data_4LU2 # _entry.id 4LU2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4LU2 RCSB RCSB081086 WWPDB D_1000081086 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2016-07-27 _pdbx_database_PDB_obs_spr.pdb_id 5KX4 _pdbx_database_PDB_obs_spr.replace_pdb_id 4LU2 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 4LU2 _pdbx_database_status.recvd_initial_deposition_date 2013-07-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Asojo, O.A.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal Structure of LJM19' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Asojo, O.A.' _citation_author.ordinal 1 # _cell.entry_id 4LU2 _cell.length_a 65.280 _cell.length_b 65.280 _cell.length_c 39.310 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4LU2 _symmetry.space_group_name_H-M 'P 42' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 77 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '10.7 kDa salivary protein' 11924.151 2 ? ? ? ? 2 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EFSEDCENIFHDNAYLLKLDCEAGRVDPVEYDDISDEEIYEITVDVGVSSEDQEKVAKIIRECIAQVSTQDCTKFSEIYD CYMKKKICNYYPENMHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;EFSEDCENIFHDNAYLLKLDCEAGRVDPVEYDDISDEEIYEITVDVGVSSEDQEKVAKIIRECIAQVSTQDCTKFSEIYD CYMKKKICNYYPENMHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PHE n 1 3 SER n 1 4 GLU n 1 5 ASP n 1 6 CYS n 1 7 GLU n 1 8 ASN n 1 9 ILE n 1 10 PHE n 1 11 HIS n 1 12 ASP n 1 13 ASN n 1 14 ALA n 1 15 TYR n 1 16 LEU n 1 17 LEU n 1 18 LYS n 1 19 LEU n 1 20 ASP n 1 21 CYS n 1 22 GLU n 1 23 ALA n 1 24 GLY n 1 25 ARG n 1 26 VAL n 1 27 ASP n 1 28 PRO n 1 29 VAL n 1 30 GLU n 1 31 TYR n 1 32 ASP n 1 33 ASP n 1 34 ILE n 1 35 SER n 1 36 ASP n 1 37 GLU n 1 38 GLU n 1 39 ILE n 1 40 TYR n 1 41 GLU n 1 42 ILE n 1 43 THR n 1 44 VAL n 1 45 ASP n 1 46 VAL n 1 47 GLY n 1 48 VAL n 1 49 SER n 1 50 SER n 1 51 GLU n 1 52 ASP n 1 53 GLN n 1 54 GLU n 1 55 LYS n 1 56 VAL n 1 57 ALA n 1 58 LYS n 1 59 ILE n 1 60 ILE n 1 61 ARG n 1 62 GLU n 1 63 CYS n 1 64 ILE n 1 65 ALA n 1 66 GLN n 1 67 VAL n 1 68 SER n 1 69 THR n 1 70 GLN n 1 71 ASP n 1 72 CYS n 1 73 THR n 1 74 LYS n 1 75 PHE n 1 76 SER n 1 77 GLU n 1 78 ILE n 1 79 TYR n 1 80 ASP n 1 81 CYS n 1 82 TYR n 1 83 MET n 1 84 LYS n 1 85 LYS n 1 86 LYS n 1 87 ILE n 1 88 CYS n 1 89 ASN n 1 90 TYR n 1 91 TYR n 1 92 PRO n 1 93 GLU n 1 94 ASN n 1 95 MET n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Sand fly' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lutzomyia longipalpis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7200 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPicZalpha _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5WPZ4_LUTLO _struct_ref.pdbx_db_accession Q5WPZ4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SEDCENIFHDNAYLLKLDCEAGRVDPVEYDDISDEEIYEITVDVGVSSEDQEKVAKIIRECIAQVSTQDCTKFSEIYDCY MKKKICNYYPENM ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4LU2 A 3 ? 95 ? Q5WPZ4 23 ? 115 ? 3 95 2 1 4LU2 B 3 ? 95 ? Q5WPZ4 23 ? 115 ? 3 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4LU2 GLU A 1 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 1 1 1 4LU2 PHE A 2 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 2 2 1 4LU2 HIS A 96 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 96 3 1 4LU2 HIS A 97 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 97 4 1 4LU2 HIS A 98 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 98 5 1 4LU2 HIS A 99 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 99 6 1 4LU2 HIS A 100 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 100 7 1 4LU2 HIS A 101 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 101 8 2 4LU2 GLU B 1 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 1 9 2 4LU2 PHE B 2 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 2 10 2 4LU2 HIS B 96 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 96 11 2 4LU2 HIS B 97 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 97 12 2 4LU2 HIS B 98 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 98 13 2 4LU2 HIS B 99 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 99 14 2 4LU2 HIS B 100 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 100 15 2 4LU2 HIS B 101 ? UNP Q5WPZ4 ? ? 'EXPRESSION TAG' 101 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4LU2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.76 _exptl_crystal.density_percent_sol 29.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.02M Calcium chloride, 30% v/v MPD and 0.1 M calcium chloride, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS HTC' _diffrn_detector.pdbx_collection_date 2012-12-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4LU2 _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 23.44 _reflns.d_resolution_high 1.94 _reflns.number_obs 12456 _reflns.number_all 12456 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.9 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 2.04 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.513 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4LU2 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 11722 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 23.44 _refine.ls_d_res_high 1.94 _refine.ls_percent_reflns_obs 99.45 _refine.ls_R_factor_obs 0.17054 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.16829 _refine.ls_R_factor_R_free 0.20888 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.5 _refine.ls_number_reflns_R_free 684 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.948 _refine.B_iso_mean 34.844 _refine.aniso_B[1][1] -4.39 _refine.aniso_B[2][2] -4.39 _refine.aniso_B[3][3] 8.78 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.038 _refine.pdbx_overall_ESU_R_Free 0.032 _refine.overall_SU_ML 0.075 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.402 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1559 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1583 _refine_hist.d_res_high 1.94 _refine_hist.d_res_low 23.44 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.023 0.019 ? 1590 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.226 1.959 ? 2150 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.121 5.000 ? 190 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.802 26.517 ? 89 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 20.262 15.000 ? 289 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.571 15.000 ? 4 'X-RAY DIFFRACTION' ? r_chiral_restr 0.151 0.200 ? 232 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.012 0.020 ? 1216 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 3.936 3.307 ? 766 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 4.913 4.928 ? 954 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 4.718 3.586 ? 822 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined 10.395 30.365 ? 1277 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.940 _refine_ls_shell.d_res_low 1.990 _refine_ls_shell.number_reflns_R_work 876 _refine_ls_shell.R_factor_R_work 0.253 _refine_ls_shell.percent_reflns_obs 98.91 _refine_ls_shell.R_factor_R_free 0.333 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 35 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 4LU2 _struct.title 'Structure of ljm19' _struct.pdbx_descriptor '10.7 kDa salivary protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4LU2 _struct_keywords.pdbx_keywords 'odorant-binding protein' _struct_keywords.text 'all alpha protein class, EF hand-like fold, salivary protein, odorant-binding protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? ALA A 23 ? SER A 3 ALA A 23 1 ? 21 HELX_P HELX_P2 2 ASP A 27 ? ASP A 32 ? ASP A 27 ASP A 32 5 ? 6 HELX_P HELX_P3 3 SER A 35 ? THR A 43 ? SER A 35 THR A 43 1 ? 9 HELX_P HELX_P4 4 VAL A 44 ? GLY A 47 ? VAL A 44 GLY A 47 5 ? 4 HELX_P HELX_P5 5 ASP A 52 ? VAL A 67 ? ASP A 52 VAL A 67 1 ? 16 HELX_P HELX_P6 6 THR A 73 ? LYS A 85 ? THR A 73 LYS A 85 1 ? 13 HELX_P HELX_P7 7 LYS A 86 ? TYR A 91 ? LYS A 86 TYR A 91 5 ? 6 HELX_P HELX_P8 8 SER B 3 ? ALA B 23 ? SER B 3 ALA B 23 1 ? 21 HELX_P HELX_P9 9 ASP B 27 ? ASP B 32 ? ASP B 27 ASP B 32 5 ? 6 HELX_P HELX_P10 10 SER B 35 ? THR B 43 ? SER B 35 THR B 43 1 ? 9 HELX_P HELX_P11 11 VAL B 44 ? GLY B 47 ? VAL B 44 GLY B 47 5 ? 4 HELX_P HELX_P12 12 SER B 49 ? GLU B 51 ? SER B 49 GLU B 51 5 ? 3 HELX_P HELX_P13 13 ASP B 52 ? VAL B 67 ? ASP B 52 VAL B 67 1 ? 16 HELX_P HELX_P14 14 THR B 73 ? LYS B 85 ? THR B 73 LYS B 85 1 ? 13 HELX_P HELX_P15 15 LYS B 86 ? TYR B 91 ? LYS B 86 TYR B 91 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 72 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 72 A CYS 21 1_555 ? ? ? ? ? ? ? 1.405 ? disulf2 disulf ? ? A CYS 81 SG ? ? ? 1_555 A CYS 63 SG ? ? A CYS 81 A CYS 63 1_555 ? ? ? ? ? ? ? 1.688 ? disulf3 disulf ? ? A CYS 88 SG ? ? ? 1_555 A CYS 6 SG ? ? A CYS 88 A CYS 6 1_555 ? ? ? ? ? ? ? 1.888 ? disulf4 disulf ? ? B CYS 72 SG ? ? ? 1_555 B CYS 21 SG ? ? B CYS 72 B CYS 21 1_555 ? ? ? ? ? ? ? 1.803 ? disulf5 disulf ? ? B CYS 81 SG ? ? ? 1_555 B CYS 63 SG ? ? B CYS 81 B CYS 63 1_555 ? ? ? ? ? ? ? 1.998 ? disulf6 disulf ? ? B CYS 88 SG ? ? ? 1_555 B CYS 6 SG ? ? B CYS 88 B CYS 6 1_555 ? ? ? ? ? ? ? 1.653 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 4LU2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4LU2 _atom_sites.fract_transf_matrix[1][1] 0.015319 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015319 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025439 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n B 1 1 GLU 1 1 1 GLU GLU B . n B 1 2 PHE 2 2 2 PHE PHE B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 GLU 4 4 4 GLU GLU B . n B 1 5 ASP 5 5 5 ASP ASP B . n B 1 6 CYS 6 6 6 CYS CYS B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 ASN 8 8 8 ASN ASN B . n B 1 9 ILE 9 9 9 ILE ILE B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 HIS 11 11 11 HIS HIS B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 ASN 13 13 13 ASN ASN B . n B 1 14 ALA 14 14 14 ALA ALA B . n B 1 15 TYR 15 15 15 TYR TYR B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 ASP 20 20 20 ASP ASP B . n B 1 21 CYS 21 21 21 CYS CYS B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 GLY 24 24 24 GLY GLY B . n B 1 25 ARG 25 25 25 ARG ARG B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 TYR 31 31 31 TYR TYR B . n B 1 32 ASP 32 32 32 ASP ASP B . n B 1 33 ASP 33 33 33 ASP ASP B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 ILE 39 39 39 ILE ILE B . n B 1 40 TYR 40 40 40 TYR TYR B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 THR 43 43 43 THR THR B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 VAL 46 46 46 VAL VAL B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 VAL 48 48 48 VAL VAL B . n B 1 49 SER 49 49 49 SER SER B . n B 1 50 SER 50 50 50 SER SER B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 ASP 52 52 52 ASP ASP B . n B 1 53 GLN 53 53 53 GLN GLN B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 ARG 61 61 61 ARG ARG B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 CYS 63 63 63 CYS CYS B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 GLN 66 66 66 GLN GLN B . n B 1 67 VAL 67 67 67 VAL VAL B . n B 1 68 SER 68 68 68 SER SER B . n B 1 69 THR 69 69 69 THR THR B . n B 1 70 GLN 70 70 70 GLN GLN B . n B 1 71 ASP 71 71 71 ASP ASP B . n B 1 72 CYS 72 72 72 CYS CYS B . n B 1 73 THR 73 73 73 THR THR B . n B 1 74 LYS 74 74 74 LYS LYS B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 SER 76 76 76 SER SER B . n B 1 77 GLU 77 77 77 GLU GLU B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 TYR 79 79 79 TYR TYR B . n B 1 80 ASP 80 80 80 ASP ASP B . n B 1 81 CYS 81 81 81 CYS CYS B . n B 1 82 TYR 82 82 82 TYR TYR B . n B 1 83 MET 83 83 83 MET MET B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 LYS 85 85 85 LYS LYS B . n B 1 86 LYS 86 86 86 LYS LYS B . n B 1 87 ILE 87 87 87 ILE ILE B . n B 1 88 CYS 88 88 88 CYS CYS B . n B 1 89 ASN 89 89 89 ASN ASN B . n B 1 90 TYR 90 90 90 TYR TYR B . n B 1 91 TYR 91 91 91 TYR TYR B . n B 1 92 PRO 92 92 92 PRO PRO B . n B 1 93 GLU 93 93 93 GLU GLU B . n B 1 94 ASN 94 94 94 ASN ASN B . n B 1 95 MET 95 95 95 MET MET B . n B 1 96 HIS 96 96 96 HIS HIS B . n B 1 97 HIS 97 97 ? ? ? B . n B 1 98 HIS 98 98 ? ? ? B . n B 1 99 HIS 99 99 ? ? ? B . n B 1 100 HIS 100 100 ? ? ? B . n B 1 101 HIS 101 101 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 201 201 HOH HOH A . C 2 HOH 2 202 202 HOH HOH A . C 2 HOH 3 203 203 HOH HOH A . C 2 HOH 4 204 204 HOH HOH A . C 2 HOH 5 205 205 HOH HOH A . C 2 HOH 6 206 206 HOH HOH A . C 2 HOH 7 207 207 HOH HOH A . C 2 HOH 8 208 208 HOH HOH A . C 2 HOH 9 209 209 HOH HOH A . C 2 HOH 10 210 210 HOH HOH A . C 2 HOH 11 211 211 HOH HOH A . C 2 HOH 12 212 212 HOH HOH A . D 2 HOH 1 201 201 HOH HOH B . D 2 HOH 2 202 202 HOH HOH B . D 2 HOH 3 203 203 HOH HOH B . D 2 HOH 4 204 204 HOH HOH B . D 2 HOH 5 205 205 HOH HOH B . D 2 HOH 6 206 206 HOH HOH B . D 2 HOH 7 207 207 HOH HOH B . D 2 HOH 8 208 208 HOH HOH B . D 2 HOH 9 209 209 HOH HOH B . D 2 HOH 10 210 210 HOH HOH B . D 2 HOH 11 211 211 HOH HOH B . D 2 HOH 12 212 212 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1880 ? 1 MORE -4 ? 1 'SSA (A^2)' 9770 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-02-04 2 'Structure model' 1 1 2016-07-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group Other # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrystalClear 'data collection' . ? 1 SHELXS 'model building' . ? 2 REFMAC refinement 5.7.0032 ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 SHELXS phasing . ? 6 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 50 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 85 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_655 _pdbx_validate_symm_contact.dist 2.18 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 93 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 93 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.183 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation -0.069 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 124.71 118.30 6.41 0.90 N 2 1 CA A CYS 81 ? ? CB A CYS 81 ? ? SG A CYS 81 ? ? 122.43 114.20 8.23 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 43 ? ? -117.66 -84.90 2 1 GLU B 30 ? ? -59.12 -4.79 3 1 THR B 43 ? ? -120.77 -78.55 4 1 ASN B 94 ? ? 39.25 92.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 96 ? CG ? A HIS 96 CG 2 1 Y 1 A HIS 96 ? ND1 ? A HIS 96 ND1 3 1 Y 1 A HIS 96 ? CD2 ? A HIS 96 CD2 4 1 Y 1 A HIS 96 ? CE1 ? A HIS 96 CE1 5 1 Y 1 A HIS 96 ? NE2 ? A HIS 96 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 97 ? A HIS 97 2 1 Y 1 A HIS 98 ? A HIS 98 3 1 Y 1 A HIS 99 ? A HIS 99 4 1 Y 1 A HIS 100 ? A HIS 100 5 1 Y 1 A HIS 101 ? A HIS 101 6 1 Y 1 B HIS 97 ? B HIS 97 7 1 Y 1 B HIS 98 ? B HIS 98 8 1 Y 1 B HIS 99 ? B HIS 99 9 1 Y 1 B HIS 100 ? B HIS 100 10 1 Y 1 B HIS 101 ? B HIS 101 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #