data_4N9V # _entry.id 4N9V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4N9V pdb_00004n9v 10.2210/pdb4n9v/pdb RCSB RCSB082934 ? ? WWPDB D_1000082934 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2IBA 'X-RAY STRUCTURE OF HYDROGENATED URATE OXIDASE IN COMPLEX WITH 8-AZAXANTHINE' unspecified PDB 4N3M 'JOINT NEUTRON/X-RAY STRUCTURE OF URATE OXIDASE IN COMPLEX WITH 8-AZAXANTHINE' unspecified PDB 4N9M 'JOINT NEUTRON/X-RAY STRUCTURE OF URATE OXIDASE IN COMPLEX WITH 8-HYDROXYXANTHINE' unspecified PDB 4N9S 'HIGH RESOLUTION X-RAY STRUCTURE OF URATE OXIDASE IN COMPLEX WITH 8-HYDROXYXANTHINE' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4N9V _pdbx_database_status.recvd_initial_deposition_date 2013-10-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Oksanen, E.' 1 'Blakeley, M.P.' 2 'Budayova-Spano, M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The neutron structure of urate oxidase resolves a long-standing mechanistic conundrum and reveals unexpected changes in protonation. ; 'Plos One' 9 e86651 e86651 2014 ? US 1932-6203 ? ? 24466188 10.1371/journal.pone.0086651 1 ;Large crystal growth by thermal control allows combined X-ray and neutron crystallographic studies to elucidate the protonation states in Aspergillus flavus urate oxidase. ; 'J R Soc Interface' '6 Suppl 5' S599 S610 2009 ? UK 1742-5662 ? ? 19586953 10.1098/rsif.2009.0162.focus # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Oksanen, E.' 1 ? primary 'Blakeley, M.P.' 2 ? primary 'El-Hajji, M.' 3 ? primary 'Ryde, U.' 4 ? primary 'Budayova-Spano, M.' 5 ? 1 'Oksanen, E.' 6 ? 1 'Blakeley, M.P.' 7 ? 1 'Bonnete, F.' 8 ? 1 'Dauvergne, M.T.' 9 ? 1 'Dauvergne, F.' 10 ? 1 'Budayova-Spano, M.' 11 ? # _cell.entry_id 4N9V _cell.length_a 79.800 _cell.length_b 95.080 _cell.length_c 104.490 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4N9V _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Uricase 34183.590 1 1.7.3.3 ? ? ? 2 non-polymer syn 8-AZAXANTHINE 153.099 3 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 5 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 6 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 7 water nat water 18.015 532 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Aspergillus flavus urate oxidase, Urate oxidase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(ACE)SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQNPVTP PELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKST NSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMA EQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSKL ; _entity_poly.pdbx_seq_one_letter_code_can ;XSAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQNPVTPPELF GSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQF WGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQIL ARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 SER n 1 3 ALA n 1 4 VAL n 1 5 LYS n 1 6 ALA n 1 7 ALA n 1 8 ARG n 1 9 TYR n 1 10 GLY n 1 11 LYS n 1 12 ASP n 1 13 ASN n 1 14 VAL n 1 15 ARG n 1 16 VAL n 1 17 TYR n 1 18 LYS n 1 19 VAL n 1 20 HIS n 1 21 LYS n 1 22 ASP n 1 23 GLU n 1 24 LYS n 1 25 THR n 1 26 GLY n 1 27 VAL n 1 28 GLN n 1 29 THR n 1 30 VAL n 1 31 TYR n 1 32 GLU n 1 33 MET n 1 34 THR n 1 35 VAL n 1 36 CYS n 1 37 VAL n 1 38 LEU n 1 39 LEU n 1 40 GLU n 1 41 GLY n 1 42 GLU n 1 43 ILE n 1 44 GLU n 1 45 THR n 1 46 SER n 1 47 TYR n 1 48 THR n 1 49 LYS n 1 50 ALA n 1 51 ASP n 1 52 ASN n 1 53 SER n 1 54 VAL n 1 55 ILE n 1 56 VAL n 1 57 ALA n 1 58 THR n 1 59 ASP n 1 60 SER n 1 61 ILE n 1 62 LYS n 1 63 ASN n 1 64 THR n 1 65 ILE n 1 66 TYR n 1 67 ILE n 1 68 THR n 1 69 ALA n 1 70 LYS n 1 71 GLN n 1 72 ASN n 1 73 PRO n 1 74 VAL n 1 75 THR n 1 76 PRO n 1 77 PRO n 1 78 GLU n 1 79 LEU n 1 80 PHE n 1 81 GLY n 1 82 SER n 1 83 ILE n 1 84 LEU n 1 85 GLY n 1 86 THR n 1 87 HIS n 1 88 PHE n 1 89 ILE n 1 90 GLU n 1 91 LYS n 1 92 TYR n 1 93 ASN n 1 94 HIS n 1 95 ILE n 1 96 HIS n 1 97 ALA n 1 98 ALA n 1 99 HIS n 1 100 VAL n 1 101 ASN n 1 102 ILE n 1 103 VAL n 1 104 CYS n 1 105 HIS n 1 106 ARG n 1 107 TRP n 1 108 THR n 1 109 ARG n 1 110 MET n 1 111 ASP n 1 112 ILE n 1 113 ASP n 1 114 GLY n 1 115 LYS n 1 116 PRO n 1 117 HIS n 1 118 PRO n 1 119 HIS n 1 120 SER n 1 121 PHE n 1 122 ILE n 1 123 ARG n 1 124 ASP n 1 125 SER n 1 126 GLU n 1 127 GLU n 1 128 LYS n 1 129 ARG n 1 130 ASN n 1 131 VAL n 1 132 GLN n 1 133 VAL n 1 134 ASP n 1 135 VAL n 1 136 VAL n 1 137 GLU n 1 138 GLY n 1 139 LYS n 1 140 GLY n 1 141 ILE n 1 142 ASP n 1 143 ILE n 1 144 LYS n 1 145 SER n 1 146 SER n 1 147 LEU n 1 148 SER n 1 149 GLY n 1 150 LEU n 1 151 THR n 1 152 VAL n 1 153 LEU n 1 154 LYS n 1 155 SER n 1 156 THR n 1 157 ASN n 1 158 SER n 1 159 GLN n 1 160 PHE n 1 161 TRP n 1 162 GLY n 1 163 PHE n 1 164 LEU n 1 165 ARG n 1 166 ASP n 1 167 GLU n 1 168 TYR n 1 169 THR n 1 170 THR n 1 171 LEU n 1 172 LYS n 1 173 GLU n 1 174 THR n 1 175 TRP n 1 176 ASP n 1 177 ARG n 1 178 ILE n 1 179 LEU n 1 180 SER n 1 181 THR n 1 182 ASP n 1 183 VAL n 1 184 ASP n 1 185 ALA n 1 186 THR n 1 187 TRP n 1 188 GLN n 1 189 TRP n 1 190 LYS n 1 191 ASN n 1 192 PHE n 1 193 SER n 1 194 GLY n 1 195 LEU n 1 196 GLN n 1 197 GLU n 1 198 VAL n 1 199 ARG n 1 200 SER n 1 201 HIS n 1 202 VAL n 1 203 PRO n 1 204 LYS n 1 205 PHE n 1 206 ASP n 1 207 ALA n 1 208 THR n 1 209 TRP n 1 210 ALA n 1 211 THR n 1 212 ALA n 1 213 ARG n 1 214 GLU n 1 215 VAL n 1 216 THR n 1 217 LEU n 1 218 LYS n 1 219 THR n 1 220 PHE n 1 221 ALA n 1 222 GLU n 1 223 ASP n 1 224 ASN n 1 225 SER n 1 226 ALA n 1 227 SER n 1 228 VAL n 1 229 GLN n 1 230 ALA n 1 231 THR n 1 232 MET n 1 233 TYR n 1 234 LYS n 1 235 MET n 1 236 ALA n 1 237 GLU n 1 238 GLN n 1 239 ILE n 1 240 LEU n 1 241 ALA n 1 242 ARG n 1 243 GLN n 1 244 GLN n 1 245 LEU n 1 246 ILE n 1 247 GLU n 1 248 THR n 1 249 VAL n 1 250 GLU n 1 251 TYR n 1 252 SER n 1 253 LEU n 1 254 PRO n 1 255 ASN n 1 256 LYS n 1 257 HIS n 1 258 TYR n 1 259 PHE n 1 260 GLU n 1 261 ILE n 1 262 ASP n 1 263 LEU n 1 264 SER n 1 265 TRP n 1 266 HIS n 1 267 LYS n 1 268 GLY n 1 269 LEU n 1 270 GLN n 1 271 ASN n 1 272 THR n 1 273 GLY n 1 274 LYS n 1 275 ASN n 1 276 ALA n 1 277 GLU n 1 278 VAL n 1 279 PHE n 1 280 ALA n 1 281 PRO n 1 282 GLN n 1 283 SER n 1 284 ASP n 1 285 PRO n 1 286 ASN n 1 287 GLY n 1 288 LEU n 1 289 ILE n 1 290 LYS n 1 291 CYS n 1 292 THR n 1 293 VAL n 1 294 GLY n 1 295 ARG n 1 296 SER n 1 297 SER n 1 298 LEU n 1 299 LYS n 1 300 SER n 1 301 LYS n 1 302 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'uaZ, uox' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aspergillus flavus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5059 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code URIC_ASPFL _struct_ref.pdbx_db_accession Q00511 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQNPVTPPELFG SILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFW GFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILA RQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSKL ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4N9V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 302 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00511 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 302 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 301 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4N9V _struct_ref_seq_dif.mon_id ACE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q00511 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details acetylation _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 AZA non-polymer . 8-AZAXANTHINE ? 'C4 H3 N5 O2' 153.099 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 4N9V _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.90 _exptl_crystal.density_percent_sol 57.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details '5 % PEG 8000, 0.1 M NACL, 0.1M TRISHCL PD 8.5, 8 MG/ML URATE OXIDASE, temperature-controlled batch, temperature 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4r' _diffrn_detector.pdbx_collection_date 2007-12-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator diamond _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.933 # _reflns.entry_id 4N9V _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.1 _reflns.number_obs 158812 _reflns.number_all 158812 _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.94 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.1 _reflns_shell.d_res_low 1.13 _reflns_shell.percent_possible_all 99.7 _reflns_shell.Rmerge_I_obs 0.413 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.93 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4N9V _refine.ls_number_reflns_obs 158797 _refine.ls_number_reflns_all 158797 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 35.162 _refine.ls_d_res_high 1.100 _refine.ls_percent_reflns_obs 99.14 _refine.ls_R_factor_obs 0.1396 _refine.ls_R_factor_all 0.1396 _refine.ls_R_factor_R_work 0.1389 _refine.ls_R_factor_R_free 0.1532 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.00 _refine.ls_number_reflns_R_free 7940 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 4.1316 _refine.aniso_B[2][2] -2.0845 _refine.aniso_B[3][3] -2.7607 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.404 _refine.solvent_model_param_bsol 46.618 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ;EXPLICIT HYDROGENS DERIVED FROM THE NEUTRON STRUCTURE WERE USED IN RIDING POSITIONS IN THIS STRUCTURE, AND PROBABLY THESE RESIDUES HAVE DIFFERENT LEUCINE ROTAMERS (A244 AND A268) THAN IN THE NEUTRON STRUCTURE. ; _refine.pdbx_starting_model 'PDB ENTRY 2IBA' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details '5% random' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.12 _refine.pdbx_overall_phase_error 13.83 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2343 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 532 _refine_hist.number_atoms_total 2918 _refine_hist.d_res_high 1.100 _refine_hist.d_res_low 35.162 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.008 ? ? 2595 ? 'X-RAY DIFFRACTION' f_angle_d 1.370 ? ? 3565 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 15.912 ? ? 947 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.133 ? ? 396 ? 'X-RAY DIFFRACTION' f_plane_restr 0.007 ? ? 457 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.1000 1.1393 15084 0.1954 100.00 0.1925 . . 794 . . . . 'X-RAY DIFFRACTION' . 1.1393 1.1849 14985 0.1636 100.00 0.1870 . . 789 . . . . 'X-RAY DIFFRACTION' . 1.1849 1.2389 15063 0.1508 100.00 0.1573 . . 793 . . . . 'X-RAY DIFFRACTION' . 1.2389 1.3042 15046 0.1377 100.00 0.1598 . . 792 . . . . 'X-RAY DIFFRACTION' . 1.3042 1.3859 15031 0.1260 99.00 0.1482 . . 791 . . . . 'X-RAY DIFFRACTION' . 1.3859 1.4929 15065 0.1187 99.00 0.1496 . . 793 . . . . 'X-RAY DIFFRACTION' . 1.4929 1.6431 14982 0.1134 99.00 0.1338 . . 788 . . . . 'X-RAY DIFFRACTION' . 1.6431 1.8809 15005 0.1172 98.00 0.1365 . . 790 . . . . 'X-RAY DIFFRACTION' . 1.8809 2.3697 15063 0.1178 98.00 0.1278 . . 793 . . . . 'X-RAY DIFFRACTION' . 2.3697 35.1798 15533 0.1457 99.00 0.1566 . . 817 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4N9V _struct.title 'High resolution x-ray structure of urate oxidase in complex with 8-azaxanthine' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4N9V _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'urate oxidase, uricase, oxidoreductase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 5 ? I N N 6 ? J N N 7 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 43 ? LYS A 49 ? ILE A 42 LYS A 48 1 ? 7 HELX_P HELX_P2 2 ASP A 51 ? ILE A 55 ? ASP A 50 ILE A 54 5 ? 5 HELX_P HELX_P3 3 ALA A 57 ? ASN A 72 ? ALA A 56 ASN A 71 1 ? 16 HELX_P HELX_P4 4 PRO A 76 ? TYR A 92 ? PRO A 75 TYR A 91 1 ? 17 HELX_P HELX_P5 5 GLY A 194 ? HIS A 201 ? GLY A 193 HIS A 200 1 ? 8 HELX_P HELX_P6 6 HIS A 201 ? ASP A 223 ? HIS A 200 ASP A 222 1 ? 23 HELX_P HELX_P7 7 SER A 227 ? GLN A 243 ? SER A 226 GLN A 242 1 ? 17 HELX_P HELX_P8 8 THR A 272 ? ALA A 276 ? THR A 271 ALA A 275 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A SER 2 N ? ? A ACE 0 A SER 1 1_555 ? ? ? ? ? ? ? 1.334 ? ? metalc1 metalc ? ? A ASP 12 OD2 B ? ? 1_555 G ZN . ZN ? ? A ASP 11 A ZN 406 1_555 ? ? ? ? ? ? ? 1.947 ? ? metalc2 metalc ? ? A CYS 36 SG B ? ? 1_555 F ZN . ZN ? ? A CYS 35 A ZN 405 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc3 metalc ? ? A CYS 36 SG B ? ? 1_555 G ZN . ZN ? ? A CYS 35 A ZN 406 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc4 metalc ? ? A CYS 36 SG A ? ? 1_555 G ZN . ZN ? ? A CYS 35 A ZN 406 1_555 ? ? ? ? ? ? ? 2.972 ? ? metalc5 metalc ? ? A ILE 89 O ? ? ? 1_555 E NA . NA ? ? A ILE 88 A NA 404 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc6 metalc ? ? A TYR 92 O ? ? ? 1_555 E NA . NA ? ? A TYR 91 A NA 404 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc7 metalc ? ? A ASN 93 O ? ? ? 1_555 E NA . NA ? ? A ASN 92 A NA 404 1_555 ? ? ? ? ? ? ? 2.968 ? ? metalc8 metalc ? ? A ILE 95 O ? ? ? 1_555 E NA . NA ? ? A ILE 94 A NA 404 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc9 metalc ? ? A HIS 99 NE2 B ? ? 1_555 F ZN . ZN ? ? A HIS 98 A ZN 405 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc10 metalc ? ? A GLU 137 OE1 ? ? ? 1_555 E NA . NA ? ? A GLU 136 A NA 404 1_555 ? ? ? ? ? ? ? 2.546 ? ? metalc11 metalc ? ? C AZA . N9 ? ? ? 1_555 F ZN . ZN ? ? A AZA 402 A ZN 405 1_555 ? ? ? ? ? ? ? 2.051 ? ? metalc12 metalc ? ? C AZA . N3 ? ? ? 1_555 G ZN . ZN ? ? A AZA 402 A ZN 406 1_555 ? ? ? ? ? ? ? 2.034 ? ? metalc13 metalc ? ? D AZA . N3 ? ? ? 1_555 F ZN . ZN ? ? A AZA 403 A ZN 405 1_555 ? ? ? ? ? ? ? 1.997 ? ? metalc14 metalc ? ? D AZA . N9 ? ? ? 1_555 G ZN . ZN ? ? A AZA 403 A ZN 406 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc15 metalc ? ? E NA . NA ? ? ? 1_555 J DOD . O ? ? A NA 404 A DOD 575 1_555 ? ? ? ? ? ? ? 2.443 ? ? metalc16 metalc ? ? F ZN . ZN ? ? ? 1_555 J DOD . O A ? A ZN 405 A DOD 1027 1_555 ? ? ? ? ? ? ? 2.511 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 75 A . ? THR 74 A PRO 76 A ? PRO 75 A 1 -9.19 2 THR 75 A . ? THR 74 A PRO 76 A ? PRO 75 A 1 -6.61 3 ASP 284 A . ? ASP 283 A PRO 285 A ? PRO 284 A 1 -10.21 4 ASP 284 A . ? ASP 283 A PRO 285 A ? PRO 284 A 1 -6.97 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 9 ? LYS A 21 ? TYR A 8 LYS A 20 A 2 GLN A 28 ? GLY A 41 ? GLN A 27 GLY A 40 A 3 ILE A 95 ? HIS A 105 ? ILE A 94 HIS A 104 A 4 LYS A 128 ? VAL A 136 ? LYS A 127 VAL A 135 A 5 ILE A 141 ? LYS A 154 ? ILE A 140 LYS A 153 A 6 LEU A 179 ? TRP A 189 ? LEU A 178 TRP A 188 A 7 ILE A 246 ? ASN A 255 ? ILE A 245 ASN A 254 A 8 GLY A 287 ? GLY A 294 ? GLY A 286 GLY A 293 B 1 THR A 108 ? ILE A 112 ? THR A 107 ILE A 111 B 2 LYS A 115 ? ILE A 122 ? LYS A 114 ILE A 121 C 1 TYR A 258 ? GLU A 260 ? TYR A 257 GLU A 259 C 2 PHE A 279 ? PRO A 281 ? PHE A 278 PRO A 280 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 9 ? N TYR A 8 O LEU A 39 ? O LEU A 38 A 2 3 N LEU A 38 ? N LEU A 37 O HIS A 99 ? O HIS A 98 A 3 4 N VAL A 100 ? N VAL A 99 O VAL A 133 ? O VAL A 132 A 4 5 N ASP A 134 ? N ASP A 133 O ASP A 142 ? O ASP A 141 A 5 6 N LEU A 150 ? N LEU A 149 O VAL A 183 ? O VAL A 182 A 6 7 N GLN A 188 ? N GLN A 187 O GLU A 247 ? O GLU A 246 A 7 8 N VAL A 249 ? N VAL A 248 O VAL A 293 ? O VAL A 292 B 1 2 N MET A 110 ? N MET A 109 O HIS A 117 ? O HIS A 116 C 1 2 N PHE A 259 ? N PHE A 258 O ALA A 280 ? O ALA A 279 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A AZA 401 ? 11 'BINDING SITE FOR RESIDUE AZA A 401' AC2 Software A AZA 402 ? 11 'BINDING SITE FOR RESIDUE AZA A 402' AC3 Software A AZA 403 ? 14 'BINDING SITE FOR RESIDUE AZA A 403' AC4 Software A NA 404 ? 6 'BINDING SITE FOR RESIDUE NA A 404' AC5 Software A ZN 405 ? 6 'BINDING SITE FOR RESIDUE ZN A 405' AC6 Software A ZN 406 ? 5 'BINDING SITE FOR RESIDUE ZN A 406' AC7 Software A GOL 407 ? 7 'BINDING SITE FOR RESIDUE GOL A 407' AC8 Software A CL 408 ? 4 'BINDING SITE FOR RESIDUE CL A 408' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ILE A 55 ? ILE A 54 . ? 2_455 ? 2 AC1 11 ALA A 57 ? ALA A 56 . ? 2_455 ? 3 AC1 11 THR A 58 ? THR A 57 . ? 2_455 ? 4 AC1 11 PHE A 160 ? PHE A 159 . ? 1_555 ? 5 AC1 11 ARG A 177 ? ARG A 176 . ? 1_555 ? 6 AC1 11 SER A 227 ? SER A 226 . ? 1_555 ? 7 AC1 11 VAL A 228 ? VAL A 227 . ? 1_555 ? 8 AC1 11 GLN A 229 ? GLN A 228 . ? 1_555 ? 9 AC1 11 ASN A 255 ? ASN A 254 . ? 1_555 ? 10 AC1 11 CL I . ? CL A 408 . ? 1_555 ? 11 AC1 11 DOD J . ? DOD A 541 . ? 1_555 ? 12 AC2 11 ASP A 12 ? ASP A 11 . ? 1_555 ? 13 AC2 11 CYS A 36 ? CYS A 35 . ? 1_555 ? 14 AC2 11 LEU A 38 ? LEU A 37 . ? 1_555 ? 15 AC2 11 HIS A 99 ? HIS A 98 . ? 1_555 ? 16 AC2 11 LEU A 288 ? LEU A 287 . ? 2_455 ? 17 AC2 11 LYS A 290 ? LYS A 289 . ? 2_455 ? 18 AC2 11 AZA D . ? AZA A 403 . ? 1_555 ? 19 AC2 11 ZN F . ? ZN A 405 . ? 1_555 ? 20 AC2 11 ZN G . ? ZN A 406 . ? 1_555 ? 21 AC2 11 DOD J . ? DOD A 821 . ? 1_555 ? 22 AC2 11 DOD J . ? DOD A 929 . ? 2_455 ? 23 AC3 14 ASP A 12 ? ASP A 11 . ? 1_555 ? 24 AC3 14 CYS A 36 ? CYS A 35 . ? 1_555 ? 25 AC3 14 HIS A 99 ? HIS A 98 . ? 1_555 ? 26 AC3 14 ASN A 101 ? ASN A 100 . ? 1_555 ? 27 AC3 14 GLN A 132 ? GLN A 131 . ? 1_555 ? 28 AC3 14 AZA C . ? AZA A 402 . ? 1_555 ? 29 AC3 14 ZN F . ? ZN A 405 . ? 1_555 ? 30 AC3 14 ZN G . ? ZN A 406 . ? 1_555 ? 31 AC3 14 DOD J . ? DOD A 722 . ? 1_555 ? 32 AC3 14 DOD J . ? DOD A 800 . ? 1_555 ? 33 AC3 14 DOD J . ? DOD A 849 . ? 1_555 ? 34 AC3 14 DOD J . ? DOD A 885 . ? 1_555 ? 35 AC3 14 DOD J . ? DOD A 967 . ? 1_555 ? 36 AC3 14 DOD J . ? DOD A 1010 . ? 1_555 ? 37 AC4 6 ILE A 89 ? ILE A 88 . ? 1_555 ? 38 AC4 6 TYR A 92 ? TYR A 91 . ? 1_555 ? 39 AC4 6 ASN A 93 ? ASN A 92 . ? 1_555 ? 40 AC4 6 ILE A 95 ? ILE A 94 . ? 1_555 ? 41 AC4 6 GLU A 137 ? GLU A 136 . ? 1_555 ? 42 AC4 6 DOD J . ? DOD A 575 . ? 1_555 ? 43 AC5 6 CYS A 36 ? CYS A 35 . ? 1_555 ? 44 AC5 6 HIS A 99 ? HIS A 98 . ? 1_555 ? 45 AC5 6 AZA C . ? AZA A 402 . ? 1_555 ? 46 AC5 6 AZA D . ? AZA A 403 . ? 1_555 ? 47 AC5 6 ZN G . ? ZN A 406 . ? 1_555 ? 48 AC5 6 DOD J . ? DOD A 1027 . ? 1_555 ? 49 AC6 5 ASP A 12 ? ASP A 11 . ? 1_555 ? 50 AC6 5 CYS A 36 ? CYS A 35 . ? 1_555 ? 51 AC6 5 AZA C . ? AZA A 402 . ? 1_555 ? 52 AC6 5 AZA D . ? AZA A 403 . ? 1_555 ? 53 AC6 5 ZN F . ? ZN A 405 . ? 1_555 ? 54 AC7 7 PRO A 281 ? PRO A 280 . ? 3_455 ? 55 AC7 7 GLN A 282 ? GLN A 281 . ? 3_455 ? 56 AC7 7 SER A 283 ? SER A 282 . ? 3_455 ? 57 AC7 7 ASP A 284 ? ASP A 283 . ? 1_555 ? 58 AC7 7 ASP A 284 ? ASP A 283 . ? 3_455 ? 59 AC7 7 PRO A 285 ? PRO A 284 . ? 1_555 ? 60 AC7 7 DOD J . ? DOD A 566 . ? 3_455 ? 61 AC8 4 THR A 58 ? THR A 57 . ? 2_455 ? 62 AC8 4 ASN A 255 ? ASN A 254 . ? 1_555 ? 63 AC8 4 GLY A 287 ? GLY A 286 . ? 1_555 ? 64 AC8 4 AZA B . ? AZA A 401 . ? 1_555 ? # _database_PDB_matrix.entry_id 4N9V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4N9V _atom_sites.fract_transf_matrix[1][1] 0.012531 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010517 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009570 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL D H N NA O S ZN # loop_ _database_PDB_caveat.text 'CHIRALITY ERROR AT CG ATOM OF LEU A244, A268.' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 ALA 3 2 2 ALA ALA A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 TYR 9 8 8 TYR TYR A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 ASP 12 11 11 ASP ASP A . n A 1 13 ASN 13 12 12 ASN ASN A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 ARG 15 14 14 ARG ARG A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 TYR 17 16 16 TYR TYR A . n A 1 18 LYS 18 17 17 LYS LYS A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 HIS 20 19 19 HIS HIS A . n A 1 21 LYS 21 20 20 LYS LYS A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 THR 25 24 24 THR THR A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 VAL 27 26 26 VAL VAL A . n A 1 28 GLN 28 27 27 GLN GLN A . n A 1 29 THR 29 28 28 THR THR A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 TYR 31 30 30 TYR TYR A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 MET 33 32 32 MET MET A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 VAL 35 34 34 VAL VAL A . n A 1 36 CYS 36 35 35 CYS CYS A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 GLY 41 40 40 GLY GLY A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 ILE 43 42 42 ILE ILE A . n A 1 44 GLU 44 43 43 GLU GLU A . n A 1 45 THR 45 44 44 THR THR A . n A 1 46 SER 46 45 45 SER SER A . n A 1 47 TYR 47 46 46 TYR TYR A . n A 1 48 THR 48 47 47 THR THR A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 ASP 51 50 50 ASP ASP A . n A 1 52 ASN 52 51 51 ASN ASN A . n A 1 53 SER 53 52 52 SER SER A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 ASP 59 58 58 ASP ASP A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ILE 61 60 60 ILE ILE A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 ASN 63 62 62 ASN ASN A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 ILE 65 64 64 ILE ILE A . n A 1 66 TYR 66 65 65 TYR TYR A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 LYS 70 69 69 LYS LYS A . n A 1 71 GLN 71 70 70 GLN GLN A . n A 1 72 ASN 72 71 71 ASN ASN A . n A 1 73 PRO 73 72 72 PRO PRO A . n A 1 74 VAL 74 73 73 VAL VAL A . n A 1 75 THR 75 74 74 THR THR A . n A 1 76 PRO 76 75 75 PRO PRO A . n A 1 77 PRO 77 76 76 PRO PRO A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 LEU 79 78 78 LEU LEU A . n A 1 80 PHE 80 79 79 PHE PHE A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 SER 82 81 81 SER SER A . n A 1 83 ILE 83 82 82 ILE ILE A . n A 1 84 LEU 84 83 83 LEU LEU A . n A 1 85 GLY 85 84 84 GLY GLY A . n A 1 86 THR 86 85 85 THR THR A . n A 1 87 HIS 87 86 86 HIS HIS A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 LYS 91 90 90 LYS LYS A . n A 1 92 TYR 92 91 91 TYR TYR A . n A 1 93 ASN 93 92 92 ASN ASN A . n A 1 94 HIS 94 93 93 HIS HIS A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 HIS 96 95 95 HIS HIS A . n A 1 97 ALA 97 96 96 ALA ALA A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 HIS 99 98 98 HIS HIS A . n A 1 100 VAL 100 99 99 VAL VAL A . n A 1 101 ASN 101 100 100 ASN ASN A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 VAL 103 102 102 VAL VAL A . n A 1 104 CYS 104 103 103 CYS CYS A . n A 1 105 HIS 105 104 104 HIS HIS A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 TRP 107 106 106 TRP TRP A . n A 1 108 THR 108 107 107 THR THR A . n A 1 109 ARG 109 108 108 ARG ARG A . n A 1 110 MET 110 109 109 MET MET A . n A 1 111 ASP 111 110 110 ASP ASP A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ASP 113 112 112 ASP ASP A . n A 1 114 GLY 114 113 113 GLY GLY A . n A 1 115 LYS 115 114 114 LYS LYS A . n A 1 116 PRO 116 115 115 PRO PRO A . n A 1 117 HIS 117 116 116 HIS HIS A . n A 1 118 PRO 118 117 117 PRO PRO A . n A 1 119 HIS 119 118 118 HIS HIS A . n A 1 120 SER 120 119 119 SER SER A . n A 1 121 PHE 121 120 120 PHE PHE A . n A 1 122 ILE 122 121 121 ILE ILE A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 ASP 124 123 123 ASP ASP A . n A 1 125 SER 125 124 124 SER SER A . n A 1 126 GLU 126 125 125 GLU GLU A . n A 1 127 GLU 127 126 126 GLU GLU A . n A 1 128 LYS 128 127 127 LYS LYS A . n A 1 129 ARG 129 128 128 ARG ARG A . n A 1 130 ASN 130 129 129 ASN ASN A . n A 1 131 VAL 131 130 130 VAL VAL A . n A 1 132 GLN 132 131 131 GLN GLN A . n A 1 133 VAL 133 132 132 VAL VAL A . n A 1 134 ASP 134 133 133 ASP ASP A . n A 1 135 VAL 135 134 134 VAL VAL A . n A 1 136 VAL 136 135 135 VAL VAL A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 GLY 138 137 137 GLY GLY A . n A 1 139 LYS 139 138 138 LYS LYS A . n A 1 140 GLY 140 139 139 GLY GLY A . n A 1 141 ILE 141 140 140 ILE ILE A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 SER 145 144 144 SER SER A . n A 1 146 SER 146 145 145 SER SER A . n A 1 147 LEU 147 146 146 LEU LEU A . n A 1 148 SER 148 147 147 SER SER A . n A 1 149 GLY 149 148 148 GLY GLY A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 THR 151 150 150 THR THR A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 LYS 154 153 153 LYS LYS A . n A 1 155 SER 155 154 154 SER SER A . n A 1 156 THR 156 155 155 THR THR A . n A 1 157 ASN 157 156 156 ASN ASN A . n A 1 158 SER 158 157 157 SER SER A . n A 1 159 GLN 159 158 158 GLN GLN A . n A 1 160 PHE 160 159 159 PHE PHE A . n A 1 161 TRP 161 160 160 TRP TRP A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 PHE 163 162 162 PHE PHE A . n A 1 164 LEU 164 163 163 LEU LEU A . n A 1 165 ARG 165 164 164 ARG ARG A . n A 1 166 ASP 166 165 165 ASP ASP A . n A 1 167 GLU 167 166 166 GLU GLU A . n A 1 168 TYR 168 167 167 TYR TYR A . n A 1 169 THR 169 168 168 THR THR A . n A 1 170 THR 170 169 169 THR THR A . n A 1 171 LEU 171 170 170 LEU LEU A . n A 1 172 LYS 172 171 171 LYS LYS A . n A 1 173 GLU 173 172 172 GLU GLU A . n A 1 174 THR 174 173 173 THR THR A . n A 1 175 TRP 175 174 174 TRP TRP A . n A 1 176 ASP 176 175 175 ASP ASP A . n A 1 177 ARG 177 176 176 ARG ARG A . n A 1 178 ILE 178 177 177 ILE ILE A . n A 1 179 LEU 179 178 178 LEU LEU A . n A 1 180 SER 180 179 179 SER SER A . n A 1 181 THR 181 180 180 THR THR A . n A 1 182 ASP 182 181 181 ASP ASP A . n A 1 183 VAL 183 182 182 VAL VAL A . n A 1 184 ASP 184 183 183 ASP ASP A . n A 1 185 ALA 185 184 184 ALA ALA A . n A 1 186 THR 186 185 185 THR THR A . n A 1 187 TRP 187 186 186 TRP TRP A . n A 1 188 GLN 188 187 187 GLN GLN A . n A 1 189 TRP 189 188 188 TRP TRP A . n A 1 190 LYS 190 189 189 LYS LYS A . n A 1 191 ASN 191 190 190 ASN ASN A . n A 1 192 PHE 192 191 191 PHE PHE A . n A 1 193 SER 193 192 192 SER SER A . n A 1 194 GLY 194 193 193 GLY GLY A . n A 1 195 LEU 195 194 194 LEU LEU A . n A 1 196 GLN 196 195 195 GLN GLN A . n A 1 197 GLU 197 196 196 GLU GLU A . n A 1 198 VAL 198 197 197 VAL VAL A . n A 1 199 ARG 199 198 198 ARG ARG A . n A 1 200 SER 200 199 199 SER SER A . n A 1 201 HIS 201 200 200 HIS HIS A . n A 1 202 VAL 202 201 201 VAL VAL A . n A 1 203 PRO 203 202 202 PRO PRO A . n A 1 204 LYS 204 203 203 LYS LYS A . n A 1 205 PHE 205 204 204 PHE PHE A . n A 1 206 ASP 206 205 205 ASP ASP A . n A 1 207 ALA 207 206 206 ALA ALA A . n A 1 208 THR 208 207 207 THR THR A . n A 1 209 TRP 209 208 208 TRP TRP A . n A 1 210 ALA 210 209 209 ALA ALA A . n A 1 211 THR 211 210 210 THR THR A . n A 1 212 ALA 212 211 211 ALA ALA A . n A 1 213 ARG 213 212 212 ARG ARG A . n A 1 214 GLU 214 213 213 GLU GLU A . n A 1 215 VAL 215 214 214 VAL VAL A . n A 1 216 THR 216 215 215 THR THR A . n A 1 217 LEU 217 216 216 LEU LEU A . n A 1 218 LYS 218 217 217 LYS LYS A . n A 1 219 THR 219 218 218 THR THR A . n A 1 220 PHE 220 219 219 PHE PHE A . n A 1 221 ALA 221 220 220 ALA ALA A . n A 1 222 GLU 222 221 221 GLU GLU A . n A 1 223 ASP 223 222 222 ASP ASP A . n A 1 224 ASN 224 223 223 ASN ASN A . n A 1 225 SER 225 224 224 SER SER A . n A 1 226 ALA 226 225 225 ALA ALA A . n A 1 227 SER 227 226 226 SER SER A . n A 1 228 VAL 228 227 227 VAL VAL A . n A 1 229 GLN 229 228 228 GLN GLN A . n A 1 230 ALA 230 229 229 ALA ALA A . n A 1 231 THR 231 230 230 THR THR A . n A 1 232 MET 232 231 231 MET MET A . n A 1 233 TYR 233 232 232 TYR TYR A . n A 1 234 LYS 234 233 233 LYS LYS A . n A 1 235 MET 235 234 234 MET MET A . n A 1 236 ALA 236 235 235 ALA ALA A . n A 1 237 GLU 237 236 236 GLU GLU A . n A 1 238 GLN 238 237 237 GLN GLN A . n A 1 239 ILE 239 238 238 ILE ILE A . n A 1 240 LEU 240 239 239 LEU LEU A . n A 1 241 ALA 241 240 240 ALA ALA A . n A 1 242 ARG 242 241 241 ARG ARG A . n A 1 243 GLN 243 242 242 GLN GLN A . n A 1 244 GLN 244 243 243 GLN GLN A . n A 1 245 LEU 245 244 244 LEU LEU A . n A 1 246 ILE 246 245 245 ILE ILE A . n A 1 247 GLU 247 246 246 GLU GLU A . n A 1 248 THR 248 247 247 THR THR A . n A 1 249 VAL 249 248 248 VAL VAL A . n A 1 250 GLU 250 249 249 GLU GLU A . n A 1 251 TYR 251 250 250 TYR TYR A . n A 1 252 SER 252 251 251 SER SER A . n A 1 253 LEU 253 252 252 LEU LEU A . n A 1 254 PRO 254 253 253 PRO PRO A . n A 1 255 ASN 255 254 254 ASN ASN A . n A 1 256 LYS 256 255 255 LYS LYS A . n A 1 257 HIS 257 256 256 HIS HIS A . n A 1 258 TYR 258 257 257 TYR TYR A . n A 1 259 PHE 259 258 258 PHE PHE A . n A 1 260 GLU 260 259 259 GLU GLU A . n A 1 261 ILE 261 260 260 ILE ILE A . n A 1 262 ASP 262 261 261 ASP ASP A . n A 1 263 LEU 263 262 262 LEU LEU A . n A 1 264 SER 264 263 263 SER SER A . n A 1 265 TRP 265 264 264 TRP TRP A . n A 1 266 HIS 266 265 265 HIS HIS A . n A 1 267 LYS 267 266 266 LYS LYS A . n A 1 268 GLY 268 267 267 GLY GLY A . n A 1 269 LEU 269 268 268 LEU LEU A . n A 1 270 GLN 270 269 269 GLN GLN A . n A 1 271 ASN 271 270 270 ASN ASN A . n A 1 272 THR 272 271 271 THR THR A . n A 1 273 GLY 273 272 272 GLY GLY A . n A 1 274 LYS 274 273 273 LYS LYS A . n A 1 275 ASN 275 274 274 ASN ASN A . n A 1 276 ALA 276 275 275 ALA ALA A . n A 1 277 GLU 277 276 276 GLU GLU A . n A 1 278 VAL 278 277 277 VAL VAL A . n A 1 279 PHE 279 278 278 PHE PHE A . n A 1 280 ALA 280 279 279 ALA ALA A . n A 1 281 PRO 281 280 280 PRO PRO A . n A 1 282 GLN 282 281 281 GLN GLN A . n A 1 283 SER 283 282 282 SER SER A . n A 1 284 ASP 284 283 283 ASP ASP A . n A 1 285 PRO 285 284 284 PRO PRO A . n A 1 286 ASN 286 285 285 ASN ASN A . n A 1 287 GLY 287 286 286 GLY GLY A . n A 1 288 LEU 288 287 287 LEU LEU A . n A 1 289 ILE 289 288 288 ILE ILE A . n A 1 290 LYS 290 289 289 LYS LYS A . n A 1 291 CYS 291 290 290 CYS CYS A . n A 1 292 THR 292 291 291 THR THR A . n A 1 293 VAL 293 292 292 VAL VAL A . n A 1 294 GLY 294 293 293 GLY GLY A . n A 1 295 ARG 295 294 294 ARG ARG A . n A 1 296 SER 296 295 295 SER SER A . n A 1 297 SER 297 296 ? ? ? A . n A 1 298 LEU 298 297 ? ? ? A . n A 1 299 LYS 299 298 ? ? ? A . n A 1 300 SER 300 299 ? ? ? A . n A 1 301 LYS 301 300 ? ? ? A . n A 1 302 LEU 302 301 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AZA 1 401 1 AZA AZA A . C 2 AZA 1 402 2 AZA AZA A . D 2 AZA 1 403 3 AZA AZA A . E 3 NA 1 404 1 NA NA A . F 4 ZN 1 405 2 ZN ZN A . G 4 ZN 1 406 3 ZN ZN A . H 5 GOL 1 407 1 GOL GOL A . I 6 CL 1 408 1 CL CL A . J 7 DOD 1 501 3 DOD DOD A . J 7 DOD 2 502 4 DOD DOD A . J 7 DOD 3 503 6 DOD DOD A . J 7 DOD 4 504 7 DOD DOD A . J 7 DOD 5 505 8 DOD DOD A . J 7 DOD 6 506 9 DOD DOD A . J 7 DOD 7 507 10 DOD DOD A . J 7 DOD 8 508 11 DOD DOD A . J 7 DOD 9 509 12 DOD DOD A . J 7 DOD 10 510 13 DOD DOD A . J 7 DOD 11 511 14 DOD DOD A . J 7 DOD 12 512 15 DOD DOD A . J 7 DOD 13 513 16 DOD DOD A . J 7 DOD 14 514 17 DOD DOD A . J 7 DOD 15 515 19 DOD DOD A . J 7 DOD 16 516 20 DOD DOD A . J 7 DOD 17 517 21 DOD DOD A . J 7 DOD 18 518 22 DOD DOD A . J 7 DOD 19 519 23 DOD DOD A . J 7 DOD 20 520 24 DOD DOD A . J 7 DOD 21 521 25 DOD DOD A . J 7 DOD 22 522 26 DOD DOD A . J 7 DOD 23 523 27 DOD DOD A . J 7 DOD 24 524 29 DOD DOD A . J 7 DOD 25 525 30 DOD DOD A . J 7 DOD 26 526 31 DOD DOD A . J 7 DOD 27 527 32 DOD DOD A . J 7 DOD 28 528 33 DOD DOD A . J 7 DOD 29 529 34 DOD DOD A . J 7 DOD 30 530 35 DOD DOD A . J 7 DOD 31 531 36 DOD DOD A . J 7 DOD 32 532 37 DOD DOD A . J 7 DOD 33 533 38 DOD DOD A . J 7 DOD 34 534 39 DOD DOD A . J 7 DOD 35 535 40 DOD DOD A . J 7 DOD 36 536 41 DOD DOD A . J 7 DOD 37 537 42 DOD DOD A . J 7 DOD 38 538 43 DOD DOD A . J 7 DOD 39 539 44 DOD DOD A . J 7 DOD 40 540 45 DOD DOD A . J 7 DOD 41 541 2 DOD DOD A . J 7 DOD 42 542 47 DOD DOD A . J 7 DOD 43 543 48 DOD DOD A . J 7 DOD 44 544 49 DOD DOD A . J 7 DOD 45 545 50 DOD DOD A . J 7 DOD 46 546 51 DOD DOD A . J 7 DOD 47 547 52 DOD DOD A . J 7 DOD 48 548 53 DOD DOD A . J 7 DOD 49 549 54 DOD DOD A . J 7 DOD 50 550 55 DOD DOD A . J 7 DOD 51 551 56 DOD DOD A . J 7 DOD 52 552 57 DOD DOD A . J 7 DOD 53 553 58 DOD DOD A . J 7 DOD 54 554 59 DOD DOD A . J 7 DOD 55 555 61 DOD DOD A . J 7 DOD 56 556 62 DOD DOD A . J 7 DOD 57 557 64 DOD DOD A . J 7 DOD 58 558 65 DOD DOD A . J 7 DOD 59 559 66 DOD DOD A . J 7 DOD 60 560 67 DOD DOD A . J 7 DOD 61 561 68 DOD DOD A . J 7 DOD 62 562 69 DOD DOD A . J 7 DOD 63 563 70 DOD DOD A . J 7 DOD 64 564 71 DOD DOD A . J 7 DOD 65 565 72 DOD DOD A . J 7 DOD 66 566 73 DOD DOD A . J 7 DOD 67 567 74 DOD DOD A . J 7 DOD 68 568 75 DOD DOD A . J 7 DOD 69 569 76 DOD DOD A . J 7 DOD 70 570 77 DOD DOD A . J 7 DOD 71 571 78 DOD DOD A . J 7 DOD 72 572 79 DOD DOD A . J 7 DOD 73 573 80 DOD DOD A . J 7 DOD 74 574 81 DOD DOD A . J 7 DOD 75 575 82 DOD DOD A . J 7 DOD 76 576 83 DOD DOD A . J 7 DOD 77 577 84 DOD DOD A . J 7 DOD 78 578 85 DOD DOD A . J 7 DOD 79 579 86 DOD DOD A . J 7 DOD 80 580 87 DOD DOD A . J 7 DOD 81 581 88 DOD DOD A . J 7 DOD 82 582 89 DOD DOD A . J 7 DOD 83 583 90 DOD DOD A . J 7 DOD 84 584 91 DOD DOD A . J 7 DOD 85 585 92 DOD DOD A . J 7 DOD 86 586 93 DOD DOD A . J 7 DOD 87 587 94 DOD DOD A . J 7 DOD 88 588 95 DOD DOD A . J 7 DOD 89 589 96 DOD DOD A . J 7 DOD 90 590 98 DOD DOD A . J 7 DOD 91 591 99 DOD DOD A . J 7 DOD 92 592 100 DOD DOD A . J 7 DOD 93 593 101 DOD DOD A . J 7 DOD 94 594 102 DOD DOD A . J 7 DOD 95 595 103 DOD DOD A . J 7 DOD 96 596 104 DOD DOD A . J 7 DOD 97 597 105 DOD DOD A . J 7 DOD 98 598 106 DOD DOD A . J 7 DOD 99 599 107 DOD DOD A . J 7 DOD 100 600 108 DOD DOD A . J 7 DOD 101 601 109 DOD DOD A . J 7 DOD 102 602 110 DOD DOD A . J 7 DOD 103 603 111 DOD DOD A . J 7 DOD 104 604 112 DOD DOD A . J 7 DOD 105 605 113 DOD DOD A . J 7 DOD 106 606 114 DOD DOD A . J 7 DOD 107 607 115 DOD DOD A . J 7 DOD 108 608 116 DOD DOD A . J 7 DOD 109 609 117 DOD DOD A . J 7 DOD 110 610 118 DOD DOD A . J 7 DOD 111 611 119 DOD DOD A . J 7 DOD 112 612 120 DOD DOD A . J 7 DOD 113 613 121 DOD DOD A . J 7 DOD 114 614 122 DOD DOD A . J 7 DOD 115 615 123 DOD DOD A . J 7 DOD 116 616 124 DOD DOD A . J 7 DOD 117 617 125 DOD DOD A . J 7 DOD 118 618 127 DOD DOD A . J 7 DOD 119 619 128 DOD DOD A . J 7 DOD 120 620 129 DOD DOD A . J 7 DOD 121 621 130 DOD DOD A . J 7 DOD 122 622 131 DOD DOD A . J 7 DOD 123 623 132 DOD DOD A . J 7 DOD 124 624 133 DOD DOD A . J 7 DOD 125 625 134 DOD DOD A . J 7 DOD 126 626 135 DOD DOD A . J 7 DOD 127 627 136 DOD DOD A . J 7 DOD 128 628 137 DOD DOD A . J 7 DOD 129 629 138 DOD DOD A . J 7 DOD 130 630 139 DOD DOD A . J 7 DOD 131 631 140 DOD DOD A . J 7 DOD 132 632 141 DOD DOD A . J 7 DOD 133 633 142 DOD DOD A . J 7 DOD 134 634 144 DOD DOD A . J 7 DOD 135 635 145 DOD DOD A . J 7 DOD 136 636 147 DOD DOD A . J 7 DOD 137 637 148 DOD DOD A . J 7 DOD 138 638 149 DOD DOD A . J 7 DOD 139 639 150 DOD DOD A . J 7 DOD 140 640 151 DOD DOD A . J 7 DOD 141 641 152 DOD DOD A . J 7 DOD 142 642 153 DOD DOD A . J 7 DOD 143 643 154 DOD DOD A . J 7 DOD 144 644 155 DOD DOD A . J 7 DOD 145 645 156 DOD DOD A . J 7 DOD 146 646 157 DOD DOD A . J 7 DOD 147 647 159 DOD DOD A . J 7 DOD 148 648 160 DOD DOD A . J 7 DOD 149 649 161 DOD DOD A . J 7 DOD 150 650 162 DOD DOD A . J 7 DOD 151 651 163 DOD DOD A . J 7 DOD 152 652 165 DOD DOD A . J 7 DOD 153 653 166 DOD DOD A . J 7 DOD 154 654 167 DOD DOD A . J 7 DOD 155 655 168 DOD DOD A . J 7 DOD 156 656 169 DOD DOD A . J 7 DOD 157 657 170 DOD DOD A . J 7 DOD 158 658 171 DOD DOD A . J 7 DOD 159 659 172 DOD DOD A . J 7 DOD 160 660 174 DOD DOD A . J 7 DOD 161 661 175 DOD DOD A . J 7 DOD 162 662 176 DOD DOD A . J 7 DOD 163 663 177 DOD DOD A . J 7 DOD 164 664 178 DOD DOD A . J 7 DOD 165 665 179 DOD DOD A . J 7 DOD 166 666 180 DOD DOD A . J 7 DOD 167 667 181 DOD DOD A . J 7 DOD 168 668 182 DOD DOD A . J 7 DOD 169 669 183 DOD DOD A . J 7 DOD 170 670 184 DOD DOD A . J 7 DOD 171 671 185 DOD DOD A . J 7 DOD 172 672 186 DOD DOD A . J 7 DOD 173 673 187 DOD DOD A . J 7 DOD 174 674 188 DOD DOD A . J 7 DOD 175 675 189 DOD DOD A . J 7 DOD 176 676 190 DOD DOD A . J 7 DOD 177 677 191 DOD DOD A . J 7 DOD 178 678 192 DOD DOD A . J 7 DOD 179 679 193 DOD DOD A . J 7 DOD 180 680 194 DOD DOD A . J 7 DOD 181 681 195 DOD DOD A . J 7 DOD 182 682 196 DOD DOD A . J 7 DOD 183 683 197 DOD DOD A . J 7 DOD 184 684 198 DOD DOD A . J 7 DOD 185 685 199 DOD DOD A . J 7 DOD 186 686 200 DOD DOD A . J 7 DOD 187 687 201 DOD DOD A . J 7 DOD 188 688 202 DOD DOD A . J 7 DOD 189 689 205 DOD DOD A . J 7 DOD 190 690 206 DOD DOD A . J 7 DOD 191 691 207 DOD DOD A . J 7 DOD 192 692 209 DOD DOD A . J 7 DOD 193 693 210 DOD DOD A . J 7 DOD 194 694 211 DOD DOD A . J 7 DOD 195 695 212 DOD DOD A . J 7 DOD 196 696 214 DOD DOD A . J 7 DOD 197 697 215 DOD DOD A . J 7 DOD 198 698 216 DOD DOD A . J 7 DOD 199 699 218 DOD DOD A . J 7 DOD 200 700 219 DOD DOD A . J 7 DOD 201 701 220 DOD DOD A . J 7 DOD 202 702 221 DOD DOD A . J 7 DOD 203 703 222 DOD DOD A . J 7 DOD 204 704 223 DOD DOD A . J 7 DOD 205 705 224 DOD DOD A . J 7 DOD 206 706 225 DOD DOD A . J 7 DOD 207 707 226 DOD DOD A . J 7 DOD 208 708 227 DOD DOD A . J 7 DOD 209 709 228 DOD DOD A . J 7 DOD 210 710 232 DOD DOD A . J 7 DOD 211 711 233 DOD DOD A . J 7 DOD 212 712 234 DOD DOD A . J 7 DOD 213 713 235 DOD DOD A . J 7 DOD 214 714 236 DOD DOD A . J 7 DOD 215 715 237 DOD DOD A . J 7 DOD 216 716 238 DOD DOD A . J 7 DOD 217 717 239 DOD DOD A . J 7 DOD 218 718 240 DOD DOD A . J 7 DOD 219 719 241 DOD DOD A . J 7 DOD 220 720 243 DOD DOD A . J 7 DOD 221 721 245 DOD DOD A . J 7 DOD 222 722 246 DOD DOD A . J 7 DOD 223 723 247 DOD DOD A . J 7 DOD 224 724 248 DOD DOD A . J 7 DOD 225 725 249 DOD DOD A . J 7 DOD 226 726 250 DOD DOD A . J 7 DOD 227 727 251 DOD DOD A . J 7 DOD 228 728 252 DOD DOD A . J 7 DOD 229 729 253 DOD DOD A . J 7 DOD 230 730 254 DOD DOD A . J 7 DOD 231 731 255 DOD DOD A . J 7 DOD 232 732 256 DOD DOD A . J 7 DOD 233 733 257 DOD DOD A . J 7 DOD 234 734 258 DOD DOD A . J 7 DOD 235 735 260 DOD DOD A . J 7 DOD 236 736 261 DOD DOD A . J 7 DOD 237 737 262 DOD DOD A . J 7 DOD 238 738 263 DOD DOD A . J 7 DOD 239 739 264 DOD DOD A . J 7 DOD 240 740 265 DOD DOD A . J 7 DOD 241 741 266 DOD DOD A . J 7 DOD 242 742 267 DOD DOD A . J 7 DOD 243 743 268 DOD DOD A . J 7 DOD 244 744 269 DOD DOD A . J 7 DOD 245 745 271 DOD DOD A . J 7 DOD 246 746 273 DOD DOD A . J 7 DOD 247 747 274 DOD DOD A . J 7 DOD 248 748 275 DOD DOD A . J 7 DOD 249 749 276 DOD DOD A . J 7 DOD 250 750 277 DOD DOD A . J 7 DOD 251 751 278 DOD DOD A . J 7 DOD 252 752 279 DOD DOD A . J 7 DOD 253 753 281 DOD DOD A . J 7 DOD 254 754 282 DOD DOD A . J 7 DOD 255 755 283 DOD DOD A . J 7 DOD 256 756 284 DOD DOD A . J 7 DOD 257 757 285 DOD DOD A . J 7 DOD 258 758 286 DOD DOD A . J 7 DOD 259 759 287 DOD DOD A . J 7 DOD 260 760 288 DOD DOD A . J 7 DOD 261 761 290 DOD DOD A . J 7 DOD 262 762 291 DOD DOD A . J 7 DOD 263 763 292 DOD DOD A . J 7 DOD 264 764 293 DOD DOD A . J 7 DOD 265 765 294 DOD DOD A . J 7 DOD 266 766 295 DOD DOD A . J 7 DOD 267 767 296 DOD DOD A . J 7 DOD 268 768 297 DOD DOD A . J 7 DOD 269 769 298 DOD DOD A . J 7 DOD 270 770 299 DOD DOD A . J 7 DOD 271 771 300 DOD DOD A . J 7 DOD 272 772 301 DOD DOD A . J 7 DOD 273 773 303 DOD DOD A . J 7 DOD 274 774 304 DOD DOD A . J 7 DOD 275 775 305 DOD DOD A . J 7 DOD 276 776 306 DOD DOD A . J 7 DOD 277 777 308 DOD DOD A . J 7 DOD 278 778 309 DOD DOD A . J 7 DOD 279 779 310 DOD DOD A . J 7 DOD 280 780 311 DOD DOD A . J 7 DOD 281 781 312 DOD DOD A . J 7 DOD 282 782 313 DOD DOD A . J 7 DOD 283 783 314 DOD DOD A . J 7 DOD 284 784 315 DOD DOD A . J 7 DOD 285 785 316 DOD DOD A . J 7 DOD 286 786 317 DOD DOD A . J 7 DOD 287 787 318 DOD DOD A . J 7 DOD 288 788 319 DOD DOD A . J 7 DOD 289 789 320 DOD DOD A . J 7 DOD 290 790 321 DOD DOD A . J 7 DOD 291 791 322 DOD DOD A . J 7 DOD 292 792 323 DOD DOD A . J 7 DOD 293 793 324 DOD DOD A . J 7 DOD 294 794 325 DOD DOD A . J 7 DOD 295 795 326 DOD DOD A . J 7 DOD 296 796 327 DOD DOD A . J 7 DOD 297 797 328 DOD DOD A . J 7 DOD 298 798 329 DOD DOD A . J 7 DOD 299 799 330 DOD DOD A . J 7 DOD 300 800 331 DOD DOD A . J 7 DOD 301 801 333 DOD DOD A . J 7 DOD 302 802 334 DOD DOD A . J 7 DOD 303 803 335 DOD DOD A . J 7 DOD 304 804 336 DOD DOD A . J 7 DOD 305 805 337 DOD DOD A . J 7 DOD 306 806 338 DOD DOD A . J 7 DOD 307 807 339 DOD DOD A . J 7 DOD 308 808 340 DOD DOD A . J 7 DOD 309 809 341 DOD DOD A . J 7 DOD 310 810 342 DOD DOD A . J 7 DOD 311 811 343 DOD DOD A . J 7 DOD 312 812 344 DOD DOD A . J 7 DOD 313 813 345 DOD DOD A . J 7 DOD 314 814 346 DOD DOD A . J 7 DOD 315 815 347 DOD DOD A . J 7 DOD 316 816 348 DOD DOD A . J 7 DOD 317 817 349 DOD DOD A . J 7 DOD 318 818 350 DOD DOD A . J 7 DOD 319 819 351 DOD DOD A . J 7 DOD 320 820 352 DOD DOD A . J 7 DOD 321 821 353 DOD DOD A . J 7 DOD 322 822 354 DOD DOD A . J 7 DOD 323 823 355 DOD DOD A . J 7 DOD 324 824 356 DOD DOD A . J 7 DOD 325 825 357 DOD DOD A . J 7 DOD 326 826 358 DOD DOD A . J 7 DOD 327 827 359 DOD DOD A . J 7 DOD 328 828 360 DOD DOD A . J 7 DOD 329 829 361 DOD DOD A . J 7 DOD 330 830 362 DOD DOD A . J 7 DOD 331 831 363 DOD DOD A . J 7 DOD 332 832 364 DOD DOD A . J 7 DOD 333 833 365 DOD DOD A . J 7 DOD 334 834 366 DOD DOD A . J 7 DOD 335 835 367 DOD DOD A . J 7 DOD 336 836 368 DOD DOD A . J 7 DOD 337 837 369 DOD DOD A . J 7 DOD 338 838 370 DOD DOD A . J 7 DOD 339 839 371 DOD DOD A . J 7 DOD 340 840 372 DOD DOD A . J 7 DOD 341 841 374 DOD DOD A . J 7 DOD 342 842 375 DOD DOD A . J 7 DOD 343 843 376 DOD DOD A . J 7 DOD 344 844 377 DOD DOD A . J 7 DOD 345 845 378 DOD DOD A . J 7 DOD 346 846 379 DOD DOD A . J 7 DOD 347 847 380 DOD DOD A . J 7 DOD 348 848 381 DOD DOD A . J 7 DOD 349 849 382 DOD DOD A . J 7 DOD 350 850 383 DOD DOD A . J 7 DOD 351 851 384 DOD DOD A . J 7 DOD 352 852 385 DOD DOD A . J 7 DOD 353 853 386 DOD DOD A . J 7 DOD 354 854 387 DOD DOD A . J 7 DOD 355 855 388 DOD DOD A . J 7 DOD 356 856 389 DOD DOD A . J 7 DOD 357 857 390 DOD DOD A . J 7 DOD 358 858 391 DOD DOD A . J 7 DOD 359 859 392 DOD DOD A . J 7 DOD 360 860 393 DOD DOD A . J 7 DOD 361 861 394 DOD DOD A . J 7 DOD 362 862 395 DOD DOD A . J 7 DOD 363 863 396 DOD DOD A . J 7 DOD 364 864 397 DOD DOD A . J 7 DOD 365 865 398 DOD DOD A . J 7 DOD 366 866 399 DOD DOD A . J 7 DOD 367 867 400 DOD DOD A . J 7 DOD 368 868 402 DOD DOD A . J 7 DOD 369 869 404 DOD DOD A . J 7 DOD 370 870 406 DOD DOD A . J 7 DOD 371 871 407 DOD DOD A . J 7 DOD 372 872 408 DOD DOD A . J 7 DOD 373 873 409 DOD DOD A . J 7 DOD 374 874 410 DOD DOD A . J 7 DOD 375 875 411 DOD DOD A . J 7 DOD 376 876 413 DOD DOD A . J 7 DOD 377 877 414 DOD DOD A . J 7 DOD 378 878 415 DOD DOD A . J 7 DOD 379 879 416 DOD DOD A . J 7 DOD 380 880 417 DOD DOD A . J 7 DOD 381 881 418 DOD DOD A . J 7 DOD 382 882 419 DOD DOD A . J 7 DOD 383 883 420 DOD DOD A . J 7 DOD 384 884 421 DOD DOD A . J 7 DOD 385 885 422 DOD DOD A . J 7 DOD 386 886 423 DOD DOD A . J 7 DOD 387 887 424 DOD DOD A . J 7 DOD 388 888 425 DOD DOD A . J 7 DOD 389 889 426 DOD DOD A . J 7 DOD 390 890 428 DOD DOD A . J 7 DOD 391 891 429 DOD DOD A . J 7 DOD 392 892 430 DOD DOD A . J 7 DOD 393 893 431 DOD DOD A . J 7 DOD 394 894 432 DOD DOD A . J 7 DOD 395 895 433 DOD DOD A . J 7 DOD 396 896 434 DOD DOD A . J 7 DOD 397 897 435 DOD DOD A . J 7 DOD 398 898 436 DOD DOD A . J 7 DOD 399 899 437 DOD DOD A . J 7 DOD 400 900 438 DOD DOD A . J 7 DOD 401 901 439 DOD DOD A . J 7 DOD 402 902 440 DOD DOD A . J 7 DOD 403 903 441 DOD DOD A . J 7 DOD 404 904 442 DOD DOD A . J 7 DOD 405 905 443 DOD DOD A . J 7 DOD 406 906 444 DOD DOD A . J 7 DOD 407 907 445 DOD DOD A . J 7 DOD 408 908 446 DOD DOD A . J 7 DOD 409 909 447 DOD DOD A . J 7 DOD 410 910 448 DOD DOD A . J 7 DOD 411 911 449 DOD DOD A . J 7 DOD 412 912 450 DOD DOD A . J 7 DOD 413 913 451 DOD DOD A . J 7 DOD 414 914 452 DOD DOD A . J 7 DOD 415 915 453 DOD DOD A . J 7 DOD 416 916 454 DOD DOD A . J 7 DOD 417 917 455 DOD DOD A . J 7 DOD 418 918 456 DOD DOD A . J 7 DOD 419 919 458 DOD DOD A . J 7 DOD 420 920 459 DOD DOD A . J 7 DOD 421 921 460 DOD DOD A . J 7 DOD 422 922 461 DOD DOD A . J 7 DOD 423 923 462 DOD DOD A . J 7 DOD 424 924 463 DOD DOD A . J 7 DOD 425 925 464 DOD DOD A . J 7 DOD 426 926 465 DOD DOD A . J 7 DOD 427 927 466 DOD DOD A . J 7 DOD 428 928 467 DOD DOD A . J 7 DOD 429 929 468 DOD DOD A . J 7 DOD 430 930 470 DOD DOD A . J 7 DOD 431 931 471 DOD DOD A . J 7 DOD 432 932 472 DOD DOD A . J 7 DOD 433 933 473 DOD DOD A . J 7 DOD 434 934 474 DOD DOD A . J 7 DOD 435 935 475 DOD DOD A . J 7 DOD 436 936 476 DOD DOD A . J 7 DOD 437 937 477 DOD DOD A . J 7 DOD 438 938 478 DOD DOD A . J 7 DOD 439 939 480 DOD DOD A . J 7 DOD 440 940 481 DOD DOD A . J 7 DOD 441 941 482 DOD DOD A . J 7 DOD 442 942 483 DOD DOD A . J 7 DOD 443 943 484 DOD DOD A . J 7 DOD 444 944 485 DOD DOD A . J 7 DOD 445 945 486 DOD DOD A . J 7 DOD 446 946 487 DOD DOD A . J 7 DOD 447 947 488 DOD DOD A . J 7 DOD 448 948 489 DOD DOD A . J 7 DOD 449 949 490 DOD DOD A . J 7 DOD 450 950 491 DOD DOD A . J 7 DOD 451 951 492 DOD DOD A . J 7 DOD 452 952 493 DOD DOD A . J 7 DOD 453 953 494 DOD DOD A . J 7 DOD 454 954 495 DOD DOD A . J 7 DOD 455 955 496 DOD DOD A . J 7 DOD 456 956 498 DOD DOD A . J 7 DOD 457 957 499 DOD DOD A . J 7 DOD 458 958 501 DOD DOD A . J 7 DOD 459 959 503 DOD DOD A . J 7 DOD 460 960 504 DOD DOD A . J 7 DOD 461 961 505 DOD DOD A . J 7 DOD 462 962 506 DOD DOD A . J 7 DOD 463 963 507 DOD DOD A . J 7 DOD 464 964 508 DOD DOD A . J 7 DOD 465 965 509 DOD DOD A . J 7 DOD 466 966 510 DOD DOD A . J 7 DOD 467 967 511 DOD DOD A . J 7 DOD 468 968 513 DOD DOD A . J 7 DOD 469 969 514 DOD DOD A . J 7 DOD 470 970 515 DOD DOD A . J 7 DOD 471 971 516 DOD DOD A . J 7 DOD 472 972 517 DOD DOD A . J 7 DOD 473 973 518 DOD DOD A . J 7 DOD 474 974 521 DOD DOD A . J 7 DOD 475 975 522 DOD DOD A . J 7 DOD 476 976 523 DOD DOD A . J 7 DOD 477 977 524 DOD DOD A . J 7 DOD 478 978 525 DOD DOD A . J 7 DOD 479 979 526 DOD DOD A . J 7 DOD 480 980 527 DOD DOD A . J 7 DOD 481 981 528 DOD DOD A . J 7 DOD 482 982 529 DOD DOD A . J 7 DOD 483 983 530 DOD DOD A . J 7 DOD 484 984 532 DOD DOD A . J 7 DOD 485 985 533 DOD DOD A . J 7 DOD 486 986 534 DOD DOD A . J 7 DOD 487 987 537 DOD DOD A . J 7 DOD 488 988 538 DOD DOD A . J 7 DOD 489 989 539 DOD DOD A . J 7 DOD 490 990 540 DOD DOD A . J 7 DOD 491 991 541 DOD DOD A . J 7 DOD 492 992 544 DOD DOD A . J 7 DOD 493 993 545 DOD DOD A . J 7 DOD 494 994 546 DOD DOD A . J 7 DOD 495 995 547 DOD DOD A . J 7 DOD 496 996 548 DOD DOD A . J 7 DOD 497 997 549 DOD DOD A . J 7 DOD 498 998 550 DOD DOD A . J 7 DOD 499 999 552 DOD DOD A . J 7 DOD 500 1000 554 DOD DOD A . J 7 DOD 501 1001 557 DOD DOD A . J 7 DOD 502 1002 559 DOD DOD A . J 7 DOD 503 1003 560 DOD DOD A . J 7 DOD 504 1004 562 DOD DOD A . J 7 DOD 505 1005 563 DOD DOD A . J 7 DOD 506 1006 564 DOD DOD A . J 7 DOD 507 1007 565 DOD DOD A . J 7 DOD 508 1008 567 DOD DOD A . J 7 DOD 509 1009 568 DOD DOD A . J 7 DOD 510 1010 569 DOD DOD A . J 7 DOD 511 1011 574 DOD DOD A . J 7 DOD 512 1012 575 DOD DOD A . J 7 DOD 513 1013 576 DOD DOD A . J 7 DOD 514 1014 577 DOD DOD A . J 7 DOD 515 1015 578 DOD DOD A . J 7 DOD 516 1016 579 DOD DOD A . J 7 DOD 517 1017 581 DOD DOD A . J 7 DOD 518 1018 582 DOD DOD A . J 7 DOD 519 1019 583 DOD DOD A . J 7 DOD 520 1020 584 DOD DOD A . J 7 DOD 521 1021 586 DOD DOD A . J 7 DOD 522 1022 587 DOD DOD A . J 7 DOD 523 1023 588 DOD DOD A . J 7 DOD 524 1024 589 DOD DOD A . J 7 DOD 525 1025 590 DOD DOD A . J 7 DOD 526 1026 591 DOD DOD A . J 7 DOD 527 1027 592 DOD DOD A . J 7 DOD 528 1028 593 DOD DOD A . J 7 DOD 529 1029 594 DOD DOD A . J 7 DOD 530 1030 595 DOD DOD A . J 7 DOD 531 1031 596 DOD DOD A . J 7 DOD 532 1032 597 DOD DOD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 24760 ? 1 MORE -153 ? 1 'SSA (A^2)' 41290 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -79.8000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_455 -x-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -79.8000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id DOD _pdbx_struct_special_symmetry.auth_seq_id 774 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id J _pdbx_struct_special_symmetry.label_comp_id DOD _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 B A ASP 12 ? A ASP 11 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 SG B A CYS 36 ? A CYS 35 ? 1_555 108.7 ? 2 OD2 B A ASP 12 ? A ASP 11 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 SG A A CYS 36 ? A CYS 35 ? 1_555 85.1 ? 3 SG B A CYS 36 ? A CYS 35 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 SG A A CYS 36 ? A CYS 35 ? 1_555 23.6 ? 4 OD2 B A ASP 12 ? A ASP 11 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 N3 ? C AZA . ? A AZA 402 ? 1_555 107.3 ? 5 SG B A CYS 36 ? A CYS 35 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 N3 ? C AZA . ? A AZA 402 ? 1_555 110.3 ? 6 SG A A CYS 36 ? A CYS 35 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 N3 ? C AZA . ? A AZA 402 ? 1_555 119.9 ? 7 OD2 B A ASP 12 ? A ASP 11 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 N9 ? D AZA . ? A AZA 403 ? 1_555 121.4 ? 8 SG B A CYS 36 ? A CYS 35 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 N9 ? D AZA . ? A AZA 403 ? 1_555 103.9 ? 9 SG A A CYS 36 ? A CYS 35 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 N9 ? D AZA . ? A AZA 403 ? 1_555 117.8 ? 10 N3 ? C AZA . ? A AZA 402 ? 1_555 ZN ? G ZN . ? A ZN 406 ? 1_555 N9 ? D AZA . ? A AZA 403 ? 1_555 104.9 ? 11 SG B A CYS 36 ? A CYS 35 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 NE2 B A HIS 99 ? A HIS 98 ? 1_555 109.0 ? 12 SG B A CYS 36 ? A CYS 35 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 N9 ? C AZA . ? A AZA 402 ? 1_555 104.4 ? 13 NE2 B A HIS 99 ? A HIS 98 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 N9 ? C AZA . ? A AZA 402 ? 1_555 106.4 ? 14 SG B A CYS 36 ? A CYS 35 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 N3 ? D AZA . ? A AZA 403 ? 1_555 109.2 ? 15 NE2 B A HIS 99 ? A HIS 98 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 N3 ? D AZA . ? A AZA 403 ? 1_555 122.0 ? 16 N9 ? C AZA . ? A AZA 402 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 N3 ? D AZA . ? A AZA 403 ? 1_555 104.3 ? 17 SG B A CYS 36 ? A CYS 35 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 O A J DOD . ? A DOD 1027 ? 1_555 71.7 ? 18 NE2 B A HIS 99 ? A HIS 98 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 O A J DOD . ? A DOD 1027 ? 1_555 37.7 ? 19 N9 ? C AZA . ? A AZA 402 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 O A J DOD . ? A DOD 1027 ? 1_555 111.7 ? 20 N3 ? D AZA . ? A AZA 403 ? 1_555 ZN ? F ZN . ? A ZN 405 ? 1_555 O A J DOD . ? A DOD 1027 ? 1_555 142.6 ? 21 O ? A ILE 89 ? A ILE 88 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? A TYR 92 ? A TYR 91 ? 1_555 90.5 ? 22 O ? A ILE 89 ? A ILE 88 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? A ASN 93 ? A ASN 92 ? 1_555 153.1 ? 23 O ? A TYR 92 ? A TYR 91 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? A ASN 93 ? A ASN 92 ? 1_555 74.0 ? 24 O ? A ILE 89 ? A ILE 88 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? A ILE 95 ? A ILE 94 ? 1_555 107.6 ? 25 O ? A TYR 92 ? A TYR 91 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? A ILE 95 ? A ILE 94 ? 1_555 87.8 ? 26 O ? A ASN 93 ? A ASN 92 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? A ILE 95 ? A ILE 94 ? 1_555 93.9 ? 27 O ? A ILE 89 ? A ILE 88 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 OE1 ? A GLU 137 ? A GLU 136 ? 1_555 103.6 ? 28 O ? A TYR 92 ? A TYR 91 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 OE1 ? A GLU 137 ? A GLU 136 ? 1_555 164.8 ? 29 O ? A ASN 93 ? A ASN 92 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 OE1 ? A GLU 137 ? A GLU 136 ? 1_555 94.9 ? 30 O ? A ILE 95 ? A ILE 94 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 OE1 ? A GLU 137 ? A GLU 136 ? 1_555 82.5 ? 31 O ? A ILE 89 ? A ILE 88 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? J DOD . ? A DOD 575 ? 1_555 83.8 ? 32 O ? A TYR 92 ? A TYR 91 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? J DOD . ? A DOD 575 ? 1_555 105.1 ? 33 O ? A ASN 93 ? A ASN 92 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? J DOD . ? A DOD 575 ? 1_555 79.4 ? 34 O ? A ILE 95 ? A ILE 94 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? J DOD . ? A DOD 575 ? 1_555 163.0 ? 35 OE1 ? A GLU 137 ? A GLU 136 ? 1_555 NA ? E NA . ? A NA 404 ? 1_555 O ? J DOD . ? A DOD 575 ? 1_555 82.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-02-05 2 'Structure model' 1 1 2014-02-26 3 'Structure model' 1 2 2023-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' citation 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_id_ISSN' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.value' 20 3 'Structure model' '_struct_conn.pdbx_dist_value' 21 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 3 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 23 3 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id' 24 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 31 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 34 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 35 3 'Structure model' '_struct_ref_seq_dif.details' 36 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 37 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 38 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MxCuBE 'data collection' . ? 1 MOLREP phasing . ? 2 PHENIX refinement '(phenix.refine: 1.6_289)' ? 3 XDS 'data reduction' . ? 4 XSCALE 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 DZ1 A LYS 10 ? ? DG1 A THR 57 ? ? 1.30 2 1 DH12 A ARG 198 ? ? O A DOD 1017 ? ? 1.56 3 1 OE2 A GLU 125 ? ? O A DOD 684 ? ? 1.99 4 1 NH1 A ARG 198 ? ? O A DOD 1017 ? ? 2.14 5 1 O A DOD 596 ? ? O A DOD 1013 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O3 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GOL _pdbx_validate_symm_contact.auth_seq_id_1 407 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O3 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GOL _pdbx_validate_symm_contact.auth_seq_id_2 407 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_455 _pdbx_validate_symm_contact.dist 2.03 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 268 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 B _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 268 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 B _pdbx_validate_rmsd_angle.auth_atom_id_3 CD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 268 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 B _pdbx_validate_rmsd_angle.angle_value 121.36 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation 10.36 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 118 ? ? -154.41 28.81 2 1 SER A 124 ? A 103.84 139.19 3 1 SER A 124 ? B -174.67 -178.33 4 1 ASP A 175 ? ? -164.34 102.41 5 1 SER A 226 ? ? 178.72 163.95 6 1 ASN A 270 ? ? -141.74 25.78 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 22 ? CG ? A GLU 23 CG 2 1 Y 1 A GLU 22 ? CD ? A GLU 23 CD 3 1 Y 1 A GLU 22 ? OE1 ? A GLU 23 OE1 4 1 Y 1 A GLU 22 ? OE2 ? A GLU 23 OE2 5 1 Y 1 A LYS 23 ? CG ? A LYS 24 CG 6 1 Y 1 A LYS 23 ? CD ? A LYS 24 CD 7 1 Y 1 A LYS 23 ? CE ? A LYS 24 CE 8 1 Y 1 A LYS 23 ? NZ ? A LYS 24 NZ 9 1 Y 1 A LYS 114 ? CD ? A LYS 115 CD 10 1 Y 1 A LYS 114 ? CE ? A LYS 115 CE 11 1 Y 1 A LYS 114 ? NZ ? A LYS 115 NZ 12 1 Y 1 A LYS 138 ? CE ? A LYS 139 CE 13 1 Y 1 A LYS 138 ? NZ ? A LYS 139 NZ 14 1 Y 1 A LYS 143 ? NZ ? A LYS 144 NZ 15 1 Y 1 A LYS 171 ? CE ? A LYS 172 CE 16 1 Y 1 A LYS 171 ? NZ ? A LYS 172 NZ 17 1 Y 1 A LYS 273 ? CD ? A LYS 274 CD 18 1 Y 1 A LYS 273 ? CE ? A LYS 274 CE 19 1 Y 1 A LYS 273 ? NZ ? A LYS 274 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 296 ? A SER 297 2 1 Y 1 A LEU 297 ? A LEU 298 3 1 Y 1 A LYS 298 ? A LYS 299 4 1 Y 1 A SER 299 ? A SER 300 5 1 Y 1 A LYS 300 ? A LYS 301 6 1 Y 1 A LEU 301 ? A LEU 302 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 AZA N1 N Y N 81 AZA C2 C Y N 82 AZA O2 O N N 83 AZA N3 N Y N 84 AZA C4 C Y N 85 AZA C5 C Y N 86 AZA C6 C Y N 87 AZA O6 O N N 88 AZA N7 N Y N 89 AZA N8 N Y N 90 AZA N9 N Y N 91 AZA HN1 H N N 92 AZA HN3 H N N 93 AZA HN9 H N N 94 CL CL CL N N 95 CYS N N N N 96 CYS CA C N R 97 CYS C C N N 98 CYS O O N N 99 CYS CB C N N 100 CYS SG S N N 101 CYS OXT O N N 102 CYS H H N N 103 CYS H2 H N N 104 CYS HA H N N 105 CYS HB2 H N N 106 CYS HB3 H N N 107 CYS HG H N N 108 CYS HXT H N N 109 DOD O O N N 110 DOD D1 D N N 111 DOD D2 D N N 112 GLN N N N N 113 GLN CA C N S 114 GLN C C N N 115 GLN O O N N 116 GLN CB C N N 117 GLN CG C N N 118 GLN CD C N N 119 GLN OE1 O N N 120 GLN NE2 N N N 121 GLN OXT O N N 122 GLN H H N N 123 GLN H2 H N N 124 GLN HA H N N 125 GLN HB2 H N N 126 GLN HB3 H N N 127 GLN HG2 H N N 128 GLN HG3 H N N 129 GLN HE21 H N N 130 GLN HE22 H N N 131 GLN HXT H N N 132 GLU N N N N 133 GLU CA C N S 134 GLU C C N N 135 GLU O O N N 136 GLU CB C N N 137 GLU CG C N N 138 GLU CD C N N 139 GLU OE1 O N N 140 GLU OE2 O N N 141 GLU OXT O N N 142 GLU H H N N 143 GLU H2 H N N 144 GLU HA H N N 145 GLU HB2 H N N 146 GLU HB3 H N N 147 GLU HG2 H N N 148 GLU HG3 H N N 149 GLU HE2 H N N 150 GLU HXT H N N 151 GLY N N N N 152 GLY CA C N N 153 GLY C C N N 154 GLY O O N N 155 GLY OXT O N N 156 GLY H H N N 157 GLY H2 H N N 158 GLY HA2 H N N 159 GLY HA3 H N N 160 GLY HXT H N N 161 GOL C1 C N N 162 GOL O1 O N N 163 GOL C2 C N N 164 GOL O2 O N N 165 GOL C3 C N N 166 GOL O3 O N N 167 GOL H11 H N N 168 GOL H12 H N N 169 GOL HO1 H N N 170 GOL H2 H N N 171 GOL HO2 H N N 172 GOL H31 H N N 173 GOL H32 H N N 174 GOL HO3 H N N 175 HIS N N N N 176 HIS CA C N S 177 HIS C C N N 178 HIS O O N N 179 HIS CB C N N 180 HIS CG C Y N 181 HIS ND1 N Y N 182 HIS CD2 C Y N 183 HIS CE1 C Y N 184 HIS NE2 N Y N 185 HIS OXT O N N 186 HIS H H N N 187 HIS H2 H N N 188 HIS HA H N N 189 HIS HB2 H N N 190 HIS HB3 H N N 191 HIS HD1 H N N 192 HIS HD2 H N N 193 HIS HE1 H N N 194 HIS HE2 H N N 195 HIS HXT H N N 196 ILE N N N N 197 ILE CA C N S 198 ILE C C N N 199 ILE O O N N 200 ILE CB C N S 201 ILE CG1 C N N 202 ILE CG2 C N N 203 ILE CD1 C N N 204 ILE OXT O N N 205 ILE H H N N 206 ILE H2 H N N 207 ILE HA H N N 208 ILE HB H N N 209 ILE HG12 H N N 210 ILE HG13 H N N 211 ILE HG21 H N N 212 ILE HG22 H N N 213 ILE HG23 H N N 214 ILE HD11 H N N 215 ILE HD12 H N N 216 ILE HD13 H N N 217 ILE HXT H N N 218 LEU N N N N 219 LEU CA C N S 220 LEU C C N N 221 LEU O O N N 222 LEU CB C N N 223 LEU CG C N N 224 LEU CD1 C N N 225 LEU CD2 C N N 226 LEU OXT O N N 227 LEU H H N N 228 LEU H2 H N N 229 LEU HA H N N 230 LEU HB2 H N N 231 LEU HB3 H N N 232 LEU HG H N N 233 LEU HD11 H N N 234 LEU HD12 H N N 235 LEU HD13 H N N 236 LEU HD21 H N N 237 LEU HD22 H N N 238 LEU HD23 H N N 239 LEU HXT H N N 240 LYS N N N N 241 LYS CA C N S 242 LYS C C N N 243 LYS O O N N 244 LYS CB C N N 245 LYS CG C N N 246 LYS CD C N N 247 LYS CE C N N 248 LYS NZ N N N 249 LYS OXT O N N 250 LYS H H N N 251 LYS H2 H N N 252 LYS HA H N N 253 LYS HB2 H N N 254 LYS HB3 H N N 255 LYS HG2 H N N 256 LYS HG3 H N N 257 LYS HD2 H N N 258 LYS HD3 H N N 259 LYS HE2 H N N 260 LYS HE3 H N N 261 LYS HZ1 H N N 262 LYS HZ2 H N N 263 LYS HZ3 H N N 264 LYS HXT H N N 265 MET N N N N 266 MET CA C N S 267 MET C C N N 268 MET O O N N 269 MET CB C N N 270 MET CG C N N 271 MET SD S N N 272 MET CE C N N 273 MET OXT O N N 274 MET H H N N 275 MET H2 H N N 276 MET HA H N N 277 MET HB2 H N N 278 MET HB3 H N N 279 MET HG2 H N N 280 MET HG3 H N N 281 MET HE1 H N N 282 MET HE2 H N N 283 MET HE3 H N N 284 MET HXT H N N 285 NA NA NA N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 THR N N N N 341 THR CA C N S 342 THR C C N N 343 THR O O N N 344 THR CB C N R 345 THR OG1 O N N 346 THR CG2 C N N 347 THR OXT O N N 348 THR H H N N 349 THR H2 H N N 350 THR HA H N N 351 THR HB H N N 352 THR HG1 H N N 353 THR HG21 H N N 354 THR HG22 H N N 355 THR HG23 H N N 356 THR HXT H N N 357 TRP N N N N 358 TRP CA C N S 359 TRP C C N N 360 TRP O O N N 361 TRP CB C N N 362 TRP CG C Y N 363 TRP CD1 C Y N 364 TRP CD2 C Y N 365 TRP NE1 N Y N 366 TRP CE2 C Y N 367 TRP CE3 C Y N 368 TRP CZ2 C Y N 369 TRP CZ3 C Y N 370 TRP CH2 C Y N 371 TRP OXT O N N 372 TRP H H N N 373 TRP H2 H N N 374 TRP HA H N N 375 TRP HB2 H N N 376 TRP HB3 H N N 377 TRP HD1 H N N 378 TRP HE1 H N N 379 TRP HE3 H N N 380 TRP HZ2 H N N 381 TRP HZ3 H N N 382 TRP HH2 H N N 383 TRP HXT H N N 384 TYR N N N N 385 TYR CA C N S 386 TYR C C N N 387 TYR O O N N 388 TYR CB C N N 389 TYR CG C Y N 390 TYR CD1 C Y N 391 TYR CD2 C Y N 392 TYR CE1 C Y N 393 TYR CE2 C Y N 394 TYR CZ C Y N 395 TYR OH O N N 396 TYR OXT O N N 397 TYR H H N N 398 TYR H2 H N N 399 TYR HA H N N 400 TYR HB2 H N N 401 TYR HB3 H N N 402 TYR HD1 H N N 403 TYR HD2 H N N 404 TYR HE1 H N N 405 TYR HE2 H N N 406 TYR HH H N N 407 TYR HXT H N N 408 VAL N N N N 409 VAL CA C N S 410 VAL C C N N 411 VAL O O N N 412 VAL CB C N N 413 VAL CG1 C N N 414 VAL CG2 C N N 415 VAL OXT O N N 416 VAL H H N N 417 VAL H2 H N N 418 VAL HA H N N 419 VAL HB H N N 420 VAL HG11 H N N 421 VAL HG12 H N N 422 VAL HG13 H N N 423 VAL HG21 H N N 424 VAL HG22 H N N 425 VAL HG23 H N N 426 VAL HXT H N N 427 ZN ZN ZN N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 AZA N1 C2 sing Y N 76 AZA N1 C6 sing Y N 77 AZA N1 HN1 sing N N 78 AZA C2 O2 doub N N 79 AZA C2 N3 sing Y N 80 AZA N3 C4 sing Y N 81 AZA N3 HN3 sing N N 82 AZA C4 C5 doub Y N 83 AZA C4 N9 sing Y N 84 AZA C5 C6 sing Y N 85 AZA C5 N7 sing Y N 86 AZA C6 O6 doub N N 87 AZA N7 N8 doub Y N 88 AZA N8 N9 sing Y N 89 AZA N9 HN9 sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 DOD O D1 sing N N 104 DOD O D2 sing N N 105 GLN N CA sing N N 106 GLN N H sing N N 107 GLN N H2 sing N N 108 GLN CA C sing N N 109 GLN CA CB sing N N 110 GLN CA HA sing N N 111 GLN C O doub N N 112 GLN C OXT sing N N 113 GLN CB CG sing N N 114 GLN CB HB2 sing N N 115 GLN CB HB3 sing N N 116 GLN CG CD sing N N 117 GLN CG HG2 sing N N 118 GLN CG HG3 sing N N 119 GLN CD OE1 doub N N 120 GLN CD NE2 sing N N 121 GLN NE2 HE21 sing N N 122 GLN NE2 HE22 sing N N 123 GLN OXT HXT sing N N 124 GLU N CA sing N N 125 GLU N H sing N N 126 GLU N H2 sing N N 127 GLU CA C sing N N 128 GLU CA CB sing N N 129 GLU CA HA sing N N 130 GLU C O doub N N 131 GLU C OXT sing N N 132 GLU CB CG sing N N 133 GLU CB HB2 sing N N 134 GLU CB HB3 sing N N 135 GLU CG CD sing N N 136 GLU CG HG2 sing N N 137 GLU CG HG3 sing N N 138 GLU CD OE1 doub N N 139 GLU CD OE2 sing N N 140 GLU OE2 HE2 sing N N 141 GLU OXT HXT sing N N 142 GLY N CA sing N N 143 GLY N H sing N N 144 GLY N H2 sing N N 145 GLY CA C sing N N 146 GLY CA HA2 sing N N 147 GLY CA HA3 sing N N 148 GLY C O doub N N 149 GLY C OXT sing N N 150 GLY OXT HXT sing N N 151 GOL C1 O1 sing N N 152 GOL C1 C2 sing N N 153 GOL C1 H11 sing N N 154 GOL C1 H12 sing N N 155 GOL O1 HO1 sing N N 156 GOL C2 O2 sing N N 157 GOL C2 C3 sing N N 158 GOL C2 H2 sing N N 159 GOL O2 HO2 sing N N 160 GOL C3 O3 sing N N 161 GOL C3 H31 sing N N 162 GOL C3 H32 sing N N 163 GOL O3 HO3 sing N N 164 HIS N CA sing N N 165 HIS N H sing N N 166 HIS N H2 sing N N 167 HIS CA C sing N N 168 HIS CA CB sing N N 169 HIS CA HA sing N N 170 HIS C O doub N N 171 HIS C OXT sing N N 172 HIS CB CG sing N N 173 HIS CB HB2 sing N N 174 HIS CB HB3 sing N N 175 HIS CG ND1 sing Y N 176 HIS CG CD2 doub Y N 177 HIS ND1 CE1 doub Y N 178 HIS ND1 HD1 sing N N 179 HIS CD2 NE2 sing Y N 180 HIS CD2 HD2 sing N N 181 HIS CE1 NE2 sing Y N 182 HIS CE1 HE1 sing N N 183 HIS NE2 HE2 sing N N 184 HIS OXT HXT sing N N 185 ILE N CA sing N N 186 ILE N H sing N N 187 ILE N H2 sing N N 188 ILE CA C sing N N 189 ILE CA CB sing N N 190 ILE CA HA sing N N 191 ILE C O doub N N 192 ILE C OXT sing N N 193 ILE CB CG1 sing N N 194 ILE CB CG2 sing N N 195 ILE CB HB sing N N 196 ILE CG1 CD1 sing N N 197 ILE CG1 HG12 sing N N 198 ILE CG1 HG13 sing N N 199 ILE CG2 HG21 sing N N 200 ILE CG2 HG22 sing N N 201 ILE CG2 HG23 sing N N 202 ILE CD1 HD11 sing N N 203 ILE CD1 HD12 sing N N 204 ILE CD1 HD13 sing N N 205 ILE OXT HXT sing N N 206 LEU N CA sing N N 207 LEU N H sing N N 208 LEU N H2 sing N N 209 LEU CA C sing N N 210 LEU CA CB sing N N 211 LEU CA HA sing N N 212 LEU C O doub N N 213 LEU C OXT sing N N 214 LEU CB CG sing N N 215 LEU CB HB2 sing N N 216 LEU CB HB3 sing N N 217 LEU CG CD1 sing N N 218 LEU CG CD2 sing N N 219 LEU CG HG sing N N 220 LEU CD1 HD11 sing N N 221 LEU CD1 HD12 sing N N 222 LEU CD1 HD13 sing N N 223 LEU CD2 HD21 sing N N 224 LEU CD2 HD22 sing N N 225 LEU CD2 HD23 sing N N 226 LEU OXT HXT sing N N 227 LYS N CA sing N N 228 LYS N H sing N N 229 LYS N H2 sing N N 230 LYS CA C sing N N 231 LYS CA CB sing N N 232 LYS CA HA sing N N 233 LYS C O doub N N 234 LYS C OXT sing N N 235 LYS CB CG sing N N 236 LYS CB HB2 sing N N 237 LYS CB HB3 sing N N 238 LYS CG CD sing N N 239 LYS CG HG2 sing N N 240 LYS CG HG3 sing N N 241 LYS CD CE sing N N 242 LYS CD HD2 sing N N 243 LYS CD HD3 sing N N 244 LYS CE NZ sing N N 245 LYS CE HE2 sing N N 246 LYS CE HE3 sing N N 247 LYS NZ HZ1 sing N N 248 LYS NZ HZ2 sing N N 249 LYS NZ HZ3 sing N N 250 LYS OXT HXT sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 PHE N CA sing N N 271 PHE N H sing N N 272 PHE N H2 sing N N 273 PHE CA C sing N N 274 PHE CA CB sing N N 275 PHE CA HA sing N N 276 PHE C O doub N N 277 PHE C OXT sing N N 278 PHE CB CG sing N N 279 PHE CB HB2 sing N N 280 PHE CB HB3 sing N N 281 PHE CG CD1 doub Y N 282 PHE CG CD2 sing Y N 283 PHE CD1 CE1 sing Y N 284 PHE CD1 HD1 sing N N 285 PHE CD2 CE2 doub Y N 286 PHE CD2 HD2 sing N N 287 PHE CE1 CZ doub Y N 288 PHE CE1 HE1 sing N N 289 PHE CE2 CZ sing Y N 290 PHE CE2 HE2 sing N N 291 PHE CZ HZ sing N N 292 PHE OXT HXT sing N N 293 PRO N CA sing N N 294 PRO N CD sing N N 295 PRO N H sing N N 296 PRO CA C sing N N 297 PRO CA CB sing N N 298 PRO CA HA sing N N 299 PRO C O doub N N 300 PRO C OXT sing N N 301 PRO CB CG sing N N 302 PRO CB HB2 sing N N 303 PRO CB HB3 sing N N 304 PRO CG CD sing N N 305 PRO CG HG2 sing N N 306 PRO CG HG3 sing N N 307 PRO CD HD2 sing N N 308 PRO CD HD3 sing N N 309 PRO OXT HXT sing N N 310 SER N CA sing N N 311 SER N H sing N N 312 SER N H2 sing N N 313 SER CA C sing N N 314 SER CA CB sing N N 315 SER CA HA sing N N 316 SER C O doub N N 317 SER C OXT sing N N 318 SER CB OG sing N N 319 SER CB HB2 sing N N 320 SER CB HB3 sing N N 321 SER OG HG sing N N 322 SER OXT HXT sing N N 323 THR N CA sing N N 324 THR N H sing N N 325 THR N H2 sing N N 326 THR CA C sing N N 327 THR CA CB sing N N 328 THR CA HA sing N N 329 THR C O doub N N 330 THR C OXT sing N N 331 THR CB OG1 sing N N 332 THR CB CG2 sing N N 333 THR CB HB sing N N 334 THR OG1 HG1 sing N N 335 THR CG2 HG21 sing N N 336 THR CG2 HG22 sing N N 337 THR CG2 HG23 sing N N 338 THR OXT HXT sing N N 339 TRP N CA sing N N 340 TRP N H sing N N 341 TRP N H2 sing N N 342 TRP CA C sing N N 343 TRP CA CB sing N N 344 TRP CA HA sing N N 345 TRP C O doub N N 346 TRP C OXT sing N N 347 TRP CB CG sing N N 348 TRP CB HB2 sing N N 349 TRP CB HB3 sing N N 350 TRP CG CD1 doub Y N 351 TRP CG CD2 sing Y N 352 TRP CD1 NE1 sing Y N 353 TRP CD1 HD1 sing N N 354 TRP CD2 CE2 doub Y N 355 TRP CD2 CE3 sing Y N 356 TRP NE1 CE2 sing Y N 357 TRP NE1 HE1 sing N N 358 TRP CE2 CZ2 sing Y N 359 TRP CE3 CZ3 doub Y N 360 TRP CE3 HE3 sing N N 361 TRP CZ2 CH2 doub Y N 362 TRP CZ2 HZ2 sing N N 363 TRP CZ3 CH2 sing Y N 364 TRP CZ3 HZ3 sing N N 365 TRP CH2 HH2 sing N N 366 TRP OXT HXT sing N N 367 TYR N CA sing N N 368 TYR N H sing N N 369 TYR N H2 sing N N 370 TYR CA C sing N N 371 TYR CA CB sing N N 372 TYR CA HA sing N N 373 TYR C O doub N N 374 TYR C OXT sing N N 375 TYR CB CG sing N N 376 TYR CB HB2 sing N N 377 TYR CB HB3 sing N N 378 TYR CG CD1 doub Y N 379 TYR CG CD2 sing Y N 380 TYR CD1 CE1 sing Y N 381 TYR CD1 HD1 sing N N 382 TYR CD2 CE2 doub Y N 383 TYR CD2 HD2 sing N N 384 TYR CE1 CZ doub Y N 385 TYR CE1 HE1 sing N N 386 TYR CE2 CZ sing Y N 387 TYR CE2 HE2 sing N N 388 TYR CZ OH sing N N 389 TYR OH HH sing N N 390 TYR OXT HXT sing N N 391 VAL N CA sing N N 392 VAL N H sing N N 393 VAL N H2 sing N N 394 VAL CA C sing N N 395 VAL CA CB sing N N 396 VAL CA HA sing N N 397 VAL C O doub N N 398 VAL C OXT sing N N 399 VAL CB CG1 sing N N 400 VAL CB CG2 sing N N 401 VAL CB HB sing N N 402 VAL CG1 HG11 sing N N 403 VAL CG1 HG12 sing N N 404 VAL CG1 HG13 sing N N 405 VAL CG2 HG21 sing N N 406 VAL CG2 HG22 sing N N 407 VAL CG2 HG23 sing N N 408 VAL OXT HXT sing N N 409 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 8-AZAXANTHINE AZA 3 'SODIUM ION' NA 4 'ZINC ION' ZN 5 GLYCEROL GOL 6 'CHLORIDE ION' CL 7 water DOD # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2IBA _pdbx_initial_refinement_model.details 'PDB ENTRY 2IBA' #