data_4ND7 # _entry.id 4ND7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4ND7 RCSB RCSB083054 WWPDB D_1000083054 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4ND6 'Crystal structure of apo 3-nitro-tyrosine tRNA synthetase (5B) in the open form' unspecified PDB 4NDA . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4ND7 _pdbx_database_status.recvd_initial_deposition_date 2013-10-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cooley, R.B.' 1 'Driggers, C.M.' 2 'Karplus, P.A.' 3 'Mehl, R.A.' 4 # _citation.id primary _citation.title 'Structural Basis of Improved Second-Generation 3-Nitro-tyrosine tRNA Synthetases.' _citation.journal_abbrev Biochemistry _citation.journal_volume 53 _citation.page_first 1916 _citation.page_last 1924 _citation.year 2014 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24611875 _citation.pdbx_database_id_DOI 10.1021/bi5001239 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cooley, R.B.' 1 ? primary 'Feldman, J.L.' 2 ? primary 'Driggers, C.M.' 3 ? primary 'Bundy, T.A.' 4 ? primary 'Stokes, A.L.' 5 ? primary 'Karplus, P.A.' 6 ? primary 'Mehl, R.A.' 7 ? # _cell.entry_id 4ND7 _cell.length_a 101.770 _cell.length_b 101.770 _cell.length_c 72.280 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4ND7 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine--tRNA ligase' 36087.871 1 6.1.1.1 'Y32H, H70C, D158S, I159A, L162R' ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 4 water nat water 18.015 134 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tyrosyl-tRNA synthetase, TyrRS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDEFEMIKRNTSEIISEEELREVLKKDEKSAHIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIILLADLCAYLNQKGELD EIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNSAH YRGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNP IMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRLLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDEFEMIKRNTSEIISEEELREVLKKDEKSAHIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIILLADLCAYLNQKGELD EIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNSAH YRGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNP IMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRLLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLU n 1 4 PHE n 1 5 GLU n 1 6 MET n 1 7 ILE n 1 8 LYS n 1 9 ARG n 1 10 ASN n 1 11 THR n 1 12 SER n 1 13 GLU n 1 14 ILE n 1 15 ILE n 1 16 SER n 1 17 GLU n 1 18 GLU n 1 19 GLU n 1 20 LEU n 1 21 ARG n 1 22 GLU n 1 23 VAL n 1 24 LEU n 1 25 LYS n 1 26 LYS n 1 27 ASP n 1 28 GLU n 1 29 LYS n 1 30 SER n 1 31 ALA n 1 32 HIS n 1 33 ILE n 1 34 GLY n 1 35 PHE n 1 36 GLU n 1 37 PRO n 1 38 SER n 1 39 GLY n 1 40 LYS n 1 41 ILE n 1 42 HIS n 1 43 LEU n 1 44 GLY n 1 45 HIS n 1 46 TYR n 1 47 LEU n 1 48 GLN n 1 49 ILE n 1 50 LYS n 1 51 LYS n 1 52 MET n 1 53 ILE n 1 54 ASP n 1 55 LEU n 1 56 GLN n 1 57 ASN n 1 58 ALA n 1 59 GLY n 1 60 PHE n 1 61 ASP n 1 62 ILE n 1 63 ILE n 1 64 ILE n 1 65 LEU n 1 66 LEU n 1 67 ALA n 1 68 ASP n 1 69 LEU n 1 70 CYS n 1 71 ALA n 1 72 TYR n 1 73 LEU n 1 74 ASN n 1 75 GLN n 1 76 LYS n 1 77 GLY n 1 78 GLU n 1 79 LEU n 1 80 ASP n 1 81 GLU n 1 82 ILE n 1 83 ARG n 1 84 LYS n 1 85 ILE n 1 86 GLY n 1 87 ASP n 1 88 TYR n 1 89 ASN n 1 90 LYS n 1 91 LYS n 1 92 VAL n 1 93 PHE n 1 94 GLU n 1 95 ALA n 1 96 MET n 1 97 GLY n 1 98 LEU n 1 99 LYS n 1 100 ALA n 1 101 LYS n 1 102 TYR n 1 103 VAL n 1 104 TYR n 1 105 GLY n 1 106 SER n 1 107 GLU n 1 108 PHE n 1 109 GLN n 1 110 LEU n 1 111 ASP n 1 112 LYS n 1 113 ASP n 1 114 TYR n 1 115 THR n 1 116 LEU n 1 117 ASN n 1 118 VAL n 1 119 TYR n 1 120 ARG n 1 121 LEU n 1 122 ALA n 1 123 LEU n 1 124 LYS n 1 125 THR n 1 126 THR n 1 127 LEU n 1 128 LYS n 1 129 ARG n 1 130 ALA n 1 131 ARG n 1 132 ARG n 1 133 SER n 1 134 MET n 1 135 GLU n 1 136 LEU n 1 137 ILE n 1 138 ALA n 1 139 ARG n 1 140 GLU n 1 141 ASP n 1 142 GLU n 1 143 ASN n 1 144 PRO n 1 145 LYS n 1 146 VAL n 1 147 ALA n 1 148 GLU n 1 149 VAL n 1 150 ILE n 1 151 TYR n 1 152 PRO n 1 153 ILE n 1 154 MET n 1 155 GLN n 1 156 VAL n 1 157 ASN n 1 158 SER n 1 159 ALA n 1 160 HIS n 1 161 TYR n 1 162 ARG n 1 163 GLY n 1 164 VAL n 1 165 ASP n 1 166 VAL n 1 167 ALA n 1 168 VAL n 1 169 GLY n 1 170 GLY n 1 171 MET n 1 172 GLU n 1 173 GLN n 1 174 ARG n 1 175 LYS n 1 176 ILE n 1 177 HIS n 1 178 MET n 1 179 LEU n 1 180 ALA n 1 181 ARG n 1 182 GLU n 1 183 LEU n 1 184 LEU n 1 185 PRO n 1 186 LYS n 1 187 LYS n 1 188 VAL n 1 189 VAL n 1 190 CYS n 1 191 ILE n 1 192 HIS n 1 193 ASN n 1 194 PRO n 1 195 VAL n 1 196 LEU n 1 197 THR n 1 198 GLY n 1 199 LEU n 1 200 ASP n 1 201 GLY n 1 202 GLU n 1 203 GLY n 1 204 LYS n 1 205 MET n 1 206 SER n 1 207 SER n 1 208 SER n 1 209 LYS n 1 210 GLY n 1 211 ASN n 1 212 PHE n 1 213 ILE n 1 214 ALA n 1 215 VAL n 1 216 ASP n 1 217 ASP n 1 218 SER n 1 219 PRO n 1 220 GLU n 1 221 GLU n 1 222 ILE n 1 223 ARG n 1 224 ALA n 1 225 LYS n 1 226 ILE n 1 227 LYS n 1 228 LYS n 1 229 ALA n 1 230 TYR n 1 231 CYS n 1 232 PRO n 1 233 ALA n 1 234 GLY n 1 235 VAL n 1 236 VAL n 1 237 GLU n 1 238 GLY n 1 239 ASN n 1 240 PRO n 1 241 ILE n 1 242 MET n 1 243 GLU n 1 244 ILE n 1 245 ALA n 1 246 LYS n 1 247 TYR n 1 248 PHE n 1 249 LEU n 1 250 GLU n 1 251 TYR n 1 252 PRO n 1 253 LEU n 1 254 THR n 1 255 ILE n 1 256 LYS n 1 257 ARG n 1 258 PRO n 1 259 GLU n 1 260 LYS n 1 261 PHE n 1 262 GLY n 1 263 GLY n 1 264 ASP n 1 265 LEU n 1 266 THR n 1 267 VAL n 1 268 ASN n 1 269 SER n 1 270 TYR n 1 271 GLU n 1 272 GLU n 1 273 LEU n 1 274 GLU n 1 275 SER n 1 276 LEU n 1 277 PHE n 1 278 LYS n 1 279 ASN n 1 280 LYS n 1 281 GLU n 1 282 LEU n 1 283 HIS n 1 284 PRO n 1 285 MET n 1 286 ASP n 1 287 LEU n 1 288 LYS n 1 289 ASN n 1 290 ALA n 1 291 VAL n 1 292 ALA n 1 293 GLU n 1 294 GLU n 1 295 LEU n 1 296 ILE n 1 297 LYS n 1 298 ILE n 1 299 LEU n 1 300 GLU n 1 301 PRO n 1 302 ILE n 1 303 ARG n 1 304 LYS n 1 305 ARG n 1 306 LEU n 1 307 LEU n 1 308 GLU n 1 309 HIS n 1 310 HIS n 1 311 HIS n 1 312 HIS n 1 313 HIS n 1 314 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MJ0389, tyrS, tyrS MJ0389' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243232 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYY_METJA _struct_ref.pdbx_db_accession Q57834 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDEFEMIKRNTSEIISEEELREVLKKDEKSAYIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELD EIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNDIH YLGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNP IMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ND7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 306 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q57834 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 306 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 306 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4ND7 HIS A 32 ? UNP Q57834 TYR 32 'ENGINEERED MUTATION' 32 1 1 4ND7 CYS A 70 ? UNP Q57834 HIS 70 'ENGINEERED MUTATION' 70 2 1 4ND7 SER A 158 ? UNP Q57834 ASP 158 'ENGINEERED MUTATION' 158 3 1 4ND7 ALA A 159 ? UNP Q57834 ILE 159 'ENGINEERED MUTATION' 159 4 1 4ND7 ARG A 162 ? UNP Q57834 LEU 162 'ENGINEERED MUTATION' 162 5 1 4ND7 LEU A 307 ? UNP Q57834 ? ? 'EXPRESSION TAG' 307 6 1 4ND7 GLU A 308 ? UNP Q57834 ? ? 'EXPRESSION TAG' 308 7 1 4ND7 HIS A 309 ? UNP Q57834 ? ? 'EXPRESSION TAG' 309 8 1 4ND7 HIS A 310 ? UNP Q57834 ? ? 'EXPRESSION TAG' 310 9 1 4ND7 HIS A 311 ? UNP Q57834 ? ? 'EXPRESSION TAG' 311 10 1 4ND7 HIS A 312 ? UNP Q57834 ? ? 'EXPRESSION TAG' 312 11 1 4ND7 HIS A 313 ? UNP Q57834 ? ? 'EXPRESSION TAG' 313 12 1 4ND7 HIS A 314 ? UNP Q57834 ? ? 'EXPRESSION TAG' 314 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4ND7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.59 _exptl_crystal.density_percent_sol 52.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.1 _exptl_crystal_grow.pdbx_details '22-23% PEG 300, 5% PEG 8000, 10% glycerol and 100 mM Tris pH 8.0 to 8.3, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 77 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type NOIR-1 _diffrn_detector.pdbx_collection_date 2012-04-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Rosenbaum-Rock Si(111) sagitally focused monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97 # _reflns.entry_id 4ND7 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 51.00 _reflns.d_resolution_high 2.0 _reflns.number_obs 26163 _reflns.number_all 26163 _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.10 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4ND7 _refine.ls_number_reflns_obs 26163 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.997 _refine.ls_d_res_high 2.000 _refine.ls_percent_reflns_obs 99.82 _refine.ls_R_factor_obs 0.2261 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2233 _refine.ls_R_factor_R_free 0.2777 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.07 _refine.ls_number_reflns_R_free 1327 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.34 _refine.pdbx_overall_phase_error 31.62 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2485 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 134 _refine_hist.number_atoms_total 2622 _refine_hist.d_res_high 2.000 _refine_hist.d_res_low 50.997 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.007 ? ? 2646 ? 'X-RAY DIFFRACTION' f_angle_d 1.050 ? ? 3564 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 13.765 ? ? 1050 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.070 ? ? 391 ? 'X-RAY DIFFRACTION' f_plane_restr 0.005 ? ? 463 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.0000 2.0801 2688 0.3412 100.00 0.3766 . . 154 . . . . 'X-RAY DIFFRACTION' . 2.0801 2.1748 2706 0.3058 100.00 0.3418 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.1748 2.2894 2709 0.2724 100.00 0.3494 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.2894 2.4328 2733 0.2621 100.00 0.3280 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.4328 2.6207 2732 0.2510 100.00 0.3239 . . 140 . . . . 'X-RAY DIFFRACTION' . 2.6207 2.8844 2769 0.2482 100.00 0.3157 . . 129 . . . . 'X-RAY DIFFRACTION' . 2.8844 3.3017 2722 0.2349 100.00 0.3084 . . 183 . . . . 'X-RAY DIFFRACTION' . 3.3017 4.1595 2796 0.1873 100.00 0.2534 . . 147 . . . . 'X-RAY DIFFRACTION' . 4.1595 51.0135 2981 0.2066 100.00 0.2338 . . 138 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4ND7 _struct.title 'Crystal structure of apo 3-nitro-tyrosine tRNA synthetase (5B) in the closed form' _struct.pdbx_descriptor 'Tyrosine--tRNA ligase (E.C.6.1.1.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4ND7 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'Rosmann Fold, 3-nitro-tyrosine amino-acyl tRNA synthetase, tRNA, Ligase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? ARG A 9 ? ASP A 2 ARG A 9 1 ? 8 HELX_P HELX_P2 2 SER A 16 ? LYS A 26 ? SER A 16 LYS A 26 1 ? 11 HELX_P HELX_P3 3 HIS A 42 ? ALA A 58 ? HIS A 42 ALA A 58 1 ? 17 HELX_P HELX_P4 4 ALA A 67 ? ASN A 74 ? ALA A 67 ASN A 74 1 ? 8 HELX_P HELX_P5 5 GLU A 78 ? MET A 96 ? GLU A 78 MET A 96 1 ? 19 HELX_P HELX_P6 6 SER A 106 ? PHE A 108 ? SER A 106 PHE A 108 5 ? 3 HELX_P HELX_P7 7 ASP A 111 ? THR A 125 ? ASP A 111 THR A 125 1 ? 15 HELX_P HELX_P8 8 THR A 126 ? MET A 134 ? THR A 126 MET A 134 1 ? 9 HELX_P HELX_P9 9 LYS A 145 ? GLY A 163 ? LYS A 145 GLY A 163 1 ? 19 HELX_P HELX_P10 10 GLN A 173 ? LEU A 184 ? GLN A 173 LEU A 184 1 ? 12 HELX_P HELX_P11 11 SER A 218 ? ALA A 229 ? SER A 218 ALA A 229 1 ? 12 HELX_P HELX_P12 12 ASN A 239 ? LEU A 249 ? ASN A 239 LEU A 249 1 ? 11 HELX_P HELX_P13 13 PRO A 258 ? GLY A 262 ? PRO A 258 GLY A 262 5 ? 5 HELX_P HELX_P14 14 SER A 269 ? ASN A 279 ? SER A 269 ASN A 279 1 ? 11 HELX_P HELX_P15 15 HIS A 283 ? GLU A 308 ? HIS A 283 GLU A 308 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 27 OD2 ? ? ? 1_555 B NA . NA ? ? A ASP 27 A NA 401 1_555 ? ? ? ? ? ? ? 2.430 ? metalc2 metalc ? ? B NA . NA ? ? ? 1_555 D HOH . O ? ? A NA 401 A HOH 1103 1_555 ? ? ? ? ? ? ? 2.736 ? covale1 covale none ? A CYS 70 SG ? ? ? 1_555 C BME . S2 ? ? A CYS 70 A BME 402 1_555 ? ? ? ? ? ? ? 2.067 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 15 A . ? ILE 15 A SER 16 A ? SER 16 A 1 -5.39 2 ILE 15 A . ? ILE 15 A SER 16 A ? SER 16 A 1 -3.48 3 TYR 251 A . ? TYR 251 A PRO 252 A ? PRO 252 A 1 2.36 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 13 ? ILE A 15 ? GLU A 13 ILE A 15 A 2 VAL A 189 ? ASN A 193 ? VAL A 189 ASN A 193 A 3 VAL A 166 ? GLY A 170 ? VAL A 166 GLY A 170 A 4 SER A 30 ? PHE A 35 ? SER A 30 PHE A 35 A 5 ASP A 61 ? LEU A 66 ? ASP A 61 LEU A 66 A 6 LYS A 101 ? TYR A 104 ? LYS A 101 TYR A 104 B 1 LEU A 253 ? ILE A 255 ? LEU A 253 ILE A 255 B 2 LEU A 265 ? VAL A 267 ? LEU A 265 VAL A 267 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 15 ? N ILE A 15 O CYS A 190 ? O CYS A 190 A 2 3 O VAL A 189 ? O VAL A 189 N ALA A 167 ? N ALA A 167 A 3 4 O VAL A 168 ? O VAL A 168 N HIS A 32 ? N HIS A 32 A 4 5 N ILE A 33 ? N ILE A 33 O LEU A 65 ? O LEU A 65 A 5 6 N LEU A 66 ? N LEU A 66 O VAL A 103 ? O VAL A 103 B 1 2 N ILE A 255 ? N ILE A 255 O LEU A 265 ? O LEU A 265 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 401' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BME A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 27 ? ASP A 27 . ? 1_555 ? 2 AC1 5 LEU A 127 ? LEU A 127 . ? 4_565 ? 3 AC1 5 LYS A 128 ? LYS A 128 . ? 4_565 ? 4 AC1 5 PRO A 144 ? PRO A 144 . ? 5_654 ? 5 AC1 5 HOH D . ? HOH A 1103 . ? 1_555 ? 6 AC2 3 CYS A 70 ? CYS A 70 . ? 1_555 ? 7 AC2 3 TYR A 151 ? TYR A 151 . ? 1_555 ? 8 AC2 3 GLN A 155 ? GLN A 155 . ? 1_555 ? # _database_PDB_matrix.entry_id 4ND7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4ND7 _atom_sites.fract_transf_matrix[1][1] 0.009826 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009826 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013835 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 CYS 190 190 190 CYS CYS A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 MET 205 205 205 MET MET A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 PRO 219 219 219 PRO PRO A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 PRO 232 232 232 PRO PRO A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 ASN 239 239 239 ASN ASN A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 MET 242 242 242 MET MET A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 PRO 252 252 252 PRO PRO A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 PRO 258 258 258 PRO PRO A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 PHE 261 261 261 PHE PHE A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 PHE 277 277 277 PHE PHE A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 ASN 279 279 279 ASN ASN A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 GLU 281 281 281 GLU GLU A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 HIS 283 283 283 HIS HIS A . n A 1 284 PRO 284 284 284 PRO PRO A . n A 1 285 MET 285 285 285 MET MET A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 ASN 289 289 289 ASN ASN A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 ILE 296 296 296 ILE ILE A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 ILE 298 298 298 ILE ILE A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 GLU 300 300 300 GLU GLU A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 ARG 303 303 303 ARG ARG A . n A 1 304 LYS 304 304 304 LYS LYS A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 LEU 307 307 307 LEU LEU A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 HIS 309 309 309 HIS HIS A . n A 1 310 HIS 310 310 310 HIS HIS A . n A 1 311 HIS 311 311 ? ? ? A . n A 1 312 HIS 312 312 ? ? ? A . n A 1 313 HIS 313 313 ? ? ? A . n A 1 314 HIS 314 314 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 401 311 NA NA A . C 3 BME 1 402 312 BME BME A . D 4 HOH 1 1001 1001 HOH HOH A . D 4 HOH 2 1002 1002 HOH HOH A . D 4 HOH 3 1003 1003 HOH HOH A . D 4 HOH 4 1004 1004 HOH HOH A . D 4 HOH 5 1005 1005 HOH HOH A . D 4 HOH 6 1006 1006 HOH HOH A . D 4 HOH 7 1007 1007 HOH HOH A . D 4 HOH 8 1008 1008 HOH HOH A . D 4 HOH 9 1009 1009 HOH HOH A . D 4 HOH 10 1010 1010 HOH HOH A . D 4 HOH 11 1011 1011 HOH HOH A . D 4 HOH 12 1012 1012 HOH HOH A . D 4 HOH 13 1013 1013 HOH HOH A . D 4 HOH 14 1014 1014 HOH HOH A . D 4 HOH 15 1015 1015 HOH HOH A . D 4 HOH 16 1016 1016 HOH HOH A . D 4 HOH 17 1017 1017 HOH HOH A . D 4 HOH 18 1018 1018 HOH HOH A . D 4 HOH 19 1019 1019 HOH HOH A . D 4 HOH 20 1020 1020 HOH HOH A . D 4 HOH 21 1021 1021 HOH HOH A . D 4 HOH 22 1022 1022 HOH HOH A . D 4 HOH 23 1023 1023 HOH HOH A . D 4 HOH 24 1024 1024 HOH HOH A . D 4 HOH 25 1025 1025 HOH HOH A . D 4 HOH 26 1026 1026 HOH HOH A . D 4 HOH 27 1027 1027 HOH HOH A . D 4 HOH 28 1028 1028 HOH HOH A . D 4 HOH 29 1029 1029 HOH HOH A . D 4 HOH 30 1030 1030 HOH HOH A . D 4 HOH 31 1031 1031 HOH HOH A . D 4 HOH 32 1032 1032 HOH HOH A . D 4 HOH 33 1033 1033 HOH HOH A . D 4 HOH 34 1034 1034 HOH HOH A . D 4 HOH 35 1035 1035 HOH HOH A . D 4 HOH 36 1036 1036 HOH HOH A . D 4 HOH 37 1037 1037 HOH HOH A . D 4 HOH 38 1038 1038 HOH HOH A . D 4 HOH 39 1039 1039 HOH HOH A . D 4 HOH 40 1040 1040 HOH HOH A . D 4 HOH 41 1041 1041 HOH HOH A . D 4 HOH 42 1042 1042 HOH HOH A . D 4 HOH 43 1043 1043 HOH HOH A . D 4 HOH 44 1044 1044 HOH HOH A . D 4 HOH 45 1045 1045 HOH HOH A . D 4 HOH 46 1046 1046 HOH HOH A . D 4 HOH 47 1047 1047 HOH HOH A . D 4 HOH 48 1048 1048 HOH HOH A . D 4 HOH 49 1049 1049 HOH HOH A . D 4 HOH 50 1050 1050 HOH HOH A . D 4 HOH 51 1051 1051 HOH HOH A . D 4 HOH 52 1052 1052 HOH HOH A . D 4 HOH 53 1053 1053 HOH HOH A . D 4 HOH 54 1054 1054 HOH HOH A . D 4 HOH 55 1055 1055 HOH HOH A . D 4 HOH 56 1056 1056 HOH HOH A . D 4 HOH 57 1057 1057 HOH HOH A . D 4 HOH 58 1058 1058 HOH HOH A . D 4 HOH 59 1059 1059 HOH HOH A . D 4 HOH 60 1060 1060 HOH HOH A . D 4 HOH 61 1061 1061 HOH HOH A . D 4 HOH 62 1062 1062 HOH HOH A . D 4 HOH 63 1063 1063 HOH HOH A . D 4 HOH 64 1064 1064 HOH HOH A . D 4 HOH 65 1065 1065 HOH HOH A . D 4 HOH 66 1066 1066 HOH HOH A . D 4 HOH 67 1067 1067 HOH HOH A . D 4 HOH 68 1068 1068 HOH HOH A . D 4 HOH 69 1069 1069 HOH HOH A . D 4 HOH 70 1070 1070 HOH HOH A . D 4 HOH 71 1071 1071 HOH HOH A . D 4 HOH 72 1072 1072 HOH HOH A . D 4 HOH 73 1073 1073 HOH HOH A . D 4 HOH 74 1074 1074 HOH HOH A . D 4 HOH 75 1075 1075 HOH HOH A . D 4 HOH 76 1076 1076 HOH HOH A . D 4 HOH 77 1077 1077 HOH HOH A . D 4 HOH 78 1078 1078 HOH HOH A . D 4 HOH 79 1079 1079 HOH HOH A . D 4 HOH 80 1080 1080 HOH HOH A . D 4 HOH 81 1081 1081 HOH HOH A . D 4 HOH 82 1082 1082 HOH HOH A . D 4 HOH 83 1083 1083 HOH HOH A . D 4 HOH 84 1084 1084 HOH HOH A . D 4 HOH 85 1085 1085 HOH HOH A . D 4 HOH 86 1086 1086 HOH HOH A . D 4 HOH 87 1087 1087 HOH HOH A . D 4 HOH 88 1088 1088 HOH HOH A . D 4 HOH 89 1089 1089 HOH HOH A . D 4 HOH 90 1090 1090 HOH HOH A . D 4 HOH 91 1091 1091 HOH HOH A . D 4 HOH 92 1092 1092 HOH HOH A . D 4 HOH 93 1093 1093 HOH HOH A . D 4 HOH 94 1094 1094 HOH HOH A . D 4 HOH 95 1095 1095 HOH HOH A . D 4 HOH 96 1096 1096 HOH HOH A . D 4 HOH 97 1097 1097 HOH HOH A . D 4 HOH 98 1098 1098 HOH HOH A . D 4 HOH 99 1099 1099 HOH HOH A . D 4 HOH 100 1100 1100 HOH HOH A . D 4 HOH 101 1101 1101 HOH HOH A . D 4 HOH 102 1102 1102 HOH HOH A . D 4 HOH 103 1103 1103 HOH HOH A . D 4 HOH 104 1104 1104 HOH HOH A . D 4 HOH 105 1105 1105 HOH HOH A . D 4 HOH 106 1106 1106 HOH HOH A . D 4 HOH 107 1107 1107 HOH HOH A . D 4 HOH 108 1108 1108 HOH HOH A . D 4 HOH 109 1109 1109 HOH HOH A . D 4 HOH 110 1110 1110 HOH HOH A . D 4 HOH 111 1111 1111 HOH HOH A . D 4 HOH 112 1112 1112 HOH HOH A . D 4 HOH 113 1113 1113 HOH HOH A . D 4 HOH 114 1114 1114 HOH HOH A . D 4 HOH 115 1115 1115 HOH HOH A . D 4 HOH 116 1116 1116 HOH HOH A . D 4 HOH 117 1117 1117 HOH HOH A . D 4 HOH 118 1118 1118 HOH HOH A . D 4 HOH 119 1119 1119 HOH HOH A . D 4 HOH 120 1120 1120 HOH HOH A . D 4 HOH 121 1121 1121 HOH HOH A . D 4 HOH 122 1122 1122 HOH HOH A . D 4 HOH 123 1123 1123 HOH HOH A . D 4 HOH 124 1124 1124 HOH HOH A . D 4 HOH 125 1125 1125 HOH HOH A . D 4 HOH 126 1126 1126 HOH HOH A . D 4 HOH 127 1127 1127 HOH HOH A . D 4 HOH 128 1128 1128 HOH HOH A . D 4 HOH 129 1129 1129 HOH HOH A . D 4 HOH 130 1130 1130 HOH HOH A . D 4 HOH 131 1131 1131 HOH HOH A . D 4 HOH 132 1132 1132 HOH HOH A . D 4 HOH 133 1133 1133 HOH HOH A . D 4 HOH 134 1134 1134 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3470 ? 1 MORE -55 ? 1 'SSA (A^2)' 28350 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_664 -y+1,-x+1,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 101.7700000000 -1.0000000000 0.0000000000 0.0000000000 101.7700000000 0.0000000000 0.0000000000 -1.0000000000 -36.1400000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 1009 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OD2 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id ASP _pdbx_struct_conn_angle.ptnr1_label_seq_id 27 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id ASP _pdbx_struct_conn_angle.ptnr1_auth_seq_id 27 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id NA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id NA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id NA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 401 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id D _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 1103 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 98.0 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-19 2 'Structure model' 1 1 2014-04-16 3 'Structure model' 1 2 2019-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 3 'Structure model' '_software.version' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 75.8970 43.3870 -4.5993 0.1907 0.1915 0.2770 -0.0269 -0.0725 -0.0593 3.4183 0.6991 6.1808 0.0800 2.9162 1.1341 -0.1327 -0.1868 0.1724 0.0651 -0.1059 0.2878 -0.2244 0.0601 0.1695 'X-RAY DIFFRACTION' 2 ? refined 86.2550 37.2968 20.6036 0.2534 0.4044 0.2136 -0.0748 -0.0554 0.0080 3.1545 3.3486 5.3729 -0.4167 0.2970 -0.8991 -0.1512 -0.2283 -0.0889 0.1905 0.0646 -0.1398 0.2227 -0.0756 0.0320 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 1:194)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 195:308)' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(phenix.refine: 1.8_1069)' ? 1 REFMAC refinement . ? 2 ADSC 'data collection' Quantum ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 REFMAC phasing . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 27 ? ? O A HOH 1071 ? ? 2.11 2 1 O A HOH 1126 ? ? O A HOH 1131 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE2 A GLU 221 ? B 1_555 O A HOH 1043 ? ? 8_665 2.13 2 1 OE2 A GLU 221 ? B 1_555 O A HOH 1058 ? ? 8_665 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -47.29 158.14 2 1 CYS A 231 ? ? -168.02 71.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 310 ? CG ? A HIS 310 CG 2 1 Y 1 A HIS 310 ? ND1 ? A HIS 310 ND1 3 1 Y 1 A HIS 310 ? CD2 ? A HIS 310 CD2 4 1 Y 1 A HIS 310 ? CE1 ? A HIS 310 CE1 5 1 Y 1 A HIS 310 ? NE2 ? A HIS 310 NE2 6 1 N 1 A BME 402 ? C1 ? C BME 1 C1 7 1 N 1 A BME 402 ? O1 ? C BME 1 O1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 311 ? A HIS 311 2 1 Y 1 A HIS 312 ? A HIS 312 3 1 Y 1 A HIS 313 ? A HIS 313 4 1 Y 1 A HIS 314 ? A HIS 314 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 BETA-MERCAPTOETHANOL BME 4 water HOH #