data_4N3T # _entry.id 4N3T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4N3T pdb_00004n3t 10.2210/pdb4n3t/pdb RCSB RCSB082716 ? ? WWPDB D_1000082716 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-09 2 'Structure model' 1 1 2014-05-14 3 'Structure model' 1 2 2023-09-20 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site 9 4 'Structure model' pdbx_entry_details 10 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.value' 10 3 'Structure model' '_struct_conn.pdbx_dist_value' 11 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 13 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 14 3 'Structure model' '_struct_ref_seq_dif.details' 15 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4N3T _pdbx_database_status.recvd_initial_deposition_date 2013-10-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4N3U _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Galaleldeen, A.' 1 'Taylor, A.B.' 2 'Waninger-Saroni, J.J.' 3 'Holloway, S.P.' 4 'Hart, P.J.' 5 # _citation.id primary _citation.title ;Candida albicans SOD5 represents the prototype of an unprecedented class of Cu-only superoxide dismutases required for pathogen defense. ; _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 111 _citation.page_first 5866 _citation.page_last 5871 _citation.year 2014 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24711423 _citation.pdbx_database_id_DOI 10.1073/pnas.1400137111 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gleason, J.E.' 1 ? primary 'Galaleldeen, A.' 2 ? primary 'Peterson, R.L.' 3 ? primary 'Taylor, A.B.' 4 ? primary 'Holloway, S.P.' 5 ? primary 'Waninger-Saroni, J.' 6 ? primary 'Cormack, B.P.' 7 ? primary 'Cabelli, D.E.' 8 ? primary 'Hart, P.J.' 9 ? primary 'Culotta, V.C.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Potential secreted Cu/Zn superoxide dismutase' 16896.715 1 ? ? 'UNP residues 27-181' ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 5 water nat water 18.015 145 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMVSPSLIAKFEKTSKSNIEGTIKFTPANNGTVSVSVDLKGLPSDIGPFPYHVHEKPVPASKNCSATENHFNPYNGTVR AATPAAHEVGDLAGKHGNIMGESYKTEYDDSYISLNEKSRSYIGGLSIVIHANNGTRLNCANITLLDEGHGNANTTMSN ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMVSPSLIAKFEKTSKSNIEGTIKFTPANNGTVSVSVDLKGLPSDIGPFPYHVHEKPVPASKNCSATENHFNPYNGTVR AATPAAHEVGDLAGKHGNIMGESYKTEYDDSYISLNEKSRSYIGGLSIVIHANNGTRLNCANITLLDEGHGNANTTMSN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (I) ION' CU1 3 'SULFATE ION' SO4 4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 VAL n 1 5 SER n 1 6 PRO n 1 7 SER n 1 8 LEU n 1 9 ILE n 1 10 ALA n 1 11 LYS n 1 12 PHE n 1 13 GLU n 1 14 LYS n 1 15 THR n 1 16 SER n 1 17 LYS n 1 18 SER n 1 19 ASN n 1 20 ILE n 1 21 GLU n 1 22 GLY n 1 23 THR n 1 24 ILE n 1 25 LYS n 1 26 PHE n 1 27 THR n 1 28 PRO n 1 29 ALA n 1 30 ASN n 1 31 ASN n 1 32 GLY n 1 33 THR n 1 34 VAL n 1 35 SER n 1 36 VAL n 1 37 SER n 1 38 VAL n 1 39 ASP n 1 40 LEU n 1 41 LYS n 1 42 GLY n 1 43 LEU n 1 44 PRO n 1 45 SER n 1 46 ASP n 1 47 ILE n 1 48 GLY n 1 49 PRO n 1 50 PHE n 1 51 PRO n 1 52 TYR n 1 53 HIS n 1 54 VAL n 1 55 HIS n 1 56 GLU n 1 57 LYS n 1 58 PRO n 1 59 VAL n 1 60 PRO n 1 61 ALA n 1 62 SER n 1 63 LYS n 1 64 ASN n 1 65 CYS n 1 66 SER n 1 67 ALA n 1 68 THR n 1 69 GLU n 1 70 ASN n 1 71 HIS n 1 72 PHE n 1 73 ASN n 1 74 PRO n 1 75 TYR n 1 76 ASN n 1 77 GLY n 1 78 THR n 1 79 VAL n 1 80 ARG n 1 81 ALA n 1 82 ALA n 1 83 THR n 1 84 PRO n 1 85 ALA n 1 86 ALA n 1 87 HIS n 1 88 GLU n 1 89 VAL n 1 90 GLY n 1 91 ASP n 1 92 LEU n 1 93 ALA n 1 94 GLY n 1 95 LYS n 1 96 HIS n 1 97 GLY n 1 98 ASN n 1 99 ILE n 1 100 MET n 1 101 GLY n 1 102 GLU n 1 103 SER n 1 104 TYR n 1 105 LYS n 1 106 THR n 1 107 GLU n 1 108 TYR n 1 109 ASP n 1 110 ASP n 1 111 SER n 1 112 TYR n 1 113 ILE n 1 114 SER n 1 115 LEU n 1 116 ASN n 1 117 GLU n 1 118 LYS n 1 119 SER n 1 120 ARG n 1 121 SER n 1 122 TYR n 1 123 ILE n 1 124 GLY n 1 125 GLY n 1 126 LEU n 1 127 SER n 1 128 ILE n 1 129 VAL n 1 130 ILE n 1 131 HIS n 1 132 ALA n 1 133 ASN n 1 134 ASN n 1 135 GLY n 1 136 THR n 1 137 ARG n 1 138 LEU n 1 139 ASN n 1 140 CYS n 1 141 ALA n 1 142 ASN n 1 143 ILE n 1 144 THR n 1 145 LEU n 1 146 LEU n 1 147 ASP n 1 148 GLU n 1 149 GLY n 1 150 HIS n 1 151 GLY n 1 152 ASN n 1 153 ALA n 1 154 ASN n 1 155 THR n 1 156 THR n 1 157 MET n 1 158 SER n 1 159 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CaO19.2060, CaO19.9607, SOD31, SOD5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'SC5314 / ATCC MYA-2876' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Candida albicans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 237561 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pAG8H _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 23 ? ? ? A . n A 1 2 ALA 2 24 ? ? ? A . n A 1 3 MET 3 25 ? ? ? A . n A 1 4 VAL 4 26 26 VAL VAL A . n A 1 5 SER 5 27 27 SER SER A . n A 1 6 PRO 6 28 28 PRO PRO A . n A 1 7 SER 7 29 29 SER SER A . n A 1 8 LEU 8 30 30 LEU LEU A . n A 1 9 ILE 9 31 31 ILE ILE A . n A 1 10 ALA 10 32 32 ALA ALA A . n A 1 11 LYS 11 33 33 LYS LYS A . n A 1 12 PHE 12 34 34 PHE PHE A . n A 1 13 GLU 13 35 35 GLU GLU A . n A 1 14 LYS 14 36 36 LYS LYS A . n A 1 15 THR 15 37 37 THR THR A . n A 1 16 SER 16 38 38 SER SER A . n A 1 17 LYS 17 39 39 LYS LYS A . n A 1 18 SER 18 40 40 SER SER A . n A 1 19 ASN 19 41 41 ASN ASN A . n A 1 20 ILE 20 42 42 ILE ILE A . n A 1 21 GLU 21 43 43 GLU GLU A . n A 1 22 GLY 22 44 44 GLY GLY A . n A 1 23 THR 23 45 45 THR THR A . n A 1 24 ILE 24 46 46 ILE ILE A . n A 1 25 LYS 25 47 47 LYS LYS A . n A 1 26 PHE 26 48 48 PHE PHE A . n A 1 27 THR 27 49 49 THR THR A . n A 1 28 PRO 28 50 50 PRO PRO A . n A 1 29 ALA 29 51 51 ALA ALA A . n A 1 30 ASN 30 52 52 ASN ASN A . n A 1 31 ASN 31 53 53 ASN ASN A . n A 1 32 GLY 32 54 54 GLY GLY A . n A 1 33 THR 33 55 55 THR THR A . n A 1 34 VAL 34 56 56 VAL VAL A . n A 1 35 SER 35 57 57 SER SER A . n A 1 36 VAL 36 58 58 VAL VAL A . n A 1 37 SER 37 59 59 SER SER A . n A 1 38 VAL 38 60 60 VAL VAL A . n A 1 39 ASP 39 61 61 ASP ASP A . n A 1 40 LEU 40 62 62 LEU LEU A . n A 1 41 LYS 41 63 63 LYS LYS A . n A 1 42 GLY 42 64 64 GLY GLY A . n A 1 43 LEU 43 65 65 LEU LEU A . n A 1 44 PRO 44 66 66 PRO PRO A . n A 1 45 SER 45 67 67 SER SER A . n A 1 46 ASP 46 68 68 ASP ASP A . n A 1 47 ILE 47 69 69 ILE ILE A . n A 1 48 GLY 48 70 70 GLY GLY A . n A 1 49 PRO 49 71 71 PRO PRO A . n A 1 50 PHE 50 72 72 PHE PHE A . n A 1 51 PRO 51 73 73 PRO PRO A . n A 1 52 TYR 52 74 74 TYR TYR A . n A 1 53 HIS 53 75 75 HIS HIS A . n A 1 54 VAL 54 76 76 VAL VAL A . n A 1 55 HIS 55 77 77 HIS HIS A . n A 1 56 GLU 56 78 78 GLU GLU A . n A 1 57 LYS 57 79 79 LYS LYS A . n A 1 58 PRO 58 80 80 PRO PRO A . n A 1 59 VAL 59 81 81 VAL VAL A . n A 1 60 PRO 60 82 82 PRO PRO A . n A 1 61 ALA 61 83 83 ALA ALA A . n A 1 62 SER 62 84 84 SER SER A . n A 1 63 LYS 63 85 85 LYS LYS A . n A 1 64 ASN 64 86 86 ASN ASN A . n A 1 65 CYS 65 87 87 CYS CYS A . n A 1 66 SER 66 88 88 SER SER A . n A 1 67 ALA 67 89 89 ALA ALA A . n A 1 68 THR 68 90 90 THR THR A . n A 1 69 GLU 69 91 91 GLU GLU A . n A 1 70 ASN 70 92 92 ASN ASN A . n A 1 71 HIS 71 93 93 HIS HIS A . n A 1 72 PHE 72 94 94 PHE PHE A . n A 1 73 ASN 73 95 95 ASN ASN A . n A 1 74 PRO 74 96 96 PRO PRO A . n A 1 75 TYR 75 97 97 TYR TYR A . n A 1 76 ASN 76 98 98 ASN ASN A . n A 1 77 GLY 77 99 99 GLY GLY A . n A 1 78 THR 78 100 100 THR THR A . n A 1 79 VAL 79 101 101 VAL VAL A . n A 1 80 ARG 80 102 102 ARG ARG A . n A 1 81 ALA 81 103 103 ALA ALA A . n A 1 82 ALA 82 104 104 ALA ALA A . n A 1 83 THR 83 105 105 THR THR A . n A 1 84 PRO 84 106 106 PRO PRO A . n A 1 85 ALA 85 107 107 ALA ALA A . n A 1 86 ALA 86 108 108 ALA ALA A . n A 1 87 HIS 87 109 109 HIS HIS A . n A 1 88 GLU 88 110 110 GLU GLU A . n A 1 89 VAL 89 111 111 VAL VAL A . n A 1 90 GLY 90 112 112 GLY GLY A . n A 1 91 ASP 91 113 113 ASP ASP A . n A 1 92 LEU 92 114 114 LEU LEU A . n A 1 93 ALA 93 115 115 ALA ALA A . n A 1 94 GLY 94 116 116 GLY GLY A . n A 1 95 LYS 95 117 117 LYS LYS A . n A 1 96 HIS 96 118 118 HIS HIS A . n A 1 97 GLY 97 119 119 GLY GLY A . n A 1 98 ASN 98 120 120 ASN ASN A . n A 1 99 ILE 99 121 121 ILE ILE A . n A 1 100 MET 100 122 122 MET MET A . n A 1 101 GLY 101 123 123 GLY GLY A . n A 1 102 GLU 102 124 124 GLU GLU A . n A 1 103 SER 103 125 125 SER SER A . n A 1 104 TYR 104 126 126 TYR TYR A . n A 1 105 LYS 105 127 127 LYS LYS A . n A 1 106 THR 106 128 128 THR THR A . n A 1 107 GLU 107 129 129 GLU GLU A . n A 1 108 TYR 108 130 130 TYR TYR A . n A 1 109 ASP 109 131 131 ASP ASP A . n A 1 110 ASP 110 132 132 ASP ASP A . n A 1 111 SER 111 133 133 SER SER A . n A 1 112 TYR 112 134 134 TYR TYR A . n A 1 113 ILE 113 135 135 ILE ILE A . n A 1 114 SER 114 136 136 SER SER A . n A 1 115 LEU 115 137 137 LEU LEU A . n A 1 116 ASN 116 138 138 ASN ASN A . n A 1 117 GLU 117 139 139 GLU GLU A . n A 1 118 LYS 118 140 140 LYS LYS A . n A 1 119 SER 119 141 141 SER SER A . n A 1 120 ARG 120 142 142 ARG ARG A . n A 1 121 SER 121 143 143 SER SER A . n A 1 122 TYR 122 144 144 TYR TYR A . n A 1 123 ILE 123 145 145 ILE ILE A . n A 1 124 GLY 124 146 146 GLY GLY A . n A 1 125 GLY 125 147 147 GLY GLY A . n A 1 126 LEU 126 148 148 LEU LEU A . n A 1 127 SER 127 149 149 SER SER A . n A 1 128 ILE 128 150 150 ILE ILE A . n A 1 129 VAL 129 151 151 VAL VAL A . n A 1 130 ILE 130 152 152 ILE ILE A . n A 1 131 HIS 131 153 153 HIS HIS A . n A 1 132 ALA 132 154 154 ALA ALA A . n A 1 133 ASN 133 155 155 ASN ASN A . n A 1 134 ASN 134 156 156 ASN ASN A . n A 1 135 GLY 135 157 157 GLY GLY A . n A 1 136 THR 136 158 158 THR THR A . n A 1 137 ARG 137 159 159 ARG ARG A . n A 1 138 LEU 138 160 160 LEU LEU A . n A 1 139 ASN 139 161 161 ASN ASN A . n A 1 140 CYS 140 162 162 CYS CYS A . n A 1 141 ALA 141 163 163 ALA ALA A . n A 1 142 ASN 142 164 164 ASN ASN A . n A 1 143 ILE 143 165 165 ILE ILE A . n A 1 144 THR 144 166 166 THR THR A . n A 1 145 LEU 145 167 167 LEU LEU A . n A 1 146 LEU 146 168 168 LEU LEU A . n A 1 147 ASP 147 169 169 ASP ASP A . n A 1 148 GLU 148 170 170 GLU GLU A . n A 1 149 GLY 149 171 171 GLY GLY A . n A 1 150 HIS 150 172 172 HIS HIS A . n A 1 151 GLY 151 173 173 GLY GLY A . n A 1 152 ASN 152 174 174 ASN ASN A . n A 1 153 ALA 153 175 175 ALA ALA A . n A 1 154 ASN 154 176 176 ASN ASN A . n A 1 155 THR 155 177 177 THR THR A . n A 1 156 THR 156 178 178 THR THR A . n A 1 157 MET 157 179 ? ? ? A . n A 1 158 SER 158 180 ? ? ? A . n A 1 159 ASN 159 181 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU1 1 201 201 CU1 CU A . C 3 SO4 1 202 301 SO4 SO4 A . D 3 SO4 1 203 302 SO4 SO4 A . E 4 TRS 1 204 401 TRS TRS A . F 5 HOH 1 301 1 HOH HOH A . F 5 HOH 2 302 2 HOH HOH A . F 5 HOH 3 303 3 HOH HOH A . F 5 HOH 4 304 4 HOH HOH A . F 5 HOH 5 305 5 HOH HOH A . F 5 HOH 6 306 6 HOH HOH A . F 5 HOH 7 307 7 HOH HOH A . F 5 HOH 8 308 8 HOH HOH A . F 5 HOH 9 309 9 HOH HOH A . F 5 HOH 10 310 10 HOH HOH A . F 5 HOH 11 311 11 HOH HOH A . F 5 HOH 12 312 12 HOH HOH A . F 5 HOH 13 313 13 HOH HOH A . F 5 HOH 14 314 14 HOH HOH A . F 5 HOH 15 315 15 HOH HOH A . F 5 HOH 16 316 16 HOH HOH A . F 5 HOH 17 317 17 HOH HOH A . F 5 HOH 18 318 18 HOH HOH A . F 5 HOH 19 319 19 HOH HOH A . F 5 HOH 20 320 20 HOH HOH A . F 5 HOH 21 321 21 HOH HOH A . F 5 HOH 22 322 22 HOH HOH A . F 5 HOH 23 323 23 HOH HOH A . F 5 HOH 24 324 24 HOH HOH A . F 5 HOH 25 325 25 HOH HOH A . F 5 HOH 26 326 26 HOH HOH A . F 5 HOH 27 327 27 HOH HOH A . F 5 HOH 28 328 28 HOH HOH A . F 5 HOH 29 329 29 HOH HOH A . F 5 HOH 30 330 30 HOH HOH A . F 5 HOH 31 331 31 HOH HOH A . F 5 HOH 32 332 32 HOH HOH A . F 5 HOH 33 333 33 HOH HOH A . F 5 HOH 34 334 34 HOH HOH A . F 5 HOH 35 335 35 HOH HOH A . F 5 HOH 36 336 36 HOH HOH A . F 5 HOH 37 337 37 HOH HOH A . F 5 HOH 38 338 38 HOH HOH A . F 5 HOH 39 339 39 HOH HOH A . F 5 HOH 40 340 40 HOH HOH A . F 5 HOH 41 341 41 HOH HOH A . F 5 HOH 42 342 42 HOH HOH A . F 5 HOH 43 343 43 HOH HOH A . F 5 HOH 44 344 44 HOH HOH A . F 5 HOH 45 345 45 HOH HOH A . F 5 HOH 46 346 46 HOH HOH A . F 5 HOH 47 347 47 HOH HOH A . F 5 HOH 48 348 48 HOH HOH A . F 5 HOH 49 349 49 HOH HOH A . F 5 HOH 50 350 50 HOH HOH A . F 5 HOH 51 351 51 HOH HOH A . F 5 HOH 52 352 52 HOH HOH A . F 5 HOH 53 353 53 HOH HOH A . F 5 HOH 54 354 54 HOH HOH A . F 5 HOH 55 355 55 HOH HOH A . F 5 HOH 56 356 56 HOH HOH A . F 5 HOH 57 357 57 HOH HOH A . F 5 HOH 58 358 58 HOH HOH A . F 5 HOH 59 359 59 HOH HOH A . F 5 HOH 60 360 60 HOH HOH A . F 5 HOH 61 361 61 HOH HOH A . F 5 HOH 62 362 62 HOH HOH A . F 5 HOH 63 363 63 HOH HOH A . F 5 HOH 64 364 64 HOH HOH A . F 5 HOH 65 365 65 HOH HOH A . F 5 HOH 66 366 66 HOH HOH A . F 5 HOH 67 367 67 HOH HOH A . F 5 HOH 68 368 68 HOH HOH A . F 5 HOH 69 369 69 HOH HOH A . F 5 HOH 70 370 70 HOH HOH A . F 5 HOH 71 371 71 HOH HOH A . F 5 HOH 72 372 72 HOH HOH A . F 5 HOH 73 373 73 HOH HOH A . F 5 HOH 74 374 74 HOH HOH A . F 5 HOH 75 375 75 HOH HOH A . F 5 HOH 76 376 76 HOH HOH A . F 5 HOH 77 377 77 HOH HOH A . F 5 HOH 78 378 78 HOH HOH A . F 5 HOH 79 379 79 HOH HOH A . F 5 HOH 80 380 80 HOH HOH A . F 5 HOH 81 381 81 HOH HOH A . F 5 HOH 82 382 82 HOH HOH A . F 5 HOH 83 383 83 HOH HOH A . F 5 HOH 84 384 84 HOH HOH A . F 5 HOH 85 385 85 HOH HOH A . F 5 HOH 86 386 86 HOH HOH A . F 5 HOH 87 387 87 HOH HOH A . F 5 HOH 88 388 88 HOH HOH A . F 5 HOH 89 389 89 HOH HOH A . F 5 HOH 90 390 90 HOH HOH A . F 5 HOH 91 391 91 HOH HOH A . F 5 HOH 92 392 92 HOH HOH A . F 5 HOH 93 393 93 HOH HOH A . F 5 HOH 94 394 94 HOH HOH A . F 5 HOH 95 395 95 HOH HOH A . F 5 HOH 96 396 96 HOH HOH A . F 5 HOH 97 397 97 HOH HOH A . F 5 HOH 98 398 98 HOH HOH A . F 5 HOH 99 399 99 HOH HOH A . F 5 HOH 100 400 100 HOH HOH A . F 5 HOH 101 401 101 HOH HOH A . F 5 HOH 102 402 102 HOH HOH A . F 5 HOH 103 403 103 HOH HOH A . F 5 HOH 104 404 104 HOH HOH A . F 5 HOH 105 405 105 HOH HOH A . F 5 HOH 106 406 106 HOH HOH A . F 5 HOH 107 407 107 HOH HOH A . F 5 HOH 108 408 108 HOH HOH A . F 5 HOH 109 409 109 HOH HOH A . F 5 HOH 110 410 110 HOH HOH A . F 5 HOH 111 411 111 HOH HOH A . F 5 HOH 112 412 112 HOH HOH A . F 5 HOH 113 413 113 HOH HOH A . F 5 HOH 114 414 114 HOH HOH A . F 5 HOH 115 415 115 HOH HOH A . F 5 HOH 116 416 116 HOH HOH A . F 5 HOH 117 417 117 HOH HOH A . F 5 HOH 118 418 118 HOH HOH A . F 5 HOH 119 419 119 HOH HOH A . F 5 HOH 120 420 120 HOH HOH A . F 5 HOH 121 421 121 HOH HOH A . F 5 HOH 122 422 122 HOH HOH A . F 5 HOH 123 423 123 HOH HOH A . F 5 HOH 124 424 124 HOH HOH A . F 5 HOH 125 425 125 HOH HOH A . F 5 HOH 126 426 126 HOH HOH A . F 5 HOH 127 427 127 HOH HOH A . F 5 HOH 128 428 128 HOH HOH A . F 5 HOH 129 429 129 HOH HOH A . F 5 HOH 130 430 130 HOH HOH A . F 5 HOH 131 431 131 HOH HOH A . F 5 HOH 132 432 132 HOH HOH A . F 5 HOH 133 433 133 HOH HOH A . F 5 HOH 134 434 134 HOH HOH A . F 5 HOH 135 435 135 HOH HOH A . F 5 HOH 136 436 136 HOH HOH A . F 5 HOH 137 437 137 HOH HOH A . F 5 HOH 138 438 138 HOH HOH A . F 5 HOH 139 439 139 HOH HOH A . F 5 HOH 140 440 140 HOH HOH A . F 5 HOH 141 441 141 HOH HOH A . F 5 HOH 142 442 142 HOH HOH A . F 5 HOH 143 443 143 HOH HOH A . F 5 HOH 144 444 144 HOH HOH A . F 5 HOH 145 445 145 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHASER phasing . ? 1 PHENIX refinement '(phenix.refine: 1.8.3_1479)' ? 2 XDS 'data reduction' . ? 3 XDS 'data scaling' . ? 4 # _cell.entry_id 4N3T _cell.length_a 34.476 _cell.length_b 40.466 _cell.length_c 102.167 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4N3T _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # _exptl.entry_id 4N3T _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_percent_sol 41.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pdbx_details '2.4 M ammonium sulfate, 0.1 M bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2012-07-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97918 # _reflns.entry_id 4N3T _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 102.2 _reflns.d_resolution_high 1.4 _reflns.number_obs 28906 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.043 _reflns.pdbx_netI_over_sigmaI 18.1 _reflns.B_iso_Wilson_estimate 14.2 _reflns.pdbx_redundancy 4.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.4 _reflns_shell.d_res_low 1.48 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.569 _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.pdbx_redundancy 4.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 4138 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4N3T _refine.ls_number_reflns_obs 28837 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 31.720 _refine.ls_d_res_high 1.400 _refine.ls_percent_reflns_obs 99.56 _refine.ls_R_factor_obs 0.1500 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1471 _refine.ls_R_factor_R_free 0.1890 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 6.93 _refine.ls_number_reflns_R_free 1999 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 25.6 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB entry 1AZV' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model anisotropic _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.13 _refine.pdbx_overall_phase_error 17.92 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1146 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 145 _refine_hist.number_atoms_total 1310 _refine_hist.d_res_high 1.400 _refine_hist.d_res_low 31.720 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.006 ? ? 1204 ? 'X-RAY DIFFRACTION' f_angle_d 1.092 ? ? 1644 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 9.986 ? ? 439 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.072 ? ? 184 ? 'X-RAY DIFFRACTION' f_plane_restr 0.004 ? ? 215 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.400 1.4351 1889 0.2325 100.00 0.2896 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.4351 1.4739 1871 0.2023 100.00 0.2274 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.4739 1.5172 1902 0.1923 100.00 0.2525 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.5172 1.5662 1899 0.1658 100.00 0.2268 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.5662 1.6222 1895 0.1531 100.00 0.2656 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.6222 1.6871 1876 0.1393 100.00 0.1856 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.6871 1.7639 1902 0.1337 100.00 0.1629 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.7639 1.8569 1901 0.1258 100.00 0.2099 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.8569 1.9732 1903 0.1270 99.00 0.1613 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.9732 2.1256 1927 0.1280 99.00 0.1621 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.1256 2.3394 1913 0.1367 99.00 0.1956 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.3394 2.6778 1950 0.1437 100.00 0.1969 . . 146 . . . . 'X-RAY DIFFRACTION' . 2.6778 3.3731 1956 0.1466 99.00 0.1950 . . 144 . . . . 'X-RAY DIFFRACTION' . 3.3731 31.7278 2054 0.1519 99.00 0.1636 . . 154 . . . . 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 4N3T _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 4N3T _struct.title 'Candida albicans Superoxide Dismutase 5 (SOD5), Cu(I)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4N3T _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'antioxidant, oxidative burst, oxidoreductase, zinc loop, disulfide bond, extracellular' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5AD07_CANAL _struct_ref.pdbx_db_accession Q5AD07 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SPSLIAKFEKTSKSNIEGTIKFTPANNGTVSVSVDLKGLPSDIGPFPYHVHEKPVPASKNCSATENHFNPYNGTVRAATP AAHEVGDLAGKHGNIMGESYKTEYDDSYISLNEKSRSYIGGLSIVIHANNGTRLNCANITLLDEGHGNANTTMSN ; _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4N3T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5AD07 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 27 _struct_ref_seq.pdbx_auth_seq_align_end 181 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4N3T GLY A 1 ? UNP Q5AD07 ? ? 'expression tag' 23 1 1 4N3T ALA A 2 ? UNP Q5AD07 ? ? 'expression tag' 24 2 1 4N3T MET A 3 ? UNP Q5AD07 ? ? 'expression tag' 25 3 1 4N3T VAL A 4 ? UNP Q5AD07 ? ? 'expression tag' 26 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 44 ? GLY A 48 ? PRO A 66 GLY A 70 5 ? 5 HELX_P HELX_P2 2 ASN A 64 ? GLU A 69 ? ASN A 86 GLU A 91 5 ? 6 HELX_P HELX_P3 3 THR A 83 ? HIS A 87 ? THR A 105 HIS A 109 5 ? 5 HELX_P HELX_P4 4 ASP A 91 ? GLY A 97 ? ASP A 113 GLY A 119 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 140 SG ? ? A CYS 87 A CYS 162 1_555 ? ? ? ? ? ? ? 2.456 ? ? metalc1 metalc ? ? A HIS 53 ND1 ? ? ? 1_555 B CU1 . CU ? ? A HIS 75 A CU1 201 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc2 metalc ? ? A HIS 55 NE2 ? ? ? 1_555 B CU1 . CU ? ? A HIS 77 A CU1 201 1_555 ? ? ? ? ? ? ? 1.963 ? ? metalc3 metalc ? ? A HIS 131 NE2 ? ? ? 1_555 B CU1 . CU ? ? A HIS 153 A CU1 201 1_555 ? ? ? ? ? ? ? 1.995 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 53 ? A HIS 75 ? 1_555 CU ? B CU1 . ? A CU1 201 ? 1_555 NE2 ? A HIS 55 ? A HIS 77 ? 1_555 133.6 ? 2 ND1 ? A HIS 53 ? A HIS 75 ? 1_555 CU ? B CU1 . ? A CU1 201 ? 1_555 NE2 ? A HIS 131 ? A HIS 153 ? 1_555 106.9 ? 3 NE2 ? A HIS 55 ? A HIS 77 ? 1_555 CU ? B CU1 . ? A CU1 201 ? 1_555 NE2 ? A HIS 131 ? A HIS 153 ? 1_555 119.2 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 65 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 140 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 87 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 162 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 48 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 70 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 49 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 71 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.20 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 52 ? HIS A 55 ? TYR A 74 HIS A 77 A 2 SER A 127 ? HIS A 131 ? SER A 149 HIS A 153 A 3 ARG A 137 ? LEU A 145 ? ARG A 159 LEU A 167 A 4 LEU A 8 ? PHE A 12 ? LEU A 30 PHE A 34 A 5 GLU A 21 ? ALA A 29 ? GLU A 43 ALA A 51 A 6 THR A 33 ? LYS A 41 ? THR A 55 LYS A 63 A 7 TYR A 104 ? ASP A 110 ? TYR A 126 ASP A 132 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 55 ? N HIS A 77 O SER A 127 ? O SER A 149 A 2 3 N ILE A 130 ? N ILE A 152 O ASN A 139 ? O ASN A 161 A 3 4 O THR A 144 ? O THR A 166 N ILE A 9 ? N ILE A 31 A 4 5 N LEU A 8 ? N LEU A 30 O PHE A 26 ? O PHE A 48 A 5 6 N THR A 27 ? N THR A 49 O SER A 35 ? O SER A 57 A 6 7 N VAL A 36 ? N VAL A 58 O TYR A 108 ? O TYR A 130 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU1 201 ? 4 'BINDING SITE FOR RESIDUE CU1 A 201' AC2 Software A SO4 202 ? 4 'BINDING SITE FOR RESIDUE SO4 A 202' AC3 Software A SO4 203 ? 9 'BINDING SITE FOR RESIDUE SO4 A 203' AC4 Software A TRS 204 ? 7 'BINDING SITE FOR RESIDUE TRS A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 53 ? HIS A 75 . ? 1_555 ? 2 AC1 4 HIS A 55 ? HIS A 77 . ? 1_555 ? 3 AC1 4 HIS A 71 ? HIS A 93 . ? 1_555 ? 4 AC1 4 HIS A 131 ? HIS A 153 . ? 1_555 ? 5 AC2 4 THR A 15 ? THR A 37 . ? 4_445 ? 6 AC2 4 SER A 16 ? SER A 38 . ? 4_445 ? 7 AC2 4 ASN A 134 ? ASN A 156 . ? 1_555 ? 8 AC2 4 HOH F . ? HOH A 410 . ? 4_445 ? 9 AC3 9 ASN A 19 ? ASN A 41 . ? 1_555 ? 10 AC3 9 PRO A 44 ? PRO A 66 . ? 1_555 ? 11 AC3 9 SER A 62 ? SER A 84 . ? 4_445 ? 12 AC3 9 ASN A 64 ? ASN A 86 . ? 4_445 ? 13 AC3 9 HOH F . ? HOH A 326 . ? 1_555 ? 14 AC3 9 HOH F . ? HOH A 397 . ? 1_555 ? 15 AC3 9 HOH F . ? HOH A 398 . ? 1_555 ? 16 AC3 9 HOH F . ? HOH A 440 . ? 1_555 ? 17 AC3 9 HOH F . ? HOH A 443 . ? 1_555 ? 18 AC4 7 HIS A 53 ? HIS A 75 . ? 1_555 ? 19 AC4 7 HIS A 71 ? HIS A 93 . ? 1_555 ? 20 AC4 7 HIS A 131 ? HIS A 153 . ? 1_555 ? 21 AC4 7 GLY A 135 ? GLY A 157 . ? 1_555 ? 22 AC4 7 ARG A 137 ? ARG A 159 . ? 1_555 ? 23 AC4 7 HOH F . ? HOH A 330 . ? 1_555 ? 24 AC4 7 HOH F . ? HOH A 441 . ? 1_555 ? # _pdbx_entry_details.entry_id 4N3T _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 91 ? ? 59.75 -137.82 2 1 ASN A 98 ? ? 55.21 74.11 3 1 LEU A 148 ? ? -94.31 -159.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 23 ? A GLY 1 2 1 Y 1 A ALA 24 ? A ALA 2 3 1 Y 1 A MET 25 ? A MET 3 4 1 Y 1 A MET 179 ? A MET 157 5 1 Y 1 A SER 180 ? A SER 158 6 1 Y 1 A ASN 181 ? A ASN 159 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU1 CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLU N N N N 89 GLU CA C N S 90 GLU C C N N 91 GLU O O N N 92 GLU CB C N N 93 GLU CG C N N 94 GLU CD C N N 95 GLU OE1 O N N 96 GLU OE2 O N N 97 GLU OXT O N N 98 GLU H H N N 99 GLU H2 H N N 100 GLU HA H N N 101 GLU HB2 H N N 102 GLU HB3 H N N 103 GLU HG2 H N N 104 GLU HG3 H N N 105 GLU HE2 H N N 106 GLU HXT H N N 107 GLY N N N N 108 GLY CA C N N 109 GLY C C N N 110 GLY O O N N 111 GLY OXT O N N 112 GLY H H N N 113 GLY H2 H N N 114 GLY HA2 H N N 115 GLY HA3 H N N 116 GLY HXT H N N 117 HIS N N N N 118 HIS CA C N S 119 HIS C C N N 120 HIS O O N N 121 HIS CB C N N 122 HIS CG C Y N 123 HIS ND1 N Y N 124 HIS CD2 C Y N 125 HIS CE1 C Y N 126 HIS NE2 N Y N 127 HIS OXT O N N 128 HIS H H N N 129 HIS H2 H N N 130 HIS HA H N N 131 HIS HB2 H N N 132 HIS HB3 H N N 133 HIS HD1 H N N 134 HIS HD2 H N N 135 HIS HE1 H N N 136 HIS HE2 H N N 137 HIS HXT H N N 138 HOH O O N N 139 HOH H1 H N N 140 HOH H2 H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 MET N N N N 211 MET CA C N S 212 MET C C N N 213 MET O O N N 214 MET CB C N N 215 MET CG C N N 216 MET SD S N N 217 MET CE C N N 218 MET OXT O N N 219 MET H H N N 220 MET H2 H N N 221 MET HA H N N 222 MET HB2 H N N 223 MET HB3 H N N 224 MET HG2 H N N 225 MET HG3 H N N 226 MET HE1 H N N 227 MET HE2 H N N 228 MET HE3 H N N 229 MET HXT H N N 230 PHE N N N N 231 PHE CA C N S 232 PHE C C N N 233 PHE O O N N 234 PHE CB C N N 235 PHE CG C Y N 236 PHE CD1 C Y N 237 PHE CD2 C Y N 238 PHE CE1 C Y N 239 PHE CE2 C Y N 240 PHE CZ C Y N 241 PHE OXT O N N 242 PHE H H N N 243 PHE H2 H N N 244 PHE HA H N N 245 PHE HB2 H N N 246 PHE HB3 H N N 247 PHE HD1 H N N 248 PHE HD2 H N N 249 PHE HE1 H N N 250 PHE HE2 H N N 251 PHE HZ H N N 252 PHE HXT H N N 253 PRO N N N N 254 PRO CA C N S 255 PRO C C N N 256 PRO O O N N 257 PRO CB C N N 258 PRO CG C N N 259 PRO CD C N N 260 PRO OXT O N N 261 PRO H H N N 262 PRO HA H N N 263 PRO HB2 H N N 264 PRO HB3 H N N 265 PRO HG2 H N N 266 PRO HG3 H N N 267 PRO HD2 H N N 268 PRO HD3 H N N 269 PRO HXT H N N 270 SER N N N N 271 SER CA C N S 272 SER C C N N 273 SER O O N N 274 SER CB C N N 275 SER OG O N N 276 SER OXT O N N 277 SER H H N N 278 SER H2 H N N 279 SER HA H N N 280 SER HB2 H N N 281 SER HB3 H N N 282 SER HG H N N 283 SER HXT H N N 284 SO4 S S N N 285 SO4 O1 O N N 286 SO4 O2 O N N 287 SO4 O3 O N N 288 SO4 O4 O N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRS C C N N 307 TRS C1 C N N 308 TRS C2 C N N 309 TRS C3 C N N 310 TRS N N N N 311 TRS O1 O N N 312 TRS O2 O N N 313 TRS O3 O N N 314 TRS H11 H N N 315 TRS H12 H N N 316 TRS H21 H N N 317 TRS H22 H N N 318 TRS H31 H N N 319 TRS H32 H N N 320 TRS HN1 H N N 321 TRS HN2 H N N 322 TRS HN3 H N N 323 TRS HO1 H N N 324 TRS HO2 H N N 325 TRS HO3 H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 HOH O H1 sing N N 131 HOH O H2 sing N N 132 ILE N CA sing N N 133 ILE N H sing N N 134 ILE N H2 sing N N 135 ILE CA C sing N N 136 ILE CA CB sing N N 137 ILE CA HA sing N N 138 ILE C O doub N N 139 ILE C OXT sing N N 140 ILE CB CG1 sing N N 141 ILE CB CG2 sing N N 142 ILE CB HB sing N N 143 ILE CG1 CD1 sing N N 144 ILE CG1 HG12 sing N N 145 ILE CG1 HG13 sing N N 146 ILE CG2 HG21 sing N N 147 ILE CG2 HG22 sing N N 148 ILE CG2 HG23 sing N N 149 ILE CD1 HD11 sing N N 150 ILE CD1 HD12 sing N N 151 ILE CD1 HD13 sing N N 152 ILE OXT HXT sing N N 153 LEU N CA sing N N 154 LEU N H sing N N 155 LEU N H2 sing N N 156 LEU CA C sing N N 157 LEU CA CB sing N N 158 LEU CA HA sing N N 159 LEU C O doub N N 160 LEU C OXT sing N N 161 LEU CB CG sing N N 162 LEU CB HB2 sing N N 163 LEU CB HB3 sing N N 164 LEU CG CD1 sing N N 165 LEU CG CD2 sing N N 166 LEU CG HG sing N N 167 LEU CD1 HD11 sing N N 168 LEU CD1 HD12 sing N N 169 LEU CD1 HD13 sing N N 170 LEU CD2 HD21 sing N N 171 LEU CD2 HD22 sing N N 172 LEU CD2 HD23 sing N N 173 LEU OXT HXT sing N N 174 LYS N CA sing N N 175 LYS N H sing N N 176 LYS N H2 sing N N 177 LYS CA C sing N N 178 LYS CA CB sing N N 179 LYS CA HA sing N N 180 LYS C O doub N N 181 LYS C OXT sing N N 182 LYS CB CG sing N N 183 LYS CB HB2 sing N N 184 LYS CB HB3 sing N N 185 LYS CG CD sing N N 186 LYS CG HG2 sing N N 187 LYS CG HG3 sing N N 188 LYS CD CE sing N N 189 LYS CD HD2 sing N N 190 LYS CD HD3 sing N N 191 LYS CE NZ sing N N 192 LYS CE HE2 sing N N 193 LYS CE HE3 sing N N 194 LYS NZ HZ1 sing N N 195 LYS NZ HZ2 sing N N 196 LYS NZ HZ3 sing N N 197 LYS OXT HXT sing N N 198 MET N CA sing N N 199 MET N H sing N N 200 MET N H2 sing N N 201 MET CA C sing N N 202 MET CA CB sing N N 203 MET CA HA sing N N 204 MET C O doub N N 205 MET C OXT sing N N 206 MET CB CG sing N N 207 MET CB HB2 sing N N 208 MET CB HB3 sing N N 209 MET CG SD sing N N 210 MET CG HG2 sing N N 211 MET CG HG3 sing N N 212 MET SD CE sing N N 213 MET CE HE1 sing N N 214 MET CE HE2 sing N N 215 MET CE HE3 sing N N 216 MET OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 SO4 S O1 doub N N 271 SO4 S O2 doub N N 272 SO4 S O3 sing N N 273 SO4 S O4 sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRS C C1 sing N N 291 TRS C C2 sing N N 292 TRS C C3 sing N N 293 TRS C N sing N N 294 TRS C1 O1 sing N N 295 TRS C1 H11 sing N N 296 TRS C1 H12 sing N N 297 TRS C2 O2 sing N N 298 TRS C2 H21 sing N N 299 TRS C2 H22 sing N N 300 TRS C3 O3 sing N N 301 TRS C3 H31 sing N N 302 TRS C3 H32 sing N N 303 TRS N HN1 sing N N 304 TRS N HN2 sing N N 305 TRS N HN3 sing N N 306 TRS O1 HO1 sing N N 307 TRS O2 HO2 sing N N 308 TRS O3 HO3 sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1AZV _pdbx_initial_refinement_model.details 'PDB entry 1AZV' # _atom_sites.entry_id 4N3T _atom_sites.fract_transf_matrix[1][1] 0.029006 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024712 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009788 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_