data_4NEO # _entry.id 4NEO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.367 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4NEO pdb_00004neo 10.2210/pdb4neo/pdb RCSB RCSB083107 ? ? WWPDB D_1000083107 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2014-01-29 _pdbx_database_PDB_obs_spr.pdb_id 4NEO _pdbx_database_PDB_obs_spr.replace_pdb_id 4I4D _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetTrack MCSG-APC109063 . unspecified TargetTrack NatPro-GO.119729 . unspecified # _pdbx_database_status.entry_id 4NEO _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-10-29 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cuff, M.E.' 1 ? 'Bigelow, L.' 2 ? 'Bearden, J.' 3 ? 'Babnigg, G.' 4 ? 'Bruno, C.J.P.' 5 ? 'Bingman, C.A.' 6 ? 'Yennamalli, R.' 7 ? 'Lohman, J.' 8 ? 'Ma, M.' 9 ? 'Shen, B.' 10 ? 'Phillips Jr., G.N.' 11 ? 'Joachimiak, A.' 12 ? 'Enzyme Discovery for Natural Product Biosynthesis (NatPro)' 13 ? 'Midwest Center for Structural Genomics (MCSG)' 14 ? # _citation.id primary _citation.title 'The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.' _citation.journal_abbrev Proteins _citation.journal_volume 82 _citation.page_first 1210 _citation.page_last 1218 _citation.year 2014 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25050442 _citation.pdbx_database_id_DOI 10.1002/prot.24485 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lohman, J.R.' 1 ? primary 'Ma, M.' 2 ? primary 'Cuff, M.E.' 3 ? primary 'Bigelow, L.' 4 ? primary 'Bearden, J.' 5 ? primary 'Babnigg, G.' 6 ? primary 'Joachimiak, A.' 7 ? primary 'Phillips, G.N.' 8 ? primary 'Shen, B.' 9 ? # _cell.length_a 73.441 _cell.length_b 73.441 _cell.length_c 43.331 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4NEO _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.entry_id 4NEO _symmetry.Int_Tables_number 154 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptide synthetase NRPS type II-PCP' 10367.317 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 non-polymer syn '2-(2-METHOXYETHOXY)ETHANOL' 120.147 1 ? ? ? ? 4 water nat water 18.015 31 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)SAPRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAI(MLY)ITNRVEELVDAELSIRVLLE TRTVAG(MSE)TDHVHATLTGERDR ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMSAPRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIKITNRVEELVDAELSIRVLLETRTVAGMT DHVHATLTGERDR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 'MCSG-APC109063, NatPro-GO.119729 ' # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 SER n 1 6 ALA n 1 7 PRO n 1 8 ARG n 1 9 GLY n 1 10 GLU n 1 11 ARG n 1 12 THR n 1 13 ARG n 1 14 ARG n 1 15 ARG n 1 16 ALA n 1 17 LEU n 1 18 GLU n 1 19 ARG n 1 20 ASP n 1 21 ILE n 1 22 ALA n 1 23 ALA n 1 24 ILE n 1 25 TRP n 1 26 ALA n 1 27 GLU n 1 28 THR n 1 29 LEU n 1 30 GLY n 1 31 ARG n 1 32 ASP n 1 33 SER n 1 34 VAL n 1 35 GLY n 1 36 PRO n 1 37 HIS n 1 38 GLU n 1 39 ASP n 1 40 PHE n 1 41 ALA n 1 42 ALA n 1 43 LEU n 1 44 GLY n 1 45 GLY n 1 46 ASN n 1 47 SER n 1 48 ILE n 1 49 HIS n 1 50 ALA n 1 51 ILE n 1 52 MLY n 1 53 ILE n 1 54 THR n 1 55 ASN n 1 56 ARG n 1 57 VAL n 1 58 GLU n 1 59 GLU n 1 60 LEU n 1 61 VAL n 1 62 ASP n 1 63 ALA n 1 64 GLU n 1 65 LEU n 1 66 SER n 1 67 ILE n 1 68 ARG n 1 69 VAL n 1 70 LEU n 1 71 LEU n 1 72 GLU n 1 73 THR n 1 74 ARG n 1 75 THR n 1 76 VAL n 1 77 ALA n 1 78 GLY n 1 79 MSE n 1 80 THR n 1 81 ASP n 1 82 HIS n 1 83 VAL n 1 84 HIS n 1 85 ALA n 1 86 THR n 1 87 LEU n 1 88 THR n 1 89 GLY n 1 90 GLU n 1 91 ARG n 1 92 ASP n 1 93 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene blmI _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces verticillus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29309 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 15003 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-Gold' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG57 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9XC48_9ACTO _struct_ref.pdbx_db_accession Q9XC48 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SAPRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIKITNRVEELVDAELSIRVLLETRTVAGMTDHVH ATLTGERDR ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4NEO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9XC48 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 90 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4NEO SER A 1 ? UNP Q9XC48 ? ? 'expression tag' -2 1 1 4NEO ASN A 2 ? UNP Q9XC48 ? ? 'expression tag' -1 2 1 4NEO ALA A 3 ? UNP Q9XC48 ? ? 'expression tag' 0 3 1 4NEO MSE A 4 ? UNP Q9XC48 ? ? 'expression tag' 1 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2' 174.241 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PG0 non-polymer . '2-(2-METHOXYETHOXY)ETHANOL' 'PEG 6000' 'C5 H12 O3' 120.147 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4NEO _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.26 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 62.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details ;protein was reductively methylated, & crystallized in 0.1M CHES:NaOH pH 9.5, 30% PEG 400 , VAPOR DIFFUSION, SITTING DROP, temperature 289K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.pdbx_collection_date 2012-07-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'SAGITALLY FOCUSED Si(111)' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97931 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97931 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM # _reflns.entry_id 4NEO _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 50 _reflns.number_all 8055 _reflns.number_obs 8055 _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 44.4 _reflns.pdbx_redundancy 7.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.14 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.429 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.number_unique_all 397 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4NEO _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 50 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.4900 _refine.ls_number_reflns_obs 8041 _refine.ls_number_reflns_all 8041 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.ls_R_factor_all 0.1808 _refine.ls_R_factor_obs 0.1808 _refine.ls_R_factor_R_work 0.1799 _refine.ls_wR_factor_R_work 0.1893 _refine.ls_R_factor_R_free 0.2007 _refine.ls_wR_factor_R_free 0.2158 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_number_reflns_R_free 371 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 63.2554 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.5900 _refine.aniso_B[2][2] 0.5900 _refine.aniso_B[3][3] -1.9000 _refine.aniso_B[1][2] 0.2900 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9660 _refine.correlation_coeff_Fo_to_Fc_free 0.9580 _refine.overall_SU_R_Cruickshank_DPI 0.1503 _refine.overall_SU_R_free 0.1322 _refine.pdbx_overall_ESU_R 0.1500 _refine.pdbx_overall_ESU_R_Free 0.1320 _refine.overall_SU_ML 0.1000 _refine.overall_SU_B 7.8840 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8949 _refine.B_iso_max 140.170 _refine.B_iso_min 37.880 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.300 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 637 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 680 _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 50 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 707 0.016 0.019 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 693 0.001 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 960 1.777 1.961 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 1581 0.862 3.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 92 4.789 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 35 34.591 21.714 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 111 16.314 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 11 24.027 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 111 0.094 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 813 0.009 0.020 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 168 0.003 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 353 3.269 3.925 ? ? 'X-RAY DIFFRACTION' r_mcbond_other 352 3.263 3.914 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 447 4.589 5.826 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.1040 _refine_ls_shell.d_res_low 2.1590 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 97.1400 _refine_ls_shell.number_reflns_R_work 553 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2060 _refine_ls_shell.R_factor_R_free 0.2370 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 577 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4NEO _struct.title 'Structure of BlmI, a type-II acyl-carrier-protein from Streptomyces verticillus involved in bleomycin biosynthesis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4NEO _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;Structural Genomics, PSI-Biology, Enzyme Discovery for Natural Product Biosynthesis, NatPro, peptide synthetase, BIOSYNTHETIC PROTEIN, LIGASE, Midwest Center for Structural Genomics, MCSG ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details 'THE AUTHOR STATES THAT THE BIOLOGICAL UNIT OF THIS PROTEIN IS UNKNOWN.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 6 ? LEU A 29 ? ALA A 3 LEU A 26 1 ? 24 HELX_P HELX_P2 2 ASN A 46 ? ASP A 62 ? ASN A 43 ASP A 59 1 ? 17 HELX_P HELX_P3 3 ILE A 67 ? ARG A 74 ? ILE A 64 ARG A 71 1 ? 8 HELX_P HELX_P4 4 THR A 75 ? LEU A 87 ? THR A 72 LEU A 84 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 51 C ? ? ? 1_555 A MLY 52 N ? ? A ILE 48 A MLY 49 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale2 covale both ? A MLY 52 C ? ? ? 1_555 A ILE 53 N ? ? A MLY 49 A ILE 50 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A GLY 78 C ? ? ? 1_555 A MSE 79 N ? ? A GLY 75 A MSE 76 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? A MSE 79 C ? ? ? 1_555 A THR 80 N ? ? A MSE 76 A THR 77 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PG0 _struct_site.pdbx_auth_seq_id 102 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE PG0 A 102' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id ARG _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 74 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id ARG _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 71 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _atom_sites.entry_id 4NEO _atom_sites.fract_transf_matrix[1][1] 0.013616 _atom_sites.fract_transf_matrix[1][2] 0.007861 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015723 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023078 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 SER 5 2 ? ? ? A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 PRO 7 4 4 PRO PRO A . n A 1 8 ARG 8 5 5 ARG ARG A . n A 1 9 GLY 9 6 6 GLY GLY A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 ARG 11 8 8 ARG ARG A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 ARG 14 11 11 ARG ARG A . n A 1 15 ARG 15 12 12 ARG ARG A . n A 1 16 ALA 16 13 13 ALA ALA A . n A 1 17 LEU 17 14 14 LEU LEU A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 ASP 20 17 17 ASP ASP A . n A 1 21 ILE 21 18 18 ILE ILE A . n A 1 22 ALA 22 19 19 ALA ALA A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 TRP 25 22 22 TRP TRP A . n A 1 26 ALA 26 23 23 ALA ALA A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 THR 28 25 25 THR THR A . n A 1 29 LEU 29 26 26 LEU LEU A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 ARG 31 28 28 ARG ARG A . n A 1 32 ASP 32 29 29 ASP ASP A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 GLY 35 32 32 GLY GLY A . n A 1 36 PRO 36 33 33 PRO PRO A . n A 1 37 HIS 37 34 34 HIS HIS A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 ASP 39 36 36 ASP ASP A . n A 1 40 PHE 40 37 37 PHE PHE A . n A 1 41 ALA 41 38 38 ALA ALA A . n A 1 42 ALA 42 39 39 ALA ALA A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 GLY 44 41 41 GLY GLY A . n A 1 45 GLY 45 42 42 GLY GLY A . n A 1 46 ASN 46 43 43 ASN ASN A . n A 1 47 SER 47 44 44 SER SER A . n A 1 48 ILE 48 45 45 ILE ILE A . n A 1 49 HIS 49 46 46 HIS HIS A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 ILE 51 48 48 ILE ILE A . n A 1 52 MLY 52 49 49 MLY MLY A . n A 1 53 ILE 53 50 50 ILE ILE A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 ASN 55 52 52 ASN ASN A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 GLU 58 55 55 GLU GLU A . n A 1 59 GLU 59 56 56 GLU GLU A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 VAL 61 58 58 VAL VAL A . n A 1 62 ASP 62 59 59 ASP ASP A . n A 1 63 ALA 63 60 60 ALA ALA A . n A 1 64 GLU 64 61 61 GLU GLU A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 SER 66 63 63 SER SER A . n A 1 67 ILE 67 64 64 ILE ILE A . n A 1 68 ARG 68 65 65 ARG ARG A . n A 1 69 VAL 69 66 66 VAL VAL A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 GLU 72 69 69 GLU GLU A . n A 1 73 THR 73 70 70 THR THR A . n A 1 74 ARG 74 71 71 ARG ARG A . n A 1 75 THR 75 72 72 THR THR A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 ALA 77 74 74 ALA ALA A . n A 1 78 GLY 78 75 75 GLY GLY A . n A 1 79 MSE 79 76 76 MSE MSE A . n A 1 80 THR 80 77 77 THR THR A . n A 1 81 ASP 81 78 78 ASP ASP A . n A 1 82 HIS 82 79 79 HIS HIS A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 HIS 84 81 81 HIS HIS A . n A 1 85 ALA 85 82 82 ALA ALA A . n A 1 86 THR 86 83 83 THR THR A . n A 1 87 LEU 87 84 84 LEU LEU A . n A 1 88 THR 88 85 85 THR THR A . n A 1 89 GLY 89 86 ? ? ? A . n A 1 90 GLU 90 87 ? ? ? A . n A 1 91 ARG 91 88 ? ? ? A . n A 1 92 ASP 92 89 ? ? ? A . n A 1 93 ARG 93 90 ? ? ? A . n # loop_ _pdbx_SG_project.id _pdbx_SG_project.project_name _pdbx_SG_project.full_name_of_center _pdbx_SG_project.initial_of_center 1 PSI:Biology 'Enzyme Discovery for Natural Product Biosynthesis' NatPro 2 PSI:Biology 'Midwest Center for Structural Genomics' MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 101 103 EDO EDO A . C 3 PG0 1 102 105 PG0 PG0 A . D 4 HOH 1 201 1 HOH HOH A . D 4 HOH 2 202 2 HOH HOH A . D 4 HOH 3 203 3 HOH HOH A . D 4 HOH 4 204 4 HOH HOH A . D 4 HOH 5 205 5 HOH HOH A . D 4 HOH 6 206 6 HOH HOH A . D 4 HOH 7 207 7 HOH HOH A . D 4 HOH 8 208 8 HOH HOH A . D 4 HOH 9 209 9 HOH HOH A . D 4 HOH 10 210 10 HOH HOH A . D 4 HOH 11 211 11 HOH HOH A . D 4 HOH 12 212 12 HOH HOH A . D 4 HOH 13 213 13 HOH HOH A . D 4 HOH 14 214 14 HOH HOH A . D 4 HOH 15 215 15 HOH HOH A . D 4 HOH 16 216 16 HOH HOH A . D 4 HOH 17 217 17 HOH HOH A . D 4 HOH 18 218 18 HOH HOH A . D 4 HOH 19 219 19 HOH HOH A . D 4 HOH 20 220 20 HOH HOH A . D 4 HOH 21 221 21 HOH HOH A . D 4 HOH 22 222 22 HOH HOH A . D 4 HOH 23 223 23 HOH HOH A . D 4 HOH 24 224 24 HOH HOH A . D 4 HOH 25 225 25 HOH HOH A . D 4 HOH 26 226 26 HOH HOH A . D 4 HOH 27 227 27 HOH HOH A . D 4 HOH 28 228 28 HOH HOH A . D 4 HOH 29 229 29 HOH HOH A . D 4 HOH 30 230 30 HOH HOH A . D 4 HOH 31 231 31 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MLY 52 A MLY 49 ? LYS N-DIMETHYL-LYSINE 2 A MSE 79 A MSE 76 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-01-29 2 'Structure model' 1 1 2014-02-19 3 'Structure model' 1 2 2014-03-19 4 'Structure model' 1 3 2014-09-03 5 'Structure model' 1 4 2017-11-15 6 'Structure model' 1 5 2023-03-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Refinement description' 5 6 'Structure model' 'Database references' 6 6 'Structure model' 'Derived calculations' 7 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' software 2 6 'Structure model' audit_author 3 6 'Structure model' database_2 4 6 'Structure model' struct_conn 5 6 'Structure model' struct_ref_seq_dif 6 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 6 'Structure model' '_audit_author.name' 2 6 'Structure model' '_database_2.pdbx_DOI' 3 6 'Structure model' '_database_2.pdbx_database_accession' 4 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 6 'Structure model' '_struct_ref_seq_dif.details' 6 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.100 _diffrn_reflns.pdbx_d_res_low 50.000 _diffrn_reflns.pdbx_number_obs 8055 _diffrn_reflns.pdbx_Rmerge_I_obs 0.070 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 1.77 _diffrn_reflns.av_sigmaI_over_netI ? _diffrn_reflns.pdbx_redundancy 7.10 _diffrn_reflns.pdbx_percent_possible_obs 99.70 _diffrn_reflns.number 56933 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 5.70 50.00 ? ? 0.071 ? 6.347 5.80 96.40 1 4.52 5.70 ? ? 0.062 ? 4.564 6.80 99.80 1 3.95 4.52 ? ? 0.055 ? 3.033 6.80 99.50 1 3.59 3.95 ? ? 0.059 ? 2.865 7.00 99.50 1 3.33 3.59 ? ? 0.063 ? 2.654 7.20 100.00 1 3.14 3.33 ? ? 0.074 ? 2.505 7.20 100.00 1 2.98 3.14 ? ? 0.080 ? 2.055 7.20 100.00 1 2.85 2.98 ? ? 0.093 ? 1.767 7.30 100.00 1 2.74 2.85 ? ? 0.105 ? 1.416 7.30 100.00 1 2.65 2.74 ? ? 0.108 ? 1.195 7.30 100.00 1 2.56 2.65 ? ? 0.115 ? 1.051 7.30 100.00 1 2.49 2.56 ? ? 0.127 ? 1.022 7.30 100.00 1 2.42 2.49 ? ? 0.152 ? 0.892 7.30 100.00 1 2.37 2.42 ? ? 0.158 ? 0.759 7.30 100.00 1 2.31 2.37 ? ? 0.203 ? 0.714 7.30 100.00 1 2.26 2.31 ? ? 0.264 ? 0.708 7.30 100.00 1 2.22 2.26 ? ? 0.327 ? 0.631 7.30 100.00 1 2.18 2.22 ? ? 0.298 ? 0.590 7.30 100.00 1 2.14 2.18 ? ? 0.341 ? 0.681 6.70 100.00 1 2.10 2.14 ? ? 0.429 ? 0.553 6.30 100.00 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 32.0853 _pdbx_refine_tls.origin_y 29.9073 _pdbx_refine_tls.origin_z -1.6628 _pdbx_refine_tls.T[1][1] 0.0330 _pdbx_refine_tls.T[2][2] 0.1167 _pdbx_refine_tls.T[3][3] 0.0438 _pdbx_refine_tls.T[1][2] -0.0333 _pdbx_refine_tls.T[1][3] 0.0105 _pdbx_refine_tls.T[2][3] 0.0138 _pdbx_refine_tls.L[1][1] 5.8503 _pdbx_refine_tls.L[2][2] 6.7594 _pdbx_refine_tls.L[3][3] 5.9940 _pdbx_refine_tls.L[1][2] -3.6795 _pdbx_refine_tls.L[1][3] 0.7254 _pdbx_refine_tls.L[2][3] 0.7056 _pdbx_refine_tls.S[1][1] 0.2636 _pdbx_refine_tls.S[2][2] -0.3044 _pdbx_refine_tls.S[3][3] 0.0408 _pdbx_refine_tls.S[1][2] 0.1387 _pdbx_refine_tls.S[1][3] 0.3334 _pdbx_refine_tls.S[2][3] 0.0604 _pdbx_refine_tls.S[2][1] -0.0843 _pdbx_refine_tls.S[3][1] 0.0940 _pdbx_refine_tls.S[3][2] 0.2874 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 3 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 85 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _pdbx_phasing_MAD_set.id 1 _pdbx_phasing_MAD_set.d_res_high 2.10 _pdbx_phasing_MAD_set.d_res_low 50.00 _pdbx_phasing_MAD_set.reflns_acentric 7089 _pdbx_phasing_MAD_set.loc_acentric 0.100 _pdbx_phasing_MAD_set.power_acentric 0.000 _pdbx_phasing_MAD_set.R_cullis_acentric 1.540 _pdbx_phasing_MAD_set.reflns_centric 952 _pdbx_phasing_MAD_set.loc_centric 0.100 _pdbx_phasing_MAD_set.power_centric 0.000 _pdbx_phasing_MAD_set.R_cullis_centric 1.000 # loop_ _pdbx_phasing_MAD_set_shell.id _pdbx_phasing_MAD_set_shell.d_res_high _pdbx_phasing_MAD_set_shell.d_res_low _pdbx_phasing_MAD_set_shell.reflns_acentric _pdbx_phasing_MAD_set_shell.loc_acentric _pdbx_phasing_MAD_set_shell.power_acentric _pdbx_phasing_MAD_set_shell.R_cullis_acentric _pdbx_phasing_MAD_set_shell.reflns_centric _pdbx_phasing_MAD_set_shell.loc_centric _pdbx_phasing_MAD_set_shell.power_centric _pdbx_phasing_MAD_set_shell.R_cullis_centric 1 12.98 50.00 22 0.400 0.000 1.560 15 0.200 0.000 1.000 1 7.46 12.98 107 0.300 0.000 1.050 49 0.200 0.000 1.000 1 5.23 7.46 287 0.200 0.000 1.260 79 0.100 0.000 1.000 1 4.03 5.23 530 0.200 0.000 1.160 101 0.100 0.000 1.000 1 3.28 4.03 858 0.100 0.000 1.140 137 0.100 0.000 1.000 1 2.76 3.28 1270 0.000 0.000 1.940 157 0.000 0.000 1.000 1 2.39 2.76 1756 0.000 0.000 5.080 200 0.000 0.000 1.000 1 2.10 2.39 2259 0.000 0.000 7.770 214 0.000 0.000 1.000 # _pdbx_phasing_MAD_set_site.id 1 _pdbx_phasing_MAD_set_site.atom_type_symbol Se _pdbx_phasing_MAD_set_site.fract_x -0.340 _pdbx_phasing_MAD_set_site.fract_y -0.506 _pdbx_phasing_MAD_set_site.fract_z -0.007 _pdbx_phasing_MAD_set_site.b_iso 63.7551 _pdbx_phasing_MAD_set_site.occupancy_iso 0.000 _pdbx_phasing_MAD_set_site.occupancy 5.185 # loop_ _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom _pdbx_phasing_MAD_shell.reflns_centric _pdbx_phasing_MAD_shell.fom_centric _pdbx_phasing_MAD_shell.reflns_acentric _pdbx_phasing_MAD_shell.fom_acentric 12.98 50.00 37 0.226 15 0.000 22 0.381 7.46 12.98 156 0.313 49 0.000 107 0.457 5.23 7.46 366 0.408 79 0.000 287 0.520 4.03 5.23 631 0.403 101 0.000 530 0.479 3.28 4.03 995 0.412 137 0.000 858 0.478 2.76 3.28 1427 0.398 157 0.000 1270 0.447 2.39 2.76 1956 0.255 200 0.000 1756 0.284 2.10 2.39 2473 0.106 214 0.000 2259 0.116 # _pdbx_phasing_dm.entry_id 4NEO _pdbx_phasing_dm.method 'Solvent flattening and Histogram matching' _pdbx_phasing_dm.reflns 8041 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 5.420 100.000 64.400 ? ? ? 0.826 ? ? 501 4.270 5.420 63.400 ? ? ? 0.914 ? ? 504 3.720 4.270 59.300 ? ? ? 0.925 ? ? 505 3.370 3.720 58.800 ? ? ? 0.914 ? ? 503 3.120 3.370 57.700 ? ? ? 0.920 ? ? 514 2.930 3.120 55.200 ? ? ? 0.906 ? ? 503 2.790 2.930 62.500 ? ? ? 0.879 ? ? 505 2.660 2.790 64.200 ? ? ? 0.880 ? ? 501 2.560 2.660 60.600 ? ? ? 0.886 ? ? 505 2.470 2.560 65.600 ? ? ? 0.899 ? ? 502 2.390 2.470 64.100 ? ? ? 0.890 ? ? 502 2.320 2.390 68.200 ? ? ? 0.885 ? ? 502 2.260 2.320 73.500 ? ? ? 0.862 ? ? 506 2.200 2.260 75.200 ? ? ? 0.874 ? ? 501 2.100 2.200 81.200 ? ? ? 0.850 ? ? 987 # _phasing.method SAD # _phasing_MAD.entry_id 4NEO _phasing_MAD.pdbx_d_res_high 2.10 _phasing_MAD.pdbx_d_res_low 50.00 _phasing_MAD.pdbx_reflns 8041 _phasing_MAD.pdbx_fom 0.273 _phasing_MAD.pdbx_reflns_centric 952 _phasing_MAD.pdbx_fom_centric 0.000 _phasing_MAD.pdbx_reflns_acentric 7089 _phasing_MAD.pdbx_fom_acentric 0.310 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 MLPHARE . ? other 'Eleanor J. Dodson' ccp4@ccp4.ac.uk phasing http://www.ccp4.ac.uk/dist/html/mlphare.html Fortran_77 ? 4 DM 6.1 ? program 'Kevin Cowtan' kowtan@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/dm.html Fortran_77 ? 5 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 6 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 7 SBC-Collect . ? ? ? ? 'data collection' ? ? ? 8 HKL-3000 . ? ? ? ? 'data reduction' ? ? ? 9 HKL-3000 . ? ? ? ? 'data scaling' ? ? ? 10 HKL-3000 SHELXD ? ? ? ? phasing ? ? ? 11 SHELXE . ? ? ? ? 'model building' ? ? ? 12 SOLVE . ? ? ? ? phasing ? ? ? 13 RESOLVE . ? ? ? ? phasing ? ? ? 14 ARP/wARP . ? ? ? ? 'model building' ? ? ? 15 CCP4 . ? ? ? ? phasing ? ? ? 16 O . ? ? ? ? 'model building' ? ? ? 17 Coot . ? ? ? ? 'model building' ? ? ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 16 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 A _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 209 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 11 ? A CZ A ARG 11 ? A NH1 A ARG 11 ? A 124.71 120.30 4.41 0.50 N 2 1 NE A ARG 11 ? A CZ A ARG 11 ? A NH2 A ARG 11 ? A 116.21 120.30 -4.09 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 71 ? ? 69.86 -3.86 2 1 LEU A 84 ? ? -63.23 2.29 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 5 ? CG ? A ARG 8 CG 2 1 Y 1 A ARG 5 ? CD ? A ARG 8 CD 3 1 Y 1 A ARG 5 ? NE ? A ARG 8 NE 4 1 Y 1 A ARG 5 ? CZ ? A ARG 8 CZ 5 1 Y 1 A ARG 5 ? NH1 ? A ARG 8 NH1 6 1 Y 1 A ARG 5 ? NH2 ? A ARG 8 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 5 1 Y 1 A SER 2 ? A SER 5 6 1 Y 1 A GLY 86 ? A GLY 89 7 1 Y 1 A GLU 87 ? A GLU 90 8 1 Y 1 A ARG 88 ? A ARG 91 9 1 Y 1 A ASP 89 ? A ASP 92 10 1 Y 1 A ARG 90 ? A ARG 93 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 '2-(2-METHOXYETHOXY)ETHANOL' PG0 4 water HOH #