data_4LTD # _entry.id 4LTD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4LTD RCSB RCSB081061 WWPDB D_1000081061 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2013-08-07 _pdbx_database_PDB_obs_spr.pdb_id 4LTD _pdbx_database_PDB_obs_spr.replace_pdb_id 2VZF _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4LTM . unspecified PDB 4LTN . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4LTD _pdbx_database_status.recvd_initial_deposition_date 2013-07-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nissen, M.S.' 1 'Youn, B.' 2 'Knowles, B.D.' 3 'Ballinger, J.W.' 4 'Jun, S.' 5 'Belchik, S.M.' 6 'Xun, L.' 7 'Kang, C.' 8 # _citation.id primary _citation.title 'Crystal structures of NADH:FMN oxidoreductase (EmoB) at different stages of catalysis.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 28710 _citation.page_last 28720 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18701448 _citation.pdbx_database_id_DOI 10.1074/jbc.M804535200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Nissen, M.S.' 1 primary 'Youn, B.' 2 primary 'Knowles, B.D.' 3 primary 'Ballinger, J.W.' 4 primary 'Jun, S.Y.' 5 primary 'Belchik, S.M.' 6 primary 'Xun, L.' 7 primary 'Kang, C.' 8 # _cell.entry_id 4LTD _cell.length_a 100.925 _cell.length_b 100.925 _cell.length_c 129.610 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4LTD _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NADH-dependent FMN reductase' 21115.639 1 1.5.1.42 ? ? ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 116 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name EmoB # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)TYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVA TPIYKASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHS(MSE)GVRHVVQSFF(MSE)VQSQFS VVDGKLAVEDDVASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDATRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MTYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIY KASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFMVQSQFSVVDGKLAVEDDV ASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDATRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 THR n 1 3 TYR n 1 4 SER n 1 5 ILE n 1 6 VAL n 1 7 ALA n 1 8 ILE n 1 9 SER n 1 10 GLY n 1 11 SER n 1 12 PRO n 1 13 SER n 1 14 ARG n 1 15 ASN n 1 16 SER n 1 17 THR n 1 18 THR n 1 19 ALA n 1 20 LYS n 1 21 LEU n 1 22 ALA n 1 23 GLU n 1 24 TYR n 1 25 ALA n 1 26 LEU n 1 27 ALA n 1 28 HIS n 1 29 VAL n 1 30 LEU n 1 31 ALA n 1 32 ARG n 1 33 SER n 1 34 ASP n 1 35 SER n 1 36 GLN n 1 37 GLY n 1 38 ARG n 1 39 HIS n 1 40 ILE n 1 41 HIS n 1 42 VAL n 1 43 ILE n 1 44 ASP n 1 45 LEU n 1 46 ASP n 1 47 PRO n 1 48 LYS n 1 49 ALA n 1 50 LEU n 1 51 LEU n 1 52 ARG n 1 53 GLY n 1 54 ASP n 1 55 LEU n 1 56 SER n 1 57 ASN n 1 58 ALA n 1 59 LYS n 1 60 LEU n 1 61 LYS n 1 62 GLU n 1 63 ALA n 1 64 VAL n 1 65 ASP n 1 66 ALA n 1 67 THR n 1 68 CYS n 1 69 ASN n 1 70 ALA n 1 71 ASP n 1 72 GLY n 1 73 LEU n 1 74 ILE n 1 75 VAL n 1 76 ALA n 1 77 THR n 1 78 PRO n 1 79 ILE n 1 80 TYR n 1 81 LYS n 1 82 ALA n 1 83 SER n 1 84 TYR n 1 85 THR n 1 86 GLY n 1 87 LEU n 1 88 LEU n 1 89 LYS n 1 90 ALA n 1 91 PHE n 1 92 LEU n 1 93 ASP n 1 94 ILE n 1 95 LEU n 1 96 PRO n 1 97 GLN n 1 98 PHE n 1 99 ALA n 1 100 LEU n 1 101 ALA n 1 102 GLY n 1 103 LYS n 1 104 ALA n 1 105 ALA n 1 106 LEU n 1 107 PRO n 1 108 LEU n 1 109 ALA n 1 110 THR n 1 111 GLY n 1 112 GLY n 1 113 SER n 1 114 PRO n 1 115 ALA n 1 116 HIS n 1 117 VAL n 1 118 LEU n 1 119 ALA n 1 120 LEU n 1 121 ASP n 1 122 TYR n 1 123 GLY n 1 124 LEU n 1 125 ARG n 1 126 PRO n 1 127 VAL n 1 128 LEU n 1 129 HIS n 1 130 SER n 1 131 MSE n 1 132 GLY n 1 133 VAL n 1 134 ARG n 1 135 HIS n 1 136 VAL n 1 137 VAL n 1 138 GLN n 1 139 SER n 1 140 PHE n 1 141 PHE n 1 142 MSE n 1 143 VAL n 1 144 GLN n 1 145 SER n 1 146 GLN n 1 147 PHE n 1 148 SER n 1 149 VAL n 1 150 VAL n 1 151 ASP n 1 152 GLY n 1 153 LYS n 1 154 LEU n 1 155 ALA n 1 156 VAL n 1 157 GLU n 1 158 ASP n 1 159 ASP n 1 160 VAL n 1 161 ALA n 1 162 SER n 1 163 GLN n 1 164 LEU n 1 165 ASN n 1 166 ASN n 1 167 ALA n 1 168 ILE n 1 169 ASP n 1 170 HIS n 1 171 PHE n 1 172 ARG n 1 173 LEU n 1 174 SER n 1 175 LEU n 1 176 SER n 1 177 SER n 1 178 GLU n 1 179 PRO n 1 180 SER n 1 181 THR n 1 182 ARG n 1 183 HIS n 1 184 LEU n 1 185 GLY n 1 186 HIS n 1 187 PRO n 1 188 ARG n 1 189 PRO n 1 190 SER n 1 191 LEU n 1 192 ASP n 1 193 ALA n 1 194 THR n 1 195 ARG n 1 196 ALA n 1 197 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene emoB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'EDTA-degrading bacterium BNC1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85561 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9F9T2_9PROT _struct_ref.pdbx_db_accession Q9F9T2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIY KASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFLVQSQFSVVDGKLAVEDDV ASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDATRAA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4LTD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 197 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9F9T2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 197 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4LTD _struct_ref_seq_dif.mon_id MSE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 142 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9F9T2 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 142 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 142 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4LTD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.51 _exptl_crystal.density_percent_sol 72.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details ;10 mg/mL EmoB in 20 mM sodium acetate, pH 5, 1 mM EDTA, 1 mM DTT mixed with an equal volume of reservoir solution (0.1 M MES, pH 6.5, 1.6 M ammonium sulfate, 10% dioxane), VAPOR DIFFUSION, HANGING DROP, temperature 277K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2007-12-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double Crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.0332 1.0 2 0.97925 1.0 3 0.97942 1.0 4 0.91162 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '1.0332, 0.97925, 0.97942, 0.91162' # _reflns.entry_id 4LTD _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 24.241 _reflns.d_resolution_high 2.186 _reflns.number_obs 17012 _reflns.number_all 36423 _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.186 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4LTD _refine.ls_number_reflns_obs 17012 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 4.10 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.241 _refine.ls_d_res_high 2.186 _refine.ls_percent_reflns_obs 81.88 _refine.ls_R_factor_obs 0.1708 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1685 _refine.ls_R_factor_R_free 0.1918 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.00 _refine.ls_number_reflns_R_free 1702 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.18 _refine.pdbx_overall_phase_error 15.10 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1404 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 116 _refine_hist.number_atoms_total 1540 _refine_hist.d_res_high 2.186 _refine_hist.d_res_low 24.241 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.009 ? ? 1456 ? 'X-RAY DIFFRACTION' f_angle_d 1.167 ? ? 1981 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 11.744 ? ? 517 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.080 ? ? 232 ? 'X-RAY DIFFRACTION' f_plane_restr 0.005 ? ? 252 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.186 2.2507 903 0.1666 59.0 0.2206 . . 100 . . . . 'X-RAY DIFFRACTION' . 2.2507 2.3233 987 0.1652 66.0 0.1762 . . 110 . . . . 'X-RAY DIFFRACTION' . 2.3233 2.4062 1044 0.1701 68.0 0.2104 . . 116 . . . . 'X-RAY DIFFRACTION' . 2.4062 2.5025 1101 0.1655 72.0 0.1795 . . 122 . . . . 'X-RAY DIFFRACTION' . 2.5025 2.6162 1195 0.1736 78.0 0.1985 . . 133 . . . . 'X-RAY DIFFRACTION' . 2.6162 2.7540 1277 0.1762 83.0 0.1899 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.7540 2.9263 1325 0.1784 86.0 0.1932 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.9263 3.1518 1387 0.1779 89.0 0.2143 . . 154 . . . . 'X-RAY DIFFRACTION' . 3.1518 3.4681 1421 0.1709 91.0 0.1773 . . 158 . . . . 'X-RAY DIFFRACTION' . 3.4681 3.9681 1504 0.1533 95.0 0.1799 . . 168 . . . . 'X-RAY DIFFRACTION' . 3.9681 4.9921 1539 0.1438 96.0 0.1671 . . 170 . . . . 'X-RAY DIFFRACTION' . 4.9921 24.2429 1627 0.1953 95.0 0.2245 . . 182 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4LTD _struct.title 'Crystal structures of NADH:FMN oxidoreductase (EMOB) - apo form' _struct.pdbx_descriptor 'NADH-dependent FMN reductase (E.C.1.5.1.42)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4LTD _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? ALA A 31 ? SER A 16 ALA A 31 1 ? 16 HELX_P HELX_P2 2 ILE A 43 ? LEU A 45 ? ILE A 43 LEU A 45 5 ? 3 HELX_P HELX_P3 3 ASP A 46 ? GLY A 53 ? ASP A 46 GLY A 53 1 ? 8 HELX_P HELX_P4 4 ASN A 57 ? ALA A 70 ? ASN A 57 ALA A 70 1 ? 14 HELX_P HELX_P5 5 THR A 85 ? LEU A 95 ? THR A 85 LEU A 95 1 ? 11 HELX_P HELX_P6 6 SER A 113 ? VAL A 117 ? SER A 113 VAL A 117 5 ? 5 HELX_P HELX_P7 7 LEU A 118 ? GLY A 123 ? LEU A 118 GLY A 123 1 ? 6 HELX_P HELX_P8 8 GLY A 123 ? MSE A 131 ? GLY A 123 MSE A 131 1 ? 9 HELX_P HELX_P9 9 GLU A 157 ? LEU A 175 ? GLU A 157 LEU A 175 1 ? 19 HELX_P HELX_P10 10 GLU A 178 ? ARG A 182 ? GLU A 178 ARG A 182 5 ? 5 HELX_P HELX_P11 11 ARG A 188 ? ASP A 192 ? ARG A 188 ASP A 192 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A SER 130 C ? ? ? 1_555 A MSE 131 N ? ? A SER 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A MSE 131 C ? ? ? 1_555 A GLY 132 N ? ? A MSE 131 A GLY 132 1_555 ? ? ? ? ? ? ? 1.333 ? covale3 covale ? ? A PHE 141 C ? ? ? 1_555 A MSE 142 N ? ? A PHE 141 A MSE 142 1_555 ? ? ? ? ? ? ? 1.327 ? covale4 covale ? ? A MSE 142 C ? ? ? 1_555 A VAL 143 N ? ? A MSE 142 A VAL 143 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 35 ? HIS A 41 ? SER A 35 HIS A 41 A 2 TYR A 3 ? SER A 9 ? TYR A 3 SER A 9 A 3 GLY A 72 ? PRO A 78 ? GLY A 72 PRO A 78 A 4 ALA A 104 ? GLY A 111 ? ALA A 104 GLY A 111 A 5 HIS A 135 ? VAL A 136 ? HIS A 135 VAL A 136 B 1 SER A 35 ? HIS A 41 ? SER A 35 HIS A 41 B 2 TYR A 3 ? SER A 9 ? TYR A 3 SER A 9 B 3 GLY A 72 ? PRO A 78 ? GLY A 72 PRO A 78 B 4 ALA A 104 ? GLY A 111 ? ALA A 104 GLY A 111 B 5 PHE A 140 ? VAL A 143 ? PHE A 140 VAL A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 40 ? O ILE A 40 N ALA A 7 ? N ALA A 7 A 2 3 N ILE A 8 ? N ILE A 8 O ILE A 74 ? O ILE A 74 A 3 4 N VAL A 75 ? N VAL A 75 O LEU A 108 ? O LEU A 108 A 4 5 N ALA A 105 ? N ALA A 105 O HIS A 135 ? O HIS A 135 B 1 2 O ILE A 40 ? O ILE A 40 N ALA A 7 ? N ALA A 7 B 2 3 N ILE A 8 ? N ILE A 8 O ILE A 74 ? O ILE A 74 B 3 4 N VAL A 75 ? N VAL A 75 O LEU A 108 ? O LEU A 108 B 4 5 N PRO A 107 ? N PRO A 107 O PHE A 140 ? O PHE A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PO4 A 201' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 202' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 203' AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SO4 A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 SER A 11 ? SER A 11 . ? 1_555 ? 2 AC1 8 SER A 13 ? SER A 13 . ? 1_555 ? 3 AC1 8 SER A 16 ? SER A 16 . ? 1_555 ? 4 AC1 8 THR A 17 ? THR A 17 . ? 1_555 ? 5 AC1 8 THR A 18 ? THR A 18 . ? 1_555 ? 6 AC1 8 PRO A 78 ? PRO A 78 . ? 1_555 ? 7 AC1 8 GLN A 144 ? GLN A 144 . ? 1_555 ? 8 AC1 8 HOH F . ? HOH A 332 . ? 1_555 ? 9 AC2 6 SER A 162 ? SER A 162 . ? 1_555 ? 10 AC2 6 ASN A 166 ? ASN A 166 . ? 1_555 ? 11 AC2 6 ARG A 188 ? ARG A 188 . ? 11_655 ? 12 AC2 6 PRO A 189 ? PRO A 189 . ? 11_655 ? 13 AC2 6 SER A 190 ? SER A 190 . ? 11_655 ? 14 AC2 6 HOH F . ? HOH A 413 . ? 1_555 ? 15 AC3 5 ASP A 46 ? ASP A 46 . ? 1_555 ? 16 AC3 5 ASN A 57 ? ASN A 57 . ? 1_555 ? 17 AC3 5 LYS A 59 ? LYS A 59 . ? 1_555 ? 18 AC3 5 HOH F . ? HOH A 306 . ? 1_555 ? 19 AC3 5 HOH F . ? HOH A 339 . ? 1_555 ? 20 AC4 1 ARG A 172 ? ARG A 172 . ? 1_555 ? # _database_PDB_matrix.entry_id 4LTD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4LTD _atom_sites.fract_transf_matrix[1][1] 0.009908 _atom_sites.fract_transf_matrix[1][2] 0.005721 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011441 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007715 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 MSE 131 131 131 MSE MSE A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 MSE 142 142 142 MSE MSE A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 VAL 149 149 ? ? ? A . n A 1 150 VAL 150 150 ? ? ? A . n A 1 151 ASP 151 151 ? ? ? A . n A 1 152 GLY 152 152 ? ? ? A . n A 1 153 LYS 153 153 ? ? ? A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 THR 194 194 ? ? ? A . n A 1 195 ARG 195 195 ? ? ? A . n A 1 196 ALA 196 196 ? ? ? A . n A 1 197 ALA 197 197 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 201 500 PO4 PO4 A . C 3 SO4 1 202 2 SO4 SO4 A . D 3 SO4 1 203 4 SO4 SO4 A . E 3 SO4 1 204 5 SO4 SO4 A . F 4 HOH 1 301 1 HOH HOH A . F 4 HOH 2 302 2 HOH HOH A . F 4 HOH 3 303 3 HOH HOH A . F 4 HOH 4 304 4 HOH HOH A . F 4 HOH 5 305 5 HOH HOH A . F 4 HOH 6 306 6 HOH HOH A . F 4 HOH 7 307 7 HOH HOH A . F 4 HOH 8 308 8 HOH HOH A . F 4 HOH 9 309 9 HOH HOH A . F 4 HOH 10 310 10 HOH HOH A . F 4 HOH 11 311 11 HOH HOH A . F 4 HOH 12 312 12 HOH HOH A . F 4 HOH 13 313 13 HOH HOH A . F 4 HOH 14 314 14 HOH HOH A . F 4 HOH 15 315 15 HOH HOH A . F 4 HOH 16 316 16 HOH HOH A . F 4 HOH 17 317 17 HOH HOH A . F 4 HOH 18 318 18 HOH HOH A . F 4 HOH 19 319 19 HOH HOH A . F 4 HOH 20 320 20 HOH HOH A . F 4 HOH 21 321 21 HOH HOH A . F 4 HOH 22 322 22 HOH HOH A . F 4 HOH 23 323 23 HOH HOH A . F 4 HOH 24 324 24 HOH HOH A . F 4 HOH 25 325 25 HOH HOH A . F 4 HOH 26 326 26 HOH HOH A . F 4 HOH 27 327 27 HOH HOH A . F 4 HOH 28 328 28 HOH HOH A . F 4 HOH 29 329 29 HOH HOH A . F 4 HOH 30 330 30 HOH HOH A . F 4 HOH 31 331 31 HOH HOH A . F 4 HOH 32 332 32 HOH HOH A . F 4 HOH 33 333 33 HOH HOH A . F 4 HOH 34 334 34 HOH HOH A . F 4 HOH 35 335 35 HOH HOH A . F 4 HOH 36 336 36 HOH HOH A . F 4 HOH 37 337 37 HOH HOH A . F 4 HOH 38 338 38 HOH HOH A . F 4 HOH 39 339 39 HOH HOH A . F 4 HOH 40 340 40 HOH HOH A . F 4 HOH 41 341 41 HOH HOH A . F 4 HOH 42 342 42 HOH HOH A . F 4 HOH 43 343 43 HOH HOH A . F 4 HOH 44 344 44 HOH HOH A . F 4 HOH 45 345 45 HOH HOH A . F 4 HOH 46 346 46 HOH HOH A . F 4 HOH 47 347 47 HOH HOH A . F 4 HOH 48 348 48 HOH HOH A . F 4 HOH 49 349 49 HOH HOH A . F 4 HOH 50 350 50 HOH HOH A . F 4 HOH 51 351 51 HOH HOH A . F 4 HOH 52 352 52 HOH HOH A . F 4 HOH 53 353 53 HOH HOH A . F 4 HOH 54 354 54 HOH HOH A . F 4 HOH 55 355 55 HOH HOH A . F 4 HOH 56 356 56 HOH HOH A . F 4 HOH 57 357 57 HOH HOH A . F 4 HOH 58 358 58 HOH HOH A . F 4 HOH 59 359 59 HOH HOH A . F 4 HOH 60 360 60 HOH HOH A . F 4 HOH 61 361 61 HOH HOH A . F 4 HOH 62 362 62 HOH HOH A . F 4 HOH 63 363 63 HOH HOH A . F 4 HOH 64 364 64 HOH HOH A . F 4 HOH 65 365 65 HOH HOH A . F 4 HOH 66 366 66 HOH HOH A . F 4 HOH 67 367 67 HOH HOH A . F 4 HOH 68 368 68 HOH HOH A . F 4 HOH 69 369 69 HOH HOH A . F 4 HOH 70 370 70 HOH HOH A . F 4 HOH 71 371 71 HOH HOH A . F 4 HOH 72 372 72 HOH HOH A . F 4 HOH 73 373 73 HOH HOH A . F 4 HOH 74 374 74 HOH HOH A . F 4 HOH 75 375 75 HOH HOH A . F 4 HOH 76 376 76 HOH HOH A . F 4 HOH 77 377 77 HOH HOH A . F 4 HOH 78 378 78 HOH HOH A . F 4 HOH 79 379 79 HOH HOH A . F 4 HOH 80 380 80 HOH HOH A . F 4 HOH 81 381 81 HOH HOH A . F 4 HOH 82 382 82 HOH HOH A . F 4 HOH 83 383 83 HOH HOH A . F 4 HOH 84 384 84 HOH HOH A . F 4 HOH 85 385 85 HOH HOH A . F 4 HOH 86 386 86 HOH HOH A . F 4 HOH 87 387 87 HOH HOH A . F 4 HOH 88 388 88 HOH HOH A . F 4 HOH 89 389 89 HOH HOH A . F 4 HOH 90 390 90 HOH HOH A . F 4 HOH 91 391 91 HOH HOH A . F 4 HOH 92 392 92 HOH HOH A . F 4 HOH 93 393 93 HOH HOH A . F 4 HOH 94 394 94 HOH HOH A . F 4 HOH 95 395 95 HOH HOH A . F 4 HOH 96 396 96 HOH HOH A . F 4 HOH 97 397 97 HOH HOH A . F 4 HOH 98 398 98 HOH HOH A . F 4 HOH 99 399 99 HOH HOH A . F 4 HOH 100 400 100 HOH HOH A . F 4 HOH 101 401 101 HOH HOH A . F 4 HOH 102 402 102 HOH HOH A . F 4 HOH 103 403 103 HOH HOH A . F 4 HOH 104 404 104 HOH HOH A . F 4 HOH 105 405 105 HOH HOH A . F 4 HOH 106 406 106 HOH HOH A . F 4 HOH 107 407 107 HOH HOH A . F 4 HOH 108 408 108 HOH HOH A . F 4 HOH 109 409 109 HOH HOH A . F 4 HOH 110 410 110 HOH HOH A . F 4 HOH 111 411 111 HOH HOH A . F 4 HOH 112 412 112 HOH HOH A . F 4 HOH 113 413 113 HOH HOH A . F 4 HOH 114 414 114 HOH HOH A . F 4 HOH 115 415 115 HOH HOH A . F 4 HOH 116 416 116 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 131 A MSE 131 ? MET SELENOMETHIONINE 2 A MSE 142 A MSE 142 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12510 ? 1 MORE -228 ? 1 'SSA (A^2)' 25970 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 100.9250000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 11_655 -x+y+1,y,-z -1.0000000000 0.0000000000 0.0000000000 100.9250000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 346 ? F HOH . 2 1 A HOH 400 ? F HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-08-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 X-PLOR 'model building' . ? 2 PHENIX refinement '(phenix.refine: 1.8.2_1309)' ? 3 CrystalClear 'data reduction' . ? 4 CrystalClear 'data scaling' . ? 5 X-PLOR phasing . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 363 ? ? O A HOH 368 ? ? 2.07 2 1 O A HOH 359 ? ? O A HOH 366 ? ? 2.11 3 1 O A HOH 372 ? ? O A HOH 377 ? ? 2.14 4 1 O A HOH 371 ? ? O A HOH 411 ? ? 2.16 5 1 O A ASP 121 ? ? O A HOH 316 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 318 ? ? 1_555 O A HOH 318 ? ? 11_655 1.89 2 1 O A HOH 316 ? ? 1_555 O A HOH 316 ? ? 11_655 1.90 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 146 ? ? -156.57 -31.28 2 1 GLU A 178 ? ? -33.09 125.05 3 1 LEU A 191 ? ? -89.80 38.50 4 1 ASP A 192 ? ? 72.74 -139.89 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A VAL 149 ? A VAL 149 3 1 Y 1 A VAL 150 ? A VAL 150 4 1 Y 1 A ASP 151 ? A ASP 151 5 1 Y 1 A GLY 152 ? A GLY 152 6 1 Y 1 A LYS 153 ? A LYS 153 7 1 Y 1 A THR 194 ? A THR 194 8 1 Y 1 A ARG 195 ? A ARG 195 9 1 Y 1 A ALA 196 ? A ALA 196 10 1 Y 1 A ALA 197 ? A ALA 197 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 'SULFATE ION' SO4 4 water HOH #