data_4N12 # _entry.id 4N12 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4N12 RCSB RCSB082617 WWPDB D_1000082617 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4MNT 'Crystal structure of human DJ1 in complex with Cu' unspecified PDB 4N0M . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4N12 _pdbx_database_status.recvd_initial_deposition_date 2013-10-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cendron, L.' 1 'Girotto, S.' 2 'Bisaglia, M.' 3 'Tessari, I.' 4 'Mammi, S.' 5 'Zanotti, G.' 6 'Bubacco, L.' 7 # _citation.id primary _citation.title 'DJ-1 Is a Copper Chaperone Acting on SOD1 Activation.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 289 _citation.page_first 10887 _citation.page_last 10899 _citation.year 2014 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24567322 _citation.pdbx_database_id_DOI 10.1074/jbc.M113.535112 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Girotto, S.' 1 primary 'Cendron, L.' 2 primary 'Bisaglia, M.' 3 primary 'Tessari, I.' 4 primary 'Mammi, S.' 5 primary 'Zanotti, G.' 6 primary 'Bubacco, L.' 7 # _cell.entry_id 4N12 _cell.length_a 75.110 _cell.length_b 75.110 _cell.length_c 75.350 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4N12 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein DJ-1' 19935.025 1 3.4.-.- E18D ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 169 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Oncogene DJ1, Parkinson disease protein 7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MASKRALVILAKGAEEMDTVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ NLSESAAVKEILKEQENRKGLIAAI(CSD)AGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR GPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD ; _entity_poly.pdbx_seq_one_letter_code_can ;MASKRALVILAKGAEEMDTVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT SFEFALAIVEALNGKEVAAQVKAPLVLKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 LYS n 1 5 ARG n 1 6 ALA n 1 7 LEU n 1 8 VAL n 1 9 ILE n 1 10 LEU n 1 11 ALA n 1 12 LYS n 1 13 GLY n 1 14 ALA n 1 15 GLU n 1 16 GLU n 1 17 MET n 1 18 ASP n 1 19 THR n 1 20 VAL n 1 21 ILE n 1 22 PRO n 1 23 VAL n 1 24 ASP n 1 25 VAL n 1 26 MET n 1 27 ARG n 1 28 ARG n 1 29 ALA n 1 30 GLY n 1 31 ILE n 1 32 LYS n 1 33 VAL n 1 34 THR n 1 35 VAL n 1 36 ALA n 1 37 GLY n 1 38 LEU n 1 39 ALA n 1 40 GLY n 1 41 LYS n 1 42 ASP n 1 43 PRO n 1 44 VAL n 1 45 GLN n 1 46 CYS n 1 47 SER n 1 48 ARG n 1 49 ASP n 1 50 VAL n 1 51 VAL n 1 52 ILE n 1 53 CYS n 1 54 PRO n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 LEU n 1 59 GLU n 1 60 ASP n 1 61 ALA n 1 62 LYS n 1 63 LYS n 1 64 GLU n 1 65 GLY n 1 66 PRO n 1 67 TYR n 1 68 ASP n 1 69 VAL n 1 70 VAL n 1 71 VAL n 1 72 LEU n 1 73 PRO n 1 74 GLY n 1 75 GLY n 1 76 ASN n 1 77 LEU n 1 78 GLY n 1 79 ALA n 1 80 GLN n 1 81 ASN n 1 82 LEU n 1 83 SER n 1 84 GLU n 1 85 SER n 1 86 ALA n 1 87 ALA n 1 88 VAL n 1 89 LYS n 1 90 GLU n 1 91 ILE n 1 92 LEU n 1 93 LYS n 1 94 GLU n 1 95 GLN n 1 96 GLU n 1 97 ASN n 1 98 ARG n 1 99 LYS n 1 100 GLY n 1 101 LEU n 1 102 ILE n 1 103 ALA n 1 104 ALA n 1 105 ILE n 1 106 CSD n 1 107 ALA n 1 108 GLY n 1 109 PRO n 1 110 THR n 1 111 ALA n 1 112 LEU n 1 113 LEU n 1 114 ALA n 1 115 HIS n 1 116 GLU n 1 117 ILE n 1 118 GLY n 1 119 PHE n 1 120 GLY n 1 121 SER n 1 122 LYS n 1 123 VAL n 1 124 THR n 1 125 THR n 1 126 HIS n 1 127 PRO n 1 128 LEU n 1 129 ALA n 1 130 LYS n 1 131 ASP n 1 132 LYS n 1 133 MET n 1 134 MET n 1 135 ASN n 1 136 GLY n 1 137 GLY n 1 138 HIS n 1 139 TYR n 1 140 THR n 1 141 TYR n 1 142 SER n 1 143 GLU n 1 144 ASN n 1 145 ARG n 1 146 VAL n 1 147 GLU n 1 148 LYS n 1 149 ASP n 1 150 GLY n 1 151 LEU n 1 152 ILE n 1 153 LEU n 1 154 THR n 1 155 SER n 1 156 ARG n 1 157 GLY n 1 158 PRO n 1 159 GLY n 1 160 THR n 1 161 SER n 1 162 PHE n 1 163 GLU n 1 164 PHE n 1 165 ALA n 1 166 LEU n 1 167 ALA n 1 168 ILE n 1 169 VAL n 1 170 GLU n 1 171 ALA n 1 172 LEU n 1 173 ASN n 1 174 GLY n 1 175 LYS n 1 176 GLU n 1 177 VAL n 1 178 ALA n 1 179 ALA n 1 180 GLN n 1 181 VAL n 1 182 LYS n 1 183 ALA n 1 184 PRO n 1 185 LEU n 1 186 VAL n 1 187 LEU n 1 188 LYS n 1 189 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PARK7 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PARK7_HUMAN _struct_ref.pdbx_db_accession Q99497 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGT SFEFALAIVEALNGKEVAAQVKAPLVLKD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4N12 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99497 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 189 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4N12 _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 18 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q99497 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 18 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 18 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSD 'L-peptide linking' n 3-SULFINOALANINE 'S-CYSTEINESULFINIC ACID; S-SULFINOCYSTEINE' 'C3 H7 N O4 S' 153.157 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4N12 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.08 _exptl_crystal.density_percent_sol 60.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium Malonate and 20% w/v PEG 3350, pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 293K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-06-11 _diffrn_detector.details 'Si(111) with Toroidal focusing mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'channel cut ESRF monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.3702 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.3702 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4N12 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 29.86 _reflns.d_resolution_high 1.478 _reflns.number_obs 41496 _reflns.number_all 41496 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.478 _reflns_shell.d_res_low 1.56 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.185 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4N12 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 41459 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.86 _refine.ls_d_res_high 1.478 _refine.ls_percent_reflns_obs 99.82 _refine.ls_R_factor_obs 0.1644 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1639 _refine.ls_R_factor_R_free 0.1742 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.02 _refine.ls_number_reflns_R_free 2082 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.10 _refine.pdbx_overall_phase_error 15.56 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1376 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 169 _refine_hist.number_atoms_total 1550 _refine_hist.d_res_high 1.478 _refine_hist.d_res_low 29.86 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.006 ? ? 1433 'X-RAY DIFFRACTION' ? f_angle_d 1.163 ? ? 1941 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 12.639 ? ? 554 'X-RAY DIFFRACTION' ? f_chiral_restr 0.072 ? ? 231 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 251 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.4780 1.5124 2592 0.1727 100.00 0.2109 . . 125 . . . . 'X-RAY DIFFRACTION' . 1.5124 1.5503 2602 0.1627 100.00 0.1728 . . 119 . . . . 'X-RAY DIFFRACTION' . 1.5503 1.5922 2581 0.1555 100.00 0.1770 . . 154 . . . . 'X-RAY DIFFRACTION' . 1.5922 1.6390 2618 0.1551 100.00 0.1500 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.6390 1.6919 2593 0.1567 100.00 0.1732 . . 135 . . . . 'X-RAY DIFFRACTION' . 1.6919 1.7524 2599 0.1546 100.00 0.1966 . . 146 . . . . 'X-RAY DIFFRACTION' . 1.7524 1.8225 2597 0.1633 100.00 0.1954 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.8225 1.9055 2634 0.1596 100.00 0.1886 . . 130 . . . . 'X-RAY DIFFRACTION' . 1.9055 2.0059 2617 0.1613 100.00 0.1930 . . 157 . . . . 'X-RAY DIFFRACTION' . 2.0059 2.1315 2608 0.1598 100.00 0.1645 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.1315 2.2961 2611 0.1591 100.00 0.1517 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.2961 2.5270 2637 0.1701 100.00 0.1861 . . 150 . . . . 'X-RAY DIFFRACTION' . 2.5270 2.8924 2661 0.1768 100.00 0.1923 . . 148 . . . . 'X-RAY DIFFRACTION' . 2.8924 3.6431 2680 0.1757 100.00 0.1713 . . 128 . . . . 'X-RAY DIFFRACTION' . 3.6431 29.86 2747 0.1549 98.00 0.1534 . . 122 . . . . # _struct.entry_id 4N12 _struct.title 'Crystal structure of human E18D DJ-1 in complex with Cu' _struct.pdbx_descriptor 'Protein DJ-1 (E.C.3.4.-.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4N12 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Alpha/beta structure, chaperone, oxidative stress protection, cytosol, nucleus, mitochondria, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 15 ? ALA A 29 ? GLU A 15 ALA A 29 1 ? 15 HELX_P HELX_P2 2 LEU A 58 ? LYS A 62 ? LEU A 58 LYS A 62 1 ? 5 HELX_P HELX_P3 3 LYS A 63 ? GLY A 65 ? LYS A 63 GLY A 65 5 ? 3 HELX_P HELX_P4 4 GLY A 75 ? SER A 85 ? GLY A 75 SER A 85 1 ? 11 HELX_P HELX_P5 5 SER A 85 ? ARG A 98 ? SER A 85 ARG A 98 1 ? 14 HELX_P HELX_P6 6 PRO A 109 ? HIS A 115 ? PRO A 109 HIS A 115 1 ? 7 HELX_P HELX_P7 7 HIS A 126 ? LEU A 128 ? HIS A 126 LEU A 128 5 ? 3 HELX_P HELX_P8 8 ALA A 129 ? MET A 134 ? ALA A 129 MET A 134 1 ? 6 HELX_P HELX_P9 9 GLY A 157 ? GLY A 159 ? GLY A 157 GLY A 159 5 ? 3 HELX_P HELX_P10 10 THR A 160 ? GLY A 174 ? THR A 160 GLY A 174 1 ? 15 HELX_P HELX_P11 11 GLY A 174 ? ALA A 183 ? GLY A 174 ALA A 183 1 ? 10 HELX_P HELX_P12 12 PRO A 184 ? VAL A 186 ? PRO A 184 VAL A 186 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ILE 105 C ? ? ? 1_555 A CSD 106 N ? ? A ILE 105 A CSD 106 1_555 ? ? ? ? ? ? ? 1.344 ? covale2 covale ? ? A CSD 106 C ? ? ? 1_555 A ALA 107 N ? ? A CSD 106 A ALA 107 1_555 ? ? ? ? ? ? ? 1.317 ? metalc1 metalc ? ? A CYS 53 SG ? ? ? 1_555 B CU . CU ? ? A CYS 53 A CU 201 1_555 ? ? ? ? ? ? ? 2.082 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 65 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 65 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 66 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 66 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.77 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 56 ? SER A 57 ? ALA A 56 SER A 57 A 2 LYS A 32 ? GLY A 37 ? LYS A 32 GLY A 37 A 3 ARG A 5 ? LEU A 10 ? ARG A 5 LEU A 10 A 4 VAL A 69 ? LEU A 72 ? VAL A 69 LEU A 72 A 5 LEU A 101 ? ILE A 105 ? LEU A 101 ILE A 105 A 6 ILE A 152 ? SER A 155 ? ILE A 152 SER A 155 A 7 VAL A 146 ? ASP A 149 ? VAL A 146 ASP A 149 B 1 VAL A 44 ? GLN A 45 ? VAL A 44 GLN A 45 B 2 VAL A 51 ? ILE A 52 ? VAL A 51 ILE A 52 C 1 LYS A 122 ? VAL A 123 ? LYS A 122 VAL A 123 C 2 THR A 140 ? TYR A 141 ? THR A 140 TYR A 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 56 ? O ALA A 56 N GLY A 37 ? N GLY A 37 A 2 3 O ALA A 36 ? O ALA A 36 N LEU A 10 ? N LEU A 10 A 3 4 N LEU A 7 ? N LEU A 7 O VAL A 71 ? O VAL A 71 A 4 5 N LEU A 72 ? N LEU A 72 O ALA A 103 ? O ALA A 103 A 5 6 N ILE A 102 ? N ILE A 102 O LEU A 153 ? O LEU A 153 A 6 7 O THR A 154 ? O THR A 154 N GLU A 147 ? N GLU A 147 B 1 2 N VAL A 44 ? N VAL A 44 O ILE A 52 ? O ILE A 52 C 1 2 N VAL A 123 ? N VAL A 123 O THR A 140 ? O THR A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CU A 201' AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE EDO A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 53 ? CYS A 53 . ? 6_554 ? 2 AC1 2 CYS A 53 ? CYS A 53 . ? 1_555 ? 3 AC2 9 GLU A 15 ? GLU A 15 . ? 1_555 ? 4 AC2 9 ARG A 28 ? ARG A 28 . ? 6_554 ? 5 AC2 9 ARG A 48 ? ARG A 48 . ? 1_555 ? 6 AC2 9 CSD A 106 ? CSD A 106 . ? 1_555 ? 7 AC2 9 HIS A 126 ? HIS A 126 . ? 1_555 ? 8 AC2 9 PRO A 158 ? PRO A 158 . ? 1_555 ? 9 AC2 9 PRO A 184 ? PRO A 184 . ? 6_554 ? 10 AC2 9 HOH D . ? HOH A 318 . ? 3_654 ? 11 AC2 9 HOH D . ? HOH A 453 . ? 1_555 ? # _database_PDB_matrix.entry_id 4N12 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4N12 _atom_sites.fract_transf_matrix[1][1] 0.013314 _atom_sites.fract_transf_matrix[1][2] 0.007687 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015373 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013271 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 CSD 106 106 106 CSD CSD A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 ASP 189 189 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 201 1 CU CU A . C 3 EDO 1 202 1 EDO EDO A . D 4 HOH 1 301 1 HOH HOH A . D 4 HOH 2 302 2 HOH HOH A . D 4 HOH 3 303 3 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 5 HOH HOH A . D 4 HOH 6 306 6 HOH HOH A . D 4 HOH 7 307 7 HOH HOH A . D 4 HOH 8 308 8 HOH HOH A . D 4 HOH 9 309 9 HOH HOH A . D 4 HOH 10 310 10 HOH HOH A . D 4 HOH 11 311 11 HOH HOH A . D 4 HOH 12 312 12 HOH HOH A . D 4 HOH 13 313 13 HOH HOH A . D 4 HOH 14 314 14 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . D 4 HOH 16 316 16 HOH HOH A . D 4 HOH 17 317 17 HOH HOH A . D 4 HOH 18 318 18 HOH HOH A . D 4 HOH 19 319 19 HOH HOH A . D 4 HOH 20 320 20 HOH HOH A . D 4 HOH 21 321 21 HOH HOH A . D 4 HOH 22 322 22 HOH HOH A . D 4 HOH 23 323 23 HOH HOH A . D 4 HOH 24 324 24 HOH HOH A . D 4 HOH 25 325 25 HOH HOH A . D 4 HOH 26 326 26 HOH HOH A . D 4 HOH 27 327 27 HOH HOH A . D 4 HOH 28 328 28 HOH HOH A . D 4 HOH 29 329 29 HOH HOH A . D 4 HOH 30 330 30 HOH HOH A . D 4 HOH 31 331 31 HOH HOH A . D 4 HOH 32 332 32 HOH HOH A . D 4 HOH 33 333 33 HOH HOH A . D 4 HOH 34 334 34 HOH HOH A . D 4 HOH 35 335 35 HOH HOH A . D 4 HOH 36 336 36 HOH HOH A . D 4 HOH 37 337 37 HOH HOH A . D 4 HOH 38 338 38 HOH HOH A . D 4 HOH 39 339 39 HOH HOH A . D 4 HOH 40 340 40 HOH HOH A . D 4 HOH 41 341 41 HOH HOH A . D 4 HOH 42 342 42 HOH HOH A . D 4 HOH 43 343 43 HOH HOH A . D 4 HOH 44 344 44 HOH HOH A . D 4 HOH 45 345 45 HOH HOH A . D 4 HOH 46 346 46 HOH HOH A . D 4 HOH 47 347 47 HOH HOH A . D 4 HOH 48 348 48 HOH HOH A . D 4 HOH 49 349 49 HOH HOH A . D 4 HOH 50 350 50 HOH HOH A . D 4 HOH 51 351 51 HOH HOH A . D 4 HOH 52 352 52 HOH HOH A . D 4 HOH 53 353 53 HOH HOH A . D 4 HOH 54 354 54 HOH HOH A . D 4 HOH 55 355 55 HOH HOH A . D 4 HOH 56 356 56 HOH HOH A . D 4 HOH 57 357 57 HOH HOH A . D 4 HOH 58 358 58 HOH HOH A . D 4 HOH 59 359 59 HOH HOH A . D 4 HOH 60 360 60 HOH HOH A . D 4 HOH 61 361 61 HOH HOH A . D 4 HOH 62 362 62 HOH HOH A . D 4 HOH 63 363 63 HOH HOH A . D 4 HOH 64 364 64 HOH HOH A . D 4 HOH 65 365 65 HOH HOH A . D 4 HOH 66 366 66 HOH HOH A . D 4 HOH 67 367 67 HOH HOH A . D 4 HOH 68 368 68 HOH HOH A . D 4 HOH 69 369 69 HOH HOH A . D 4 HOH 70 370 70 HOH HOH A . D 4 HOH 71 371 71 HOH HOH A . D 4 HOH 72 372 72 HOH HOH A . D 4 HOH 73 373 73 HOH HOH A . D 4 HOH 74 374 74 HOH HOH A . D 4 HOH 75 375 75 HOH HOH A . D 4 HOH 76 376 76 HOH HOH A . D 4 HOH 77 377 77 HOH HOH A . D 4 HOH 78 378 78 HOH HOH A . D 4 HOH 79 379 79 HOH HOH A . D 4 HOH 80 380 80 HOH HOH A . D 4 HOH 81 381 81 HOH HOH A . D 4 HOH 82 382 82 HOH HOH A . D 4 HOH 83 383 83 HOH HOH A . D 4 HOH 84 384 84 HOH HOH A . D 4 HOH 85 385 85 HOH HOH A . D 4 HOH 86 386 86 HOH HOH A . D 4 HOH 87 387 87 HOH HOH A . D 4 HOH 88 388 88 HOH HOH A . D 4 HOH 89 389 89 HOH HOH A . D 4 HOH 90 390 90 HOH HOH A . D 4 HOH 91 391 91 HOH HOH A . D 4 HOH 92 392 92 HOH HOH A . D 4 HOH 93 393 93 HOH HOH A . D 4 HOH 94 394 94 HOH HOH A . D 4 HOH 95 395 95 HOH HOH A . D 4 HOH 96 396 96 HOH HOH A . D 4 HOH 97 397 97 HOH HOH A . D 4 HOH 98 398 98 HOH HOH A . D 4 HOH 99 399 99 HOH HOH A . D 4 HOH 100 400 100 HOH HOH A . D 4 HOH 101 401 101 HOH HOH A . D 4 HOH 102 402 102 HOH HOH A . D 4 HOH 103 403 103 HOH HOH A . D 4 HOH 104 404 104 HOH HOH A . D 4 HOH 105 405 105 HOH HOH A . D 4 HOH 106 406 106 HOH HOH A . D 4 HOH 107 407 107 HOH HOH A . D 4 HOH 108 408 108 HOH HOH A . D 4 HOH 109 409 109 HOH HOH A . D 4 HOH 110 410 110 HOH HOH A . D 4 HOH 111 411 111 HOH HOH A . D 4 HOH 112 412 112 HOH HOH A . D 4 HOH 113 413 113 HOH HOH A . D 4 HOH 114 414 114 HOH HOH A . D 4 HOH 115 415 115 HOH HOH A . D 4 HOH 116 416 116 HOH HOH A . D 4 HOH 117 417 117 HOH HOH A . D 4 HOH 118 418 118 HOH HOH A . D 4 HOH 119 419 119 HOH HOH A . D 4 HOH 120 420 120 HOH HOH A . D 4 HOH 121 421 121 HOH HOH A . D 4 HOH 122 422 122 HOH HOH A . D 4 HOH 123 423 123 HOH HOH A . D 4 HOH 124 424 124 HOH HOH A . D 4 HOH 125 425 125 HOH HOH A . D 4 HOH 126 426 126 HOH HOH A . D 4 HOH 127 427 127 HOH HOH A . D 4 HOH 128 428 128 HOH HOH A . D 4 HOH 129 429 129 HOH HOH A . D 4 HOH 130 430 130 HOH HOH A . D 4 HOH 131 431 131 HOH HOH A . D 4 HOH 132 432 132 HOH HOH A . D 4 HOH 133 433 133 HOH HOH A . D 4 HOH 134 434 134 HOH HOH A . D 4 HOH 135 435 135 HOH HOH A . D 4 HOH 136 436 136 HOH HOH A . D 4 HOH 137 437 137 HOH HOH A . D 4 HOH 138 438 138 HOH HOH A . D 4 HOH 139 439 139 HOH HOH A . D 4 HOH 140 440 140 HOH HOH A . D 4 HOH 141 441 141 HOH HOH A . D 4 HOH 142 442 142 HOH HOH A . D 4 HOH 143 443 143 HOH HOH A . D 4 HOH 144 444 144 HOH HOH A . D 4 HOH 145 445 145 HOH HOH A . D 4 HOH 146 446 146 HOH HOH A . D 4 HOH 147 447 147 HOH HOH A . D 4 HOH 148 448 148 HOH HOH A . D 4 HOH 149 449 149 HOH HOH A . D 4 HOH 150 450 150 HOH HOH A . D 4 HOH 151 451 151 HOH HOH A . D 4 HOH 152 452 152 HOH HOH A . D 4 HOH 153 453 153 HOH HOH A . D 4 HOH 154 454 155 HOH HOH A . D 4 HOH 155 455 156 HOH HOH A . D 4 HOH 156 456 157 HOH HOH A . D 4 HOH 157 457 158 HOH HOH A . D 4 HOH 158 458 159 HOH HOH A . D 4 HOH 159 459 160 HOH HOH A . D 4 HOH 160 460 161 HOH HOH A . D 4 HOH 161 461 162 HOH HOH A . D 4 HOH 162 462 163 HOH HOH A . D 4 HOH 163 463 164 HOH HOH A . D 4 HOH 164 464 165 HOH HOH A . D 4 HOH 165 465 166 HOH HOH A . D 4 HOH 166 466 167 HOH HOH A . D 4 HOH 167 467 168 HOH HOH A . D 4 HOH 168 468 169 HOH HOH A . D 4 HOH 169 469 170 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSD _pdbx_struct_mod_residue.label_seq_id 106 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSD _pdbx_struct_mod_residue.auth_seq_id 106 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 3-SULFINOALANINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2900 ? 1 MORE -34 ? 1 'SSA (A^2)' 15200 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_554 -x,-x+y,-z-2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -50.2333333333 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CU _pdbx_struct_special_symmetry.auth_seq_id 201 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id CU _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-05 2 'Structure model' 1 1 2014-04-30 3 'Structure model' 1 2 2014-11-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHENIX 'model building' MR ? 2 PHENIX refinement '(phenix.refine: 1.8.1_1168)' ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 PHENIX phasing MR ? 6 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 419 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 419 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_554 _pdbx_validate_symm_contact.dist 2.11 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CSD _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 106 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 78.40 _pdbx_validate_torsion.psi -106.76 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 189 ? A ASP 189 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 1,2-ETHANEDIOL EDO 4 water HOH #