data_4NYW # _entry.id 4NYW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4NYW RCSB RCSB083829 WWPDB D_1000083829 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4NYV . unspecified PDB 4NYX . unspecified # _pdbx_database_status.entry_id 4NYW _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-12-11 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Filippakopoulos, P.' 1 'Picaud, S.' 2 'Felletar, I.' 3 'Rooney, T.P.C.' 4 'Fedorov, O.' 5 'Martin, S.' 6 'Monteiro, O.P.' 7 'Conway, S.J.' 8 'von Delft, F.' 9 'Brennan, P.' 10 'Arrowsmith, C.H.' 11 'Edwards, A.M.' 12 'Bountra, C.' 13 'Knapp, S.' 14 'Structural Genomics Consortium (SGC)' 15 # _citation.id primary _citation.title 'Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Filippakopoulos, P.' 1 primary 'Picaud, S.' 2 primary 'Felletar, I.' 3 primary 'Rooney, T.P.C.' 4 primary 'Fedorov, O.' 5 primary 'Martin, S.' 6 primary 'Monteiro, O.P.' 7 primary 'Conway, S.J.' 8 primary 'von Delft, F.' 9 primary 'Brennan, P.' 10 primary 'Arrowsmith, C.H.' 11 primary 'Edwards, A.M.' 12 primary 'Bountra, C.' 13 primary 'Knapp, S.' 14 # _cell.length_a 34.966 _cell.length_b 49.917 _cell.length_c 80.160 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4NYW _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 4NYW _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CREB-binding protein' 14223.349 1 ? ? 'UNP residues 1081-1197' ? 2 non-polymer syn 'THIOCYANATE ION' 58.082 1 ? ? ? ? 3 non-polymer syn '(3R)-N-[3-(3,4-dihydroquinolin-1(2H)-yl)propyl]-3-methyl-2-oxo-1,2,3,4-tetrahydroquinoxaline-5-carboxamide' 378.467 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 5 water nat water 18.015 186 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_seq_one_letter_code_can ;SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ARG n 1 4 LYS n 1 5 LYS n 1 6 ILE n 1 7 PHE n 1 8 LYS n 1 9 PRO n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 ARG n 1 14 GLN n 1 15 ALA n 1 16 LEU n 1 17 MET n 1 18 PRO n 1 19 THR n 1 20 LEU n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 TYR n 1 25 ARG n 1 26 GLN n 1 27 ASP n 1 28 PRO n 1 29 GLU n 1 30 SER n 1 31 LEU n 1 32 PRO n 1 33 PHE n 1 34 ARG n 1 35 GLN n 1 36 PRO n 1 37 VAL n 1 38 ASP n 1 39 PRO n 1 40 GLN n 1 41 LEU n 1 42 LEU n 1 43 GLY n 1 44 ILE n 1 45 PRO n 1 46 ASP n 1 47 TYR n 1 48 PHE n 1 49 ASP n 1 50 ILE n 1 51 VAL n 1 52 LYS n 1 53 ASN n 1 54 PRO n 1 55 MET n 1 56 ASP n 1 57 LEU n 1 58 SER n 1 59 THR n 1 60 ILE n 1 61 LYS n 1 62 ARG n 1 63 LYS n 1 64 LEU n 1 65 ASP n 1 66 THR n 1 67 GLY n 1 68 GLN n 1 69 TYR n 1 70 GLN n 1 71 GLU n 1 72 PRO n 1 73 TRP n 1 74 GLN n 1 75 TYR n 1 76 VAL n 1 77 ASP n 1 78 ASP n 1 79 VAL n 1 80 TRP n 1 81 LEU n 1 82 MET n 1 83 PHE n 1 84 ASN n 1 85 ASN n 1 86 ALA n 1 87 TRP n 1 88 LEU n 1 89 TYR n 1 90 ASN n 1 91 ARG n 1 92 LYS n 1 93 THR n 1 94 SER n 1 95 ARG n 1 96 VAL n 1 97 TYR n 1 98 LYS n 1 99 PHE n 1 100 CYS n 1 101 SER n 1 102 LYS n 1 103 LEU n 1 104 ALA n 1 105 GLU n 1 106 VAL n 1 107 PHE n 1 108 GLU n 1 109 GLN n 1 110 GLU n 1 111 ILE n 1 112 ASP n 1 113 PRO n 1 114 VAL n 1 115 MET n 1 116 GLN n 1 117 SER n 1 118 LEU n 1 119 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CBP, CREBBP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-R3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBP_HUMAN _struct_ref.pdbx_db_accession Q92793 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLM FNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _struct_ref.pdbx_align_begin 1081 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4NYW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92793 _struct_ref_seq.db_align_beg 1081 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1081 _struct_ref_seq.pdbx_auth_seq_align_end 1197 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4NYW SER A 1 ? UNP Q92793 ? ? 'EXPRESSION TAG' 1079 1 1 4NYW MET A 2 ? UNP Q92793 ? ? 'EXPRESSION TAG' 1080 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2O3 non-polymer . '(3R)-N-[3-(3,4-dihydroquinolin-1(2H)-yl)propyl]-3-methyl-2-oxo-1,2,3,4-tetrahydroquinoxaline-5-carboxamide' ? 'C22 H26 N4 O2' 378.467 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SCN non-polymer . 'THIOCYANATE ION' ? 'C N S -1' 58.082 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4NYW _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 49.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '20% PEG 3350, 9% Ethylene Glycol, 0.18M KSCN, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.pdbx_collection_date 2011-07-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9173 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9173 _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04-1 # _reflns.entry_id 4NYW _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 1.42 _reflns.d_resolution_low 19.69 _reflns.number_all 26900 _reflns.number_obs 26470 _reflns.percent_possible_obs 98.4 _reflns.pdbx_Rmerge_I_obs 0.097 _reflns.pdbx_Rsym_value 0.097 _reflns.pdbx_netI_over_sigmaI 15.1 _reflns.B_iso_Wilson_estimate 14.0 _reflns.pdbx_redundancy 11.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_obs _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_redundancy _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.42 1.50 ? 98.4 0.866 2.0 0.866 7.4 3748 ? ? ? ? 1 1 1.50 1.59 ? 98.6 0.640 2.8 0.640 6.9 3474 ? ? ? ? 2 1 1.59 1.70 ? 99.3 0.434 4.8 0.434 9.5 3400 ? ? ? ? 3 1 1.70 1.84 ? 99.3 0.305 8.4 0.305 13.9 3166 ? ? ? ? 4 1 1.84 2.02 ? 99.6 0.195 12.6 0.195 14.6 2963 ? ? ? ? 5 1 2.02 2.25 ? 99.6 0.116 19.0 0.116 14.0 2684 ? ? ? ? 6 1 2.25 2.60 ? 99.7 0.084 26.6 0.084 15.1 2395 ? ? ? ? 7 1 2.60 3.19 ? 99.7 0.064 33.3 0.064 14.2 2061 ? ? ? ? 8 1 3.19 4.51 ? 99.6 0.047 46.7 0.047 13.8 1628 ? ? ? ? 9 1 4.51 19.69 ? 98.9 0.059 45.4 0.059 13.4 951 ? ? ? ? 10 1 # _refine.entry_id 4NYW _refine.ls_d_res_high 1.4300 _refine.ls_d_res_low 19.6900 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.0800 _refine.ls_number_reflns_obs 26424 _refine.ls_number_reflns_all 26941 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_obs 0.1638 _refine.ls_R_factor_R_work 0.1625 _refine.ls_wR_factor_R_work 0.1516 _refine.ls_R_factor_R_free 0.1867 _refine.ls_wR_factor_R_free 0.1750 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_number_reflns_R_free 1330 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 17.8195 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.9400 _refine.aniso_B[2][2] 0.3100 _refine.aniso_B[3][3] -1.2500 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9700 _refine.correlation_coeff_Fo_to_Fc_free 0.9590 _refine.overall_SU_R_Cruickshank_DPI 0.0581 _refine.overall_SU_R_free 0.0599 _refine.pdbx_overall_ESU_R 0.0580 _refine.pdbx_overall_ESU_R_Free 0.0600 _refine.overall_SU_ML 0.0360 _refine.overall_SU_B 1.7850 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 'Ensemble of PDB entries 3DAI, 3HMH, 2GRC, 2OO1, 2OSS, 2OUO, 3D7C, and 3DWY' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.9017 _refine.B_iso_max 103.490 _refine.B_iso_min 6.960 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.300 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_R_factor_all ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 968 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 186 _refine_hist.number_atoms_total 1193 _refine_hist.d_res_high 1.4300 _refine_hist.d_res_low 19.6900 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 1056 0.014 0.022 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 749 0.005 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1431 1.529 2.008 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 1823 1.125 3.008 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 119 5.482 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 54 38.531 25.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 180 10.770 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 6 10.711 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 146 0.092 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 1145 0.010 0.021 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 210 0.001 0.020 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 1.43 _refine_ls_shell.d_res_low 1.4620 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 95.1900 _refine_ls_shell.number_reflns_R_work 1637 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2800 _refine_ls_shell.R_factor_R_free 0.3000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 84 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1721 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4NYW _struct.title 'Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand' _struct.pdbx_descriptor 'CREB-binding protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4NYW _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'CREBBP, CREB BINDING, KAT3A, RSTS, RST, BROMODOMAIN, TRANSCRIPTION, Structural Genomics Consortium, SGC' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 8 ? ARG A 25 ? LYS A 1086 ARG A 1103 1 ? 18 HELX_P HELX_P2 2 SER A 30 ? ARG A 34 ? SER A 1108 ARG A 1112 5 ? 5 HELX_P HELX_P3 3 ASP A 38 ? GLY A 43 ? ASP A 1116 GLY A 1121 1 ? 6 HELX_P HELX_P4 4 ASP A 46 ? VAL A 51 ? ASP A 1124 VAL A 1129 1 ? 6 HELX_P HELX_P5 5 ASP A 56 ? THR A 66 ? ASP A 1134 THR A 1144 1 ? 11 HELX_P HELX_P6 6 GLU A 71 ? ASN A 90 ? GLU A 1149 ASN A 1168 1 ? 20 HELX_P HELX_P7 7 SER A 94 ? GLY A 119 ? SER A 1172 GLY A 1197 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 1105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 16.13 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SCN A 1201' AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 2O3 A 1202' AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDO A 1203' AC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE EDO A 1204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 TRP A 73 ? TRP A 1151 . ? 1_555 ? 2 AC1 5 VAL A 76 ? VAL A 1154 . ? 1_555 ? 3 AC1 5 THR A 93 ? THR A 1171 . ? 4_565 ? 4 AC1 5 LYS A 98 ? LYS A 1176 . ? 4_565 ? 5 AC1 5 HOH F . ? HOH A 1422 . ? 1_555 ? 6 AC2 11 PRO A 32 ? PRO A 1110 . ? 1_555 ? 7 AC2 11 VAL A 37 ? VAL A 1115 . ? 1_555 ? 8 AC2 11 LEU A 42 ? LEU A 1120 . ? 1_555 ? 9 AC2 11 ASN A 90 ? ASN A 1168 . ? 1_555 ? 10 AC2 11 ARG A 95 ? ARG A 1173 . ? 1_555 ? 11 AC2 11 VAL A 96 ? VAL A 1174 . ? 1_555 ? 12 AC2 11 EDO E . ? EDO A 1204 . ? 1_555 ? 13 AC2 11 HOH F . ? HOH A 1303 . ? 1_555 ? 14 AC2 11 HOH F . ? HOH A 1317 . ? 1_555 ? 15 AC2 11 HOH F . ? HOH A 1367 . ? 1_555 ? 16 AC2 11 HOH F . ? HOH A 1396 . ? 1_555 ? 17 AC3 10 PRO A 9 ? PRO A 1087 . ? 1_555 ? 18 AC3 10 GLU A 10 ? GLU A 1088 . ? 1_555 ? 19 AC3 10 ARG A 13 ? ARG A 1091 . ? 1_555 ? 20 AC3 10 LEU A 64 ? LEU A 1142 . ? 1_555 ? 21 AC3 10 ASP A 65 ? ASP A 1143 . ? 1_555 ? 22 AC3 10 GLY A 67 ? GLY A 1145 . ? 1_555 ? 23 AC3 10 ARG A 91 ? ARG A 1169 . ? 2_665 ? 24 AC3 10 ASP A 112 ? ASP A 1190 . ? 3_745 ? 25 AC3 10 HOH F . ? HOH A 1309 . ? 3_745 ? 26 AC3 10 HOH F . ? HOH A 1393 . ? 2_665 ? 27 AC4 8 PRO A 28 ? PRO A 1106 . ? 1_555 ? 28 AC4 8 LEU A 31 ? LEU A 1109 . ? 1_555 ? 29 AC4 8 SER A 101 ? SER A 1179 . ? 4_465 ? 30 AC4 8 2O3 C . ? 2O3 A 1202 . ? 1_555 ? 31 AC4 8 HOH F . ? HOH A 1308 . ? 4_465 ? 32 AC4 8 HOH F . ? HOH A 1323 . ? 4_465 ? 33 AC4 8 HOH F . ? HOH A 1338 . ? 4_465 ? 34 AC4 8 HOH F . ? HOH A 1362 . ? 1_555 ? # _atom_sites.entry_id 4NYW _atom_sites.fract_transf_matrix[1][1] 0.028599 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020033 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012475 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1079 ? ? ? A . n A 1 2 MET 2 1080 ? ? ? A . n A 1 3 ARG 3 1081 ? ? ? A . n A 1 4 LYS 4 1082 1082 LYS LYS A . n A 1 5 LYS 5 1083 1083 LYS LYS A . n A 1 6 ILE 6 1084 1084 ILE ILE A . n A 1 7 PHE 7 1085 1085 PHE PHE A . n A 1 8 LYS 8 1086 1086 LYS LYS A . n A 1 9 PRO 9 1087 1087 PRO PRO A . n A 1 10 GLU 10 1088 1088 GLU GLU A . n A 1 11 GLU 11 1089 1089 GLU GLU A . n A 1 12 LEU 12 1090 1090 LEU LEU A . n A 1 13 ARG 13 1091 1091 ARG ARG A . n A 1 14 GLN 14 1092 1092 GLN GLN A . n A 1 15 ALA 15 1093 1093 ALA ALA A . n A 1 16 LEU 16 1094 1094 LEU LEU A . n A 1 17 MET 17 1095 1095 MET MET A . n A 1 18 PRO 18 1096 1096 PRO PRO A . n A 1 19 THR 19 1097 1097 THR THR A . n A 1 20 LEU 20 1098 1098 LEU LEU A . n A 1 21 GLU 21 1099 1099 GLU GLU A . n A 1 22 ALA 22 1100 1100 ALA ALA A . n A 1 23 LEU 23 1101 1101 LEU LEU A . n A 1 24 TYR 24 1102 1102 TYR TYR A . n A 1 25 ARG 25 1103 1103 ARG ARG A . n A 1 26 GLN 26 1104 1104 GLN GLN A . n A 1 27 ASP 27 1105 1105 ASP ASP A . n A 1 28 PRO 28 1106 1106 PRO PRO A . n A 1 29 GLU 29 1107 1107 GLU GLU A . n A 1 30 SER 30 1108 1108 SER SER A . n A 1 31 LEU 31 1109 1109 LEU LEU A . n A 1 32 PRO 32 1110 1110 PRO PRO A . n A 1 33 PHE 33 1111 1111 PHE PHE A . n A 1 34 ARG 34 1112 1112 ARG ARG A . n A 1 35 GLN 35 1113 1113 GLN GLN A . n A 1 36 PRO 36 1114 1114 PRO PRO A . n A 1 37 VAL 37 1115 1115 VAL VAL A . n A 1 38 ASP 38 1116 1116 ASP ASP A . n A 1 39 PRO 39 1117 1117 PRO PRO A . n A 1 40 GLN 40 1118 1118 GLN GLN A . n A 1 41 LEU 41 1119 1119 LEU LEU A . n A 1 42 LEU 42 1120 1120 LEU LEU A . n A 1 43 GLY 43 1121 1121 GLY GLY A . n A 1 44 ILE 44 1122 1122 ILE ILE A . n A 1 45 PRO 45 1123 1123 PRO PRO A . n A 1 46 ASP 46 1124 1124 ASP ASP A . n A 1 47 TYR 47 1125 1125 TYR TYR A . n A 1 48 PHE 48 1126 1126 PHE PHE A . n A 1 49 ASP 49 1127 1127 ASP ASP A . n A 1 50 ILE 50 1128 1128 ILE ILE A . n A 1 51 VAL 51 1129 1129 VAL VAL A . n A 1 52 LYS 52 1130 1130 LYS LYS A . n A 1 53 ASN 53 1131 1131 ASN ASN A . n A 1 54 PRO 54 1132 1132 PRO PRO A . n A 1 55 MET 55 1133 1133 MET MET A . n A 1 56 ASP 56 1134 1134 ASP ASP A . n A 1 57 LEU 57 1135 1135 LEU LEU A . n A 1 58 SER 58 1136 1136 SER SER A . n A 1 59 THR 59 1137 1137 THR THR A . n A 1 60 ILE 60 1138 1138 ILE ILE A . n A 1 61 LYS 61 1139 1139 LYS LYS A . n A 1 62 ARG 62 1140 1140 ARG ARG A . n A 1 63 LYS 63 1141 1141 LYS LYS A . n A 1 64 LEU 64 1142 1142 LEU LEU A . n A 1 65 ASP 65 1143 1143 ASP ASP A . n A 1 66 THR 66 1144 1144 THR THR A . n A 1 67 GLY 67 1145 1145 GLY GLY A . n A 1 68 GLN 68 1146 1146 GLN GLN A . n A 1 69 TYR 69 1147 1147 TYR TYR A . n A 1 70 GLN 70 1148 1148 GLN GLN A . n A 1 71 GLU 71 1149 1149 GLU GLU A . n A 1 72 PRO 72 1150 1150 PRO PRO A . n A 1 73 TRP 73 1151 1151 TRP TRP A . n A 1 74 GLN 74 1152 1152 GLN GLN A . n A 1 75 TYR 75 1153 1153 TYR TYR A . n A 1 76 VAL 76 1154 1154 VAL VAL A . n A 1 77 ASP 77 1155 1155 ASP ASP A . n A 1 78 ASP 78 1156 1156 ASP ASP A . n A 1 79 VAL 79 1157 1157 VAL VAL A . n A 1 80 TRP 80 1158 1158 TRP TRP A . n A 1 81 LEU 81 1159 1159 LEU LEU A . n A 1 82 MET 82 1160 1160 MET MET A . n A 1 83 PHE 83 1161 1161 PHE PHE A . n A 1 84 ASN 84 1162 1162 ASN ASN A . n A 1 85 ASN 85 1163 1163 ASN ASN A . n A 1 86 ALA 86 1164 1164 ALA ALA A . n A 1 87 TRP 87 1165 1165 TRP TRP A . n A 1 88 LEU 88 1166 1166 LEU LEU A . n A 1 89 TYR 89 1167 1167 TYR TYR A . n A 1 90 ASN 90 1168 1168 ASN ASN A . n A 1 91 ARG 91 1169 1169 ARG ARG A . n A 1 92 LYS 92 1170 1170 LYS LYS A . n A 1 93 THR 93 1171 1171 THR THR A . n A 1 94 SER 94 1172 1172 SER SER A . n A 1 95 ARG 95 1173 1173 ARG ARG A . n A 1 96 VAL 96 1174 1174 VAL VAL A . n A 1 97 TYR 97 1175 1175 TYR TYR A . n A 1 98 LYS 98 1176 1176 LYS LYS A . n A 1 99 PHE 99 1177 1177 PHE PHE A . n A 1 100 CYS 100 1178 1178 CYS CYS A . n A 1 101 SER 101 1179 1179 SER SER A . n A 1 102 LYS 102 1180 1180 LYS LYS A . n A 1 103 LEU 103 1181 1181 LEU LEU A . n A 1 104 ALA 104 1182 1182 ALA ALA A . n A 1 105 GLU 105 1183 1183 GLU GLU A . n A 1 106 VAL 106 1184 1184 VAL VAL A . n A 1 107 PHE 107 1185 1185 PHE PHE A . n A 1 108 GLU 108 1186 1186 GLU GLU A . n A 1 109 GLN 109 1187 1187 GLN GLN A . n A 1 110 GLU 110 1188 1188 GLU GLU A . n A 1 111 ILE 111 1189 1189 ILE ILE A . n A 1 112 ASP 112 1190 1190 ASP ASP A . n A 1 113 PRO 113 1191 1191 PRO PRO A . n A 1 114 VAL 114 1192 1192 VAL VAL A . n A 1 115 MET 115 1193 1193 MET MET A . n A 1 116 GLN 116 1194 1194 GLN GLN A . n A 1 117 SER 117 1195 1195 SER SER A . n A 1 118 LEU 118 1196 1196 LEU LEU A . n A 1 119 GLY 119 1197 1197 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SCN 1 1201 1 SCN SCN A . C 3 2O3 1 1202 1 2O3 DRG A . D 4 EDO 1 1203 1 EDO EDO A . E 4 EDO 1 1204 2 EDO EDO A . F 5 HOH 1 1301 1 HOH HOH A . F 5 HOH 2 1302 2 HOH HOH A . F 5 HOH 3 1303 3 HOH HOH A . F 5 HOH 4 1304 4 HOH HOH A . F 5 HOH 5 1305 5 HOH HOH A . F 5 HOH 6 1306 6 HOH HOH A . F 5 HOH 7 1307 7 HOH HOH A . F 5 HOH 8 1308 8 HOH HOH A . F 5 HOH 9 1309 9 HOH HOH A . F 5 HOH 10 1310 10 HOH HOH A . F 5 HOH 11 1311 11 HOH HOH A . F 5 HOH 12 1312 12 HOH HOH A . F 5 HOH 13 1313 13 HOH HOH A . F 5 HOH 14 1314 14 HOH HOH A . F 5 HOH 15 1315 15 HOH HOH A . F 5 HOH 16 1316 16 HOH HOH A . F 5 HOH 17 1317 17 HOH HOH A . F 5 HOH 18 1318 18 HOH HOH A . F 5 HOH 19 1319 19 HOH HOH A . F 5 HOH 20 1320 20 HOH HOH A . F 5 HOH 21 1321 21 HOH HOH A . F 5 HOH 22 1322 22 HOH HOH A . F 5 HOH 23 1323 23 HOH HOH A . F 5 HOH 24 1324 24 HOH HOH A . F 5 HOH 25 1325 25 HOH HOH A . F 5 HOH 26 1326 26 HOH HOH A . F 5 HOH 27 1327 27 HOH HOH A . F 5 HOH 28 1328 28 HOH HOH A . F 5 HOH 29 1329 29 HOH HOH A . F 5 HOH 30 1330 30 HOH HOH A . F 5 HOH 31 1331 31 HOH HOH A . F 5 HOH 32 1332 32 HOH HOH A . F 5 HOH 33 1333 33 HOH HOH A . F 5 HOH 34 1334 34 HOH HOH A . F 5 HOH 35 1335 35 HOH HOH A . F 5 HOH 36 1336 36 HOH HOH A . F 5 HOH 37 1337 37 HOH HOH A . F 5 HOH 38 1338 38 HOH HOH A . F 5 HOH 39 1339 39 HOH HOH A . F 5 HOH 40 1340 40 HOH HOH A . F 5 HOH 41 1341 41 HOH HOH A . F 5 HOH 42 1342 42 HOH HOH A . F 5 HOH 43 1343 43 HOH HOH A . F 5 HOH 44 1344 44 HOH HOH A . F 5 HOH 45 1345 45 HOH HOH A . F 5 HOH 46 1346 46 HOH HOH A . F 5 HOH 47 1347 47 HOH HOH A . F 5 HOH 48 1348 48 HOH HOH A . F 5 HOH 49 1349 49 HOH HOH A . F 5 HOH 50 1350 50 HOH HOH A . F 5 HOH 51 1351 51 HOH HOH A . F 5 HOH 52 1352 52 HOH HOH A . F 5 HOH 53 1353 53 HOH HOH A . F 5 HOH 54 1354 54 HOH HOH A . F 5 HOH 55 1355 55 HOH HOH A . F 5 HOH 56 1356 56 HOH HOH A . F 5 HOH 57 1357 57 HOH HOH A . F 5 HOH 58 1358 58 HOH HOH A . F 5 HOH 59 1359 59 HOH HOH A . F 5 HOH 60 1360 61 HOH HOH A . F 5 HOH 61 1361 62 HOH HOH A . F 5 HOH 62 1362 63 HOH HOH A . F 5 HOH 63 1363 64 HOH HOH A . F 5 HOH 64 1364 65 HOH HOH A . F 5 HOH 65 1365 66 HOH HOH A . F 5 HOH 66 1366 67 HOH HOH A . F 5 HOH 67 1367 68 HOH HOH A . F 5 HOH 68 1368 69 HOH HOH A . F 5 HOH 69 1369 70 HOH HOH A . F 5 HOH 70 1370 71 HOH HOH A . F 5 HOH 71 1371 73 HOH HOH A . F 5 HOH 72 1372 74 HOH HOH A . F 5 HOH 73 1373 75 HOH HOH A . F 5 HOH 74 1374 76 HOH HOH A . F 5 HOH 75 1375 77 HOH HOH A . F 5 HOH 76 1376 78 HOH HOH A . F 5 HOH 77 1377 79 HOH HOH A . F 5 HOH 78 1378 80 HOH HOH A . F 5 HOH 79 1379 81 HOH HOH A . F 5 HOH 80 1380 82 HOH HOH A . F 5 HOH 81 1381 83 HOH HOH A . F 5 HOH 82 1382 84 HOH HOH A . F 5 HOH 83 1383 85 HOH HOH A . F 5 HOH 84 1384 86 HOH HOH A . F 5 HOH 85 1385 87 HOH HOH A . F 5 HOH 86 1386 88 HOH HOH A . F 5 HOH 87 1387 89 HOH HOH A . F 5 HOH 88 1388 90 HOH HOH A . F 5 HOH 89 1389 91 HOH HOH A . F 5 HOH 90 1390 92 HOH HOH A . F 5 HOH 91 1391 93 HOH HOH A . F 5 HOH 92 1392 95 HOH HOH A . F 5 HOH 93 1393 96 HOH HOH A . F 5 HOH 94 1394 97 HOH HOH A . F 5 HOH 95 1395 98 HOH HOH A . F 5 HOH 96 1396 99 HOH HOH A . F 5 HOH 97 1397 100 HOH HOH A . F 5 HOH 98 1398 101 HOH HOH A . F 5 HOH 99 1399 102 HOH HOH A . F 5 HOH 100 1400 103 HOH HOH A . F 5 HOH 101 1401 104 HOH HOH A . F 5 HOH 102 1402 105 HOH HOH A . F 5 HOH 103 1403 106 HOH HOH A . F 5 HOH 104 1404 107 HOH HOH A . F 5 HOH 105 1405 108 HOH HOH A . F 5 HOH 106 1406 109 HOH HOH A . F 5 HOH 107 1407 110 HOH HOH A . F 5 HOH 108 1408 111 HOH HOH A . F 5 HOH 109 1409 112 HOH HOH A . F 5 HOH 110 1410 113 HOH HOH A . F 5 HOH 111 1411 114 HOH HOH A . F 5 HOH 112 1412 115 HOH HOH A . F 5 HOH 113 1413 116 HOH HOH A . F 5 HOH 114 1414 117 HOH HOH A . F 5 HOH 115 1415 118 HOH HOH A . F 5 HOH 116 1416 119 HOH HOH A . F 5 HOH 117 1417 120 HOH HOH A . F 5 HOH 118 1418 121 HOH HOH A . F 5 HOH 119 1419 122 HOH HOH A . F 5 HOH 120 1420 123 HOH HOH A . F 5 HOH 121 1421 124 HOH HOH A . F 5 HOH 122 1422 125 HOH HOH A . F 5 HOH 123 1423 126 HOH HOH A . F 5 HOH 124 1424 127 HOH HOH A . F 5 HOH 125 1425 128 HOH HOH A . F 5 HOH 126 1426 129 HOH HOH A . F 5 HOH 127 1427 130 HOH HOH A . F 5 HOH 128 1428 131 HOH HOH A . F 5 HOH 129 1429 132 HOH HOH A . F 5 HOH 130 1430 133 HOH HOH A . F 5 HOH 131 1431 134 HOH HOH A . F 5 HOH 132 1432 136 HOH HOH A . F 5 HOH 133 1433 137 HOH HOH A . F 5 HOH 134 1434 138 HOH HOH A . F 5 HOH 135 1435 139 HOH HOH A . F 5 HOH 136 1436 140 HOH HOH A . F 5 HOH 137 1437 141 HOH HOH A . F 5 HOH 138 1438 142 HOH HOH A . F 5 HOH 139 1439 143 HOH HOH A . F 5 HOH 140 1440 144 HOH HOH A . F 5 HOH 141 1441 145 HOH HOH A . F 5 HOH 142 1442 146 HOH HOH A . F 5 HOH 143 1443 147 HOH HOH A . F 5 HOH 144 1444 148 HOH HOH A . F 5 HOH 145 1445 149 HOH HOH A . F 5 HOH 146 1446 150 HOH HOH A . F 5 HOH 147 1447 151 HOH HOH A . F 5 HOH 148 1448 152 HOH HOH A . F 5 HOH 149 1449 153 HOH HOH A . F 5 HOH 150 1450 155 HOH HOH A . F 5 HOH 151 1451 156 HOH HOH A . F 5 HOH 152 1452 157 HOH HOH A . F 5 HOH 153 1453 158 HOH HOH A . F 5 HOH 154 1454 159 HOH HOH A . F 5 HOH 155 1455 160 HOH HOH A . F 5 HOH 156 1456 161 HOH HOH A . F 5 HOH 157 1457 162 HOH HOH A . F 5 HOH 158 1458 163 HOH HOH A . F 5 HOH 159 1459 164 HOH HOH A . F 5 HOH 160 1460 165 HOH HOH A . F 5 HOH 161 1461 166 HOH HOH A . F 5 HOH 162 1462 167 HOH HOH A . F 5 HOH 163 1463 168 HOH HOH A . F 5 HOH 164 1464 169 HOH HOH A . F 5 HOH 165 1465 170 HOH HOH A . F 5 HOH 166 1466 171 HOH HOH A . F 5 HOH 167 1467 172 HOH HOH A . F 5 HOH 168 1468 173 HOH HOH A . F 5 HOH 169 1469 174 HOH HOH A . F 5 HOH 170 1470 175 HOH HOH A . F 5 HOH 171 1471 176 HOH HOH A . F 5 HOH 172 1472 177 HOH HOH A . F 5 HOH 173 1473 178 HOH HOH A . F 5 HOH 174 1474 179 HOH HOH A . F 5 HOH 175 1475 180 HOH HOH A . F 5 HOH 176 1476 181 HOH HOH A . F 5 HOH 177 1477 182 HOH HOH A . F 5 HOH 178 1478 183 HOH HOH A . F 5 HOH 179 1479 184 HOH HOH A . F 5 HOH 180 1480 185 HOH HOH A . F 5 HOH 181 1481 186 HOH HOH A . F 5 HOH 182 1482 187 HOH HOH A . F 5 HOH 183 1483 188 HOH HOH A . F 5 HOH 184 1484 189 HOH HOH A . F 5 HOH 185 1485 190 HOH HOH A . F 5 HOH 186 1486 191 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-01-29 2 'Structure model' 1 1 2018-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation_author.name' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 1.425 _diffrn_reflns.pdbx_d_res_low 19.692 _diffrn_reflns.pdbx_number_obs 26470 _diffrn_reflns.pdbx_Rmerge_I_obs ? _diffrn_reflns.pdbx_Rsym_value 0.097 _diffrn_reflns.pdbx_chi_squared ? _diffrn_reflns.av_sigmaI_over_netI 5.80 _diffrn_reflns.pdbx_redundancy 11.70 _diffrn_reflns.pdbx_percent_possible_obs 98.40 _diffrn_reflns.number 309695 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 4.51 19.69 ? ? 0.059 0.059 ? 13.40 98.90 1 3.19 4.51 ? ? 0.047 0.047 ? 13.80 100.00 1 2.60 3.19 ? ? 0.064 0.064 ? 14.20 99.90 1 2.25 2.60 ? ? 0.084 0.084 ? 15.10 99.70 1 2.02 2.25 ? ? 0.116 0.116 ? 14.00 99.30 1 1.84 2.02 ? ? 0.195 0.195 ? 14.60 99.40 1 1.70 1.84 ? ? 0.305 0.305 ? 13.90 98.40 1 1.59 1.70 ? ? 0.434 0.434 ? 9.50 98.90 1 1.50 1.59 ? ? 0.640 0.640 ? 6.90 95.50 1 1.42 1.50 ? ? 0.866 0.866 ? 7.40 97.20 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 30.2455 _pdbx_refine_tls.origin_y 28.1319 _pdbx_refine_tls.origin_z 7.2542 _pdbx_refine_tls.T[1][1] 0.0379 _pdbx_refine_tls.T[2][2] 0.0252 _pdbx_refine_tls.T[3][3] 0.0242 _pdbx_refine_tls.T[1][2] 0.0052 _pdbx_refine_tls.T[1][3] -0.0065 _pdbx_refine_tls.T[2][3] 0.0053 _pdbx_refine_tls.L[1][1] 0.3073 _pdbx_refine_tls.L[2][2] 0.2139 _pdbx_refine_tls.L[3][3] 0.8712 _pdbx_refine_tls.L[1][2] -0.0031 _pdbx_refine_tls.L[1][3] 0.4112 _pdbx_refine_tls.L[2][3] -0.2470 _pdbx_refine_tls.S[1][1] 0.0290 _pdbx_refine_tls.S[2][2] 0.0112 _pdbx_refine_tls.S[3][3] -0.0402 _pdbx_refine_tls.S[1][2] -0.0142 _pdbx_refine_tls.S[1][3] -0.0200 _pdbx_refine_tls.S[2][3] 0.0166 _pdbx_refine_tls.S[2][1] 0.0030 _pdbx_refine_tls.S[3][1] 0.0442 _pdbx_refine_tls.S[3][2] -0.0357 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1082 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 1197 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _pdbx_phasing_MR.entry_id 4NYW _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor 59.670 _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.500 _pdbx_phasing_MR.d_res_low_rotation 19.540 _pdbx_phasing_MR.d_res_high_translation 3.500 _pdbx_phasing_MR.d_res_low_translation 19.540 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALA 3.3.16 2010/01/06 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 2 PHASER 2.1.4 'Wed Jun 24 14:00:05 2009' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 DNA . ? ? ? ? 'data collection' ? ? ? 6 XDS . ? ? ? ? 'data reduction' ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 1363 ? ? O A HOH 1471 ? ? 2.03 2 1 O A HOH 1372 ? ? O A HOH 1468 ? ? 2.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 1082 ? CG ? A LYS 4 CG 2 1 Y 1 A LYS 1082 ? CD ? A LYS 4 CD 3 1 Y 1 A LYS 1082 ? CE ? A LYS 4 CE 4 1 Y 1 A LYS 1082 ? NZ ? A LYS 4 NZ 5 1 Y 1 A LYS 1170 ? CD ? A LYS 92 CD 6 1 Y 1 A LYS 1170 ? CE ? A LYS 92 CE 7 1 Y 1 A LYS 1170 ? NZ ? A LYS 92 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1079 ? A SER 1 2 1 Y 1 A MET 1080 ? A MET 2 3 1 Y 1 A ARG 1081 ? A ARG 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'THIOCYANATE ION' SCN 3 '(3R)-N-[3-(3,4-dihydroquinolin-1(2H)-yl)propyl]-3-methyl-2-oxo-1,2,3,4-tetrahydroquinoxaline-5-carboxamide' 2O3 4 1,2-ETHANEDIOL EDO 5 water HOH #