 1 153 LEU 153 153 ? ? ? A . n A 1 154 GLU 154 154 ? ? ? A . n A 1 155 HIS 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 HIS 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n A 1 159 HIS 159 159 ? ? ? A . n A 1 160 HIS 160 160 ? ? ? A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CME _pdbx_struct_mod_residue.label_seq_id 125 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CME _pdbx_struct_mod_residue.auth_seq_id 125 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2,3,4 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 10090 ? 2 MORE -126 ? 2 'SSA (A^2)' 29380 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 44.6450000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 44.6450000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 100.0040000000 4 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 100.0040000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-12 2 'Structure model' 1 1 2014-05-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 12.7190 _pdbx_refine_tls.origin_y 13.7630 _pdbx_refine_tls.origin_z 66.0230 _pdbx_refine_tls.T[1][1] 0.1025 _pdbx_refine_tls.T[2][2] 0.0522 _pdbx_refine_tls.T[3][3] 0.1043 _pdbx_refine_tls.T[1][2] 0.0014 _pdbx_refine_tls.T[1][3] 0.0016 _pdbx_refine_tls.T[2][3] -0.0119 _pdbx_refine_tls.L[1][1] 4.4019 _pdbx_refine_tls.L[2][2] 1.4699 _pdbx_refine_tls.L[3][3] 2.5017 _pdbx_refine_tls.L[1][2] -0.5987 _pdbx_refine_tls.L[1][3] -0.0777 _pdbx_refine_tls.L[2][3] 0.1303 _pdbx_refine_tls.S[1][1] 0.0237 _pdbx_refine_tls.S[1][2] -0.2141 _pdbx_refine_tls.S[1][3] -0.1115 _pdbx_refine_tls.S[2][1] 0.0381 _pdbx_refine_tls.S[2][2] 0.0154 _pdbx_refine_tls.S[2][3] 0.0217 _pdbx_refine_tls.S[3][1] -0.0301 _pdbx_refine_tls.S[3][2] -0.2997 _pdbx_refine_tls.S[3][3] -0.0391 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 149 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CRANK phasing . ? 1 REFMAC refinement 5.5.0109 ? 2 HKL-2000 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 88 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 56.85 _pdbx_validate_torsion.psi -114.02 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 9 ? CG ? A LYS 9 CG 2 1 Y 1 A LYS 9 ? CD ? A LYS 9 CD 3 1 Y 1 A LYS 9 ? CE ? A LYS 9 CE 4 1 Y 1 A LYS 9 ? NZ ? A LYS 9 NZ 5 1 Y 1 A GLU 14 ? CG ? A GLU 14 CG 6 1 Y 1 A GLU 14 ? CD ? A GLU 14 CD 7 1 Y 1 A GLU 14 ? OE1 ? A GLU 14 OE1 8 1 Y 1 A GLU 14 ? OE2 ? A GLU 14 OE2 9 1 Y 1 A GLU 15 ? CG ? A GLU 15 CG 10 1 Y 1 A GLU 15 ? CD ? A GLU 15 CD 11 1 Y 1 A GLU 15 ? OE1 ? A GLU 15 OE1 12 1 Y 1 A GLU 15 ? OE2 ? A GLU 15 OE2 13 1 Y 1 A LYS 19 ? CG ? A LYS 19 CG 14 1 Y 1 A LYS 19 ? CD ? A LYS 19 CD 15 1 Y 1 A LYS 19 ? CE ? A LYS 19 CE 16 1 Y 1 A LYS 19 ? NZ ? A LYS 19 NZ 17 1 Y 1 A LYS 25 ? CG ? A LYS 25 CG 18 1 Y 1 A LYS 25 ? CD ? A LYS 25 CD 19 1 Y 1 A LYS 25 ? CE ? A LYS 25 CE 20 1 Y 1 A LYS 25 ? NZ ? A LYS 25 NZ 21 1 Y 1 A LYS 130 ? CG ? A LYS 130 CG 22 1 Y 1 A LYS 130 ? CD ? A LYS 130 CD 23 1 Y 1 A LYS 130 ? CE ? A LYS 130 CE 24 1 Y 1 A LYS 130 ? NZ ? A LYS 130 NZ 25 1 Y 1 A LYS 137 ? CG ? A LYS 137 CG 26 1 Y 1 A LYS 137 ? CD ? A LYS 137 CD 27 1 Y 1 A LYS 137 ? CE ? A LYS 137 CE 28 1 Y 1 A LYS 137 ? NZ ? A LYS 137 NZ 29 1 Y 1 A LYS 141 ? CG ? A LYS 141 CG 30 1 Y 1 A LYS 141 ? CD ? A LYS 141 CD 31 1 Y 1 A LYS 141 ? CE ? A LYS 141 CE 32 1 Y 1 A LYS 141 ? NZ ? A LYS 141 NZ 33 1 Y 1 A LYS 148 ? CG ? A LYS 148 CG 34 1 Y 1 A LYS 148 ? CD ? A LYS 148 CD 35 1 Y 1 A LYS 148 ? CE ? A LYS 148 CE 36 1 Y 1 A LYS 148 ? NZ ? A LYS 148 NZ 37 1 Y 1 A LYS 149 ? CG ? A LYS 149 CG 38 1 Y 1 A LYS 149 ? CD ? A LYS 149 CD 39 1 Y 1 A LYS 149 ? CE ? A LYS 149 CE 40 1 Y 1 A LYS 149 ? NZ ? A LYS 149 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 150 ? A SER 150 2 1 Y 1 A TYR 151 ? A TYR 151 3 1 Y 1 A GLY 152 ? A GLY 152 4 1 Y 1 A LEU 153 ? A LEU 153 5 1 Y 1 A GLU 154 ? A GLU 154 6 1 Y 1 A HIS 155 ? A HIS 155 7 1 Y 1 A HIS 156 ? A HIS 156 8 1 Y 1 A HIS 157 ? A HIS 157 9 1 Y 1 A HIS 158 ? A HIS 158 10 1 Y 1 A HIS 159 ? A HIS 159 11 1 Y 1 A HIS 160 ? A HIS 160 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 13 HOH HOH A . C 3 HOH 14 314 14 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 16 HOH HOH A . C 3 HOH 17 317 17 HOH HOH A . C 3 HOH 18 318 18 HOH HOH A . C 3 HOH 19 319 19 HOH HOH A . C 3 HOH 20 320 20 HOH HOH A . C 3 HOH 21 321 21 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 23 HOH HOH A . C 3 HOH 24 324 24 HOH HOH A . C 3 HOH 25 325 25 HOH HOH A . C 3 HOH 26 326 26 HOH HOH A . C 3 HOH 27 327 27 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 29 HOH HOH A . C 3 HOH 30 330 30 HOH HOH A . C 3 HOH 31 331 31 HOH HOH A . C 3 HOH 32 332 32 HOH HOH A . C 3 HOH 33 333 33 HOH HOH A . C 3 HOH 34 334 34 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 36 HOH HOH A . C 3 HOH 37 337 37 HOH HOH A . C 3 HOH 38 338 38 HOH HOH A . C 3 HOH 39 339 39 HOH HOH A . C 3 HOH 40 340 40 HOH HOH A . C 3 HOH 41 341 41 HOH HOH A . C 3 HOH 42 342 42 HOH HOH A . C 3 HOH 43 343 43 HOH HOH A . C 3 HOH 44 344 44 HOH HOH A . C 3 HOH 45 345 45 HOH HOH A . C 3 HOH 46 346 46 HOH HOH A . C 3 HOH 47 347 47 HOH HOH A . C 3 HOH 48 348 48 HOH HOH A . C 3 HOH 49 349 49 HOH HOH A . C 3 HOH 50 350 50 HOH HOH A . C 3 HOH 51 351 51 HOH HOH A . C 3 HOH 52 352 52 HOH HOH A . C 3 HOH 53 353 53 HOH HOH A . C 3 HOH 54 354 54 HOH HOH A . C 3 HOH 55 355 55 HOH HOH A . C 3 HOH 56 356 56 HOH HOH A . C 3 HOH 57 357 57 HOH HOH A . C 3 HOH 58 358 58 HOH HOH A . C 3 HOH 59 359 59 HOH HOH A . C 3 HOH 60 360 60 HOH HOH A . C 3 HOH 61 361 61 HOH HOH A . C 3 HOH 62 362 62 HOH HOH A . C 3 HOH 63 363 63 HOH HOH A . C 3 HOH 64 364 64 HOH HOH A . C 3 HOH 65 365 65 HOH HOH A . C 3 HOH 66 366 66 HOH HOH A . C 3 HOH 67 367 67 HOH HOH A . C 3 HOH 68 368 68 HOH HOH A . C 3 HOH 69 369 69 HOH HOH A . C 3 HOH 70 370 70 HOH HOH A . C 3 HOH 71 371 71 HOH HOH A . C 3 HOH 72 372 72 HOH HOH A . C 3 HOH 73 373 73 HOH HOH A . C 3 HOH 74 374 74 HOH HOH A . #