data_4OIL # _entry.id 4OIL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4OIL RCSB RCSB084538 WWPDB D_1000084538 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4OEA . unspecified PDB 4OED . unspecified PDB 4OEY . unspecified PDB 4OEZ . unspecified PDB 4OFR . unspecified PDB 4OFU . unspecified PDB 4OGH . unspecified PDB 4OH5 . unspecified PDB 4OH6 . unspecified PDB 4OHA . unspecified PDB 4OIU . unspecified PDB 4OJ9 . unspecified PDB 4OJB . unspecified PDB 4OK1 . unspecified PDB 4OKB . unspecified PDB 4OKT . unspecified PDB 4OKW . unspecified PDB 4OKX . unspecified PDB 4OLM . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4OIL _pdbx_database_status.recvd_initial_deposition_date 2014-01-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, J.S.' 1 'Hsu, C.L.' 2 'Wu, W.G.' 3 # _citation.id primary _citation.title ;Identification of a new androgen receptor (AR) co-regulator BUD31 and related peptides to suppress wild-type and mutated AR-mediated prostate cancer growth via peptide screening and X-ray structure analysis. ; _citation.journal_abbrev 'Mol Oncol' _citation.journal_volume 8 _citation.page_first 1575 _citation.page_last 1587 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25091737 _citation.pdbx_database_id_DOI 10.1016/j.molonc.2014.06.009 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hsu, C.L.' 1 primary 'Liu, J.S.' 2 primary 'Wu, P.L.' 3 primary 'Guan, H.H.' 4 primary 'Chen, Y.L.' 5 primary 'Lin, A.C.' 6 primary 'Ting, H.J.' 7 primary 'Pang, S.T.' 8 primary 'Yeh, S.D.' 9 primary 'Ma, W.L.' 10 primary 'Chen, C.J.' 11 primary 'Wu, W.G.' 12 primary 'Chang, C.' 13 # _cell.entry_id 4OIL _cell.length_a 54.417 _cell.length_b 65.593 _cell.length_c 70.283 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4OIL _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Androgen receptor' 29058.059 1 ? 'R760A, T877A' 'ligand binding doamin' ? 2 polymer syn 'co-regulator peptide' 1484.570 1 ? ? ? ? 3 non-polymer syn HYDROXYFLUTAMIDE 292.211 1 ? ? ? ? 4 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dihydrotestosterone receptor, Nuclear receptor subfamily 3 group C member 4' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAM GWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDE LRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFAFDLLIKSHMVSVDFPEMMAEIISVQVPKILSG KVKPIYFHTQ ; ;QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAM GWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDE LRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFAFDLLIKSHMVSVDFPEMMAEIISVQVPKILSG KVKPIYFHTQ ; A ? 2 'polypeptide(L)' no no NTTDTLFSQHYR NTTDTLFSQHYR B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 PRO n 1 3 ILE n 1 4 PHE n 1 5 LEU n 1 6 ASN n 1 7 VAL n 1 8 LEU n 1 9 GLU n 1 10 ALA n 1 11 ILE n 1 12 GLU n 1 13 PRO n 1 14 GLY n 1 15 VAL n 1 16 VAL n 1 17 CYS n 1 18 ALA n 1 19 GLY n 1 20 HIS n 1 21 ASP n 1 22 ASN n 1 23 ASN n 1 24 GLN n 1 25 PRO n 1 26 ASP n 1 27 SER n 1 28 PHE n 1 29 ALA n 1 30 ALA n 1 31 LEU n 1 32 LEU n 1 33 SER n 1 34 SER n 1 35 LEU n 1 36 ASN n 1 37 GLU n 1 38 LEU n 1 39 GLY n 1 40 GLU n 1 41 ARG n 1 42 GLN n 1 43 LEU n 1 44 VAL n 1 45 HIS n 1 46 VAL n 1 47 VAL n 1 48 LYS n 1 49 TRP n 1 50 ALA n 1 51 LYS n 1 52 ALA n 1 53 LEU n 1 54 PRO n 1 55 GLY n 1 56 PHE n 1 57 ARG n 1 58 ASN n 1 59 LEU n 1 60 HIS n 1 61 VAL n 1 62 ASP n 1 63 ASP n 1 64 GLN n 1 65 MET n 1 66 ALA n 1 67 VAL n 1 68 ILE n 1 69 GLN n 1 70 TYR n 1 71 SER n 1 72 TRP n 1 73 MET n 1 74 GLY n 1 75 LEU n 1 76 MET n 1 77 VAL n 1 78 PHE n 1 79 ALA n 1 80 MET n 1 81 GLY n 1 82 TRP n 1 83 ARG n 1 84 SER n 1 85 PHE n 1 86 THR n 1 87 ASN n 1 88 VAL n 1 89 ASN n 1 90 SER n 1 91 ALA n 1 92 MET n 1 93 LEU n 1 94 TYR n 1 95 PHE n 1 96 ALA n 1 97 PRO n 1 98 ASP n 1 99 LEU n 1 100 VAL n 1 101 PHE n 1 102 ASN n 1 103 GLU n 1 104 TYR n 1 105 ARG n 1 106 MET n 1 107 HIS n 1 108 LYS n 1 109 SER n 1 110 ARG n 1 111 MET n 1 112 TYR n 1 113 SER n 1 114 GLN n 1 115 CYS n 1 116 VAL n 1 117 ARG n 1 118 MET n 1 119 ARG n 1 120 HIS n 1 121 LEU n 1 122 SER n 1 123 GLN n 1 124 GLU n 1 125 PHE n 1 126 GLY n 1 127 TRP n 1 128 LEU n 1 129 GLN n 1 130 ILE n 1 131 THR n 1 132 PRO n 1 133 GLN n 1 134 GLU n 1 135 PHE n 1 136 LEU n 1 137 CYS n 1 138 MET n 1 139 LYS n 1 140 ALA n 1 141 LEU n 1 142 LEU n 1 143 LEU n 1 144 PHE n 1 145 SER n 1 146 ILE n 1 147 ILE n 1 148 PRO n 1 149 VAL n 1 150 ASP n 1 151 GLY n 1 152 LEU n 1 153 LYS n 1 154 ASN n 1 155 GLN n 1 156 LYS n 1 157 PHE n 1 158 PHE n 1 159 ASP n 1 160 GLU n 1 161 LEU n 1 162 ARG n 1 163 MET n 1 164 ASN n 1 165 TYR n 1 166 ILE n 1 167 LYS n 1 168 GLU n 1 169 LEU n 1 170 ASP n 1 171 ARG n 1 172 ILE n 1 173 ILE n 1 174 ALA n 1 175 CYS n 1 176 LYS n 1 177 ARG n 1 178 LYS n 1 179 ASN n 1 180 PRO n 1 181 THR n 1 182 SER n 1 183 CYS n 1 184 SER n 1 185 ARG n 1 186 ARG n 1 187 PHE n 1 188 TYR n 1 189 GLN n 1 190 LEU n 1 191 THR n 1 192 LYS n 1 193 LEU n 1 194 LEU n 1 195 ASP n 1 196 SER n 1 197 VAL n 1 198 GLN n 1 199 PRO n 1 200 ILE n 1 201 ALA n 1 202 ARG n 1 203 GLU n 1 204 LEU n 1 205 HIS n 1 206 GLN n 1 207 PHE n 1 208 ALA n 1 209 PHE n 1 210 ASP n 1 211 LEU n 1 212 LEU n 1 213 ILE n 1 214 LYS n 1 215 SER n 1 216 HIS n 1 217 MET n 1 218 VAL n 1 219 SER n 1 220 VAL n 1 221 ASP n 1 222 PHE n 1 223 PRO n 1 224 GLU n 1 225 MET n 1 226 MET n 1 227 ALA n 1 228 GLU n 1 229 ILE n 1 230 ILE n 1 231 SER n 1 232 VAL n 1 233 GLN n 1 234 VAL n 1 235 PRO n 1 236 LYS n 1 237 ILE n 1 238 LEU n 1 239 SER n 1 240 GLY n 1 241 LYS n 1 242 VAL n 1 243 LYS n 1 244 PRO n 1 245 ILE n 1 246 TYR n 1 247 PHE n 1 248 HIS n 1 249 THR n 1 250 GLN n 2 1 ASN n 2 2 THR n 2 3 THR n 2 4 ASP n 2 5 THR n 2 6 LEU n 2 7 PHE n 2 8 SER n 2 9 GLN n 2 10 HIS n 2 11 TYR n 2 12 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AR, DHTR, NR3C4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP ANDR_HUMAN P10275 1 ;QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAM GWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDE LRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSG KVKPIYFHTQ ; 670 ? 2 PDB 4OIL 4OIL 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4OIL A 1 ? 250 ? P10275 670 ? 919 ? 670 919 2 2 4OIL B 1 ? 12 ? 4OIL -3 ? 8 ? -3 8 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4OIL ALA A 91 ? UNP P10275 ARG 760 'ENGINEERED MUTATION' 760 1 1 4OIL ALA A 208 ? UNP P10275 THR 877 'ENGINEERED MUTATION' 877 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HFT non-polymer . HYDROXYFLUTAMIDE '2-HYDROXY-2-METHYL-N-(4-NITRO-3-(TRIFLUOROMETHYL)PHENYL)PROPANAMIDE; HYDROXYNIPHTHOLIDE' 'C11 H11 F3 N2 O4' 292.211 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4OIL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 41.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.6M magnesium sulphate, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' # _diffrn.id 1 _diffrn.ambient_temp 150 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 1.0 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.pdbx_synchrotron_site NSRRC _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4OIL _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 23.99 _reflns.d_resolution_high 2.5 _reflns.number_obs 9050 _reflns.number_all 9115 _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4OIL _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8582 _refine.ls_number_reflns_all 9081 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 23.99 _refine.ls_d_res_high 2.51 _refine.ls_percent_reflns_obs 99.23 _refine.ls_R_factor_obs 0.19710 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19257 _refine.ls_R_factor_R_free 0.28485 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 432 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.904 _refine.B_iso_mean 55.956 _refine.aniso_B[1][1] 9.88 _refine.aniso_B[2][2] -4.16 _refine.aniso_B[3][3] -5.71 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 4OGH' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 1.305 _refine.pdbx_overall_ESU_R_Free 0.357 _refine.overall_SU_ML 0.306 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 13.866 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2035 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 2072 _refine_hist.d_res_high 2.51 _refine_hist.d_res_low 23.99 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.019 ? 2106 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 2029 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.799 1.959 ? 2848 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.839 3.000 ? 4648 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.865 5.000 ? 246 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 31.839 23.636 ? 99 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.852 15.000 ? 371 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 19.359 15.000 ? 12 'X-RAY DIFFRACTION' ? r_chiral_restr 0.167 0.200 ? 310 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.021 ? 2339 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 521 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.505 _refine_ls_shell.d_res_low 2.570 _refine_ls_shell.number_reflns_R_work 615 _refine_ls_shell.R_factor_R_work 0.240 _refine_ls_shell.percent_reflns_obs 99.22 _refine_ls_shell.R_factor_R_free 0.233 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 22 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 4OIL _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # _struct.entry_id 4OIL _struct.title 'Crystal structure of T877A-AR-LBD bound with co-regulator peptide' _struct.pdbx_descriptor 'Androgen receptor, co-regulator peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4OIL _struct_keywords.pdbx_keywords 'HORMONE RECEPTOR/PEPTIDE' _struct_keywords.text 'Alpha-helix, Hormone/growth Factor Receptor, Phosphorylation, HORMONE RECEPTOR-PEPTIDE complex, signal transduction' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_biol.id _struct_biol.details 2 ? 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 2 ? GLU A 12 ? PRO A 671 GLU A 681 1 ? 11 HELX_P HELX_P2 2 SER A 27 ? ALA A 52 ? SER A 696 ALA A 721 1 ? 26 HELX_P HELX_P3 3 GLY A 55 ? LEU A 59 ? GLY A 724 LEU A 728 5 ? 5 HELX_P HELX_P4 4 HIS A 60 ? ASN A 89 ? HIS A 729 ASN A 758 1 ? 30 HELX_P HELX_P5 5 ASN A 102 ? SER A 109 ? ASN A 771 SER A 778 1 ? 8 HELX_P HELX_P6 6 MET A 111 ? LEU A 128 ? MET A 780 LEU A 797 1 ? 18 HELX_P HELX_P7 7 THR A 131 ? LEU A 143 ? THR A 800 LEU A 812 1 ? 13 HELX_P HELX_P8 8 ASN A 154 ? ALA A 174 ? ASN A 823 ALA A 843 1 ? 21 HELX_P HELX_P9 9 CYS A 183 ? SER A 196 ? CYS A 852 SER A 865 1 ? 14 HELX_P HELX_P10 10 SER A 196 ? SER A 215 ? SER A 865 SER A 884 1 ? 20 HELX_P HELX_P11 11 HIS A 216 ? VAL A 218 ? HIS A 885 VAL A 887 5 ? 3 HELX_P HELX_P12 12 PRO A 223 ? GLN A 233 ? PRO A 892 GLN A 902 1 ? 11 HELX_P HELX_P13 13 GLN A 233 ? SER A 239 ? GLN A 902 SER A 908 1 ? 7 HELX_P HELX_P14 14 PHE B 7 ? TYR B 11 ? PHE B 3 TYR B 7 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 93 ? ALA A 96 ? LEU A 762 ALA A 765 A 2 LEU A 99 ? PHE A 101 ? LEU A 768 PHE A 770 B 1 ILE A 146 ? PRO A 148 ? ILE A 815 PRO A 817 B 2 VAL A 242 ? PRO A 244 ? VAL A 911 PRO A 913 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 93 ? N LEU A 762 O PHE A 101 ? O PHE A 770 B 1 2 N ILE A 147 ? N ILE A 816 O LYS A 243 ? O LYS A 912 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE HFT A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 LEU A 35 ? LEU A 704 . ? 1_555 ? 2 AC1 11 ASN A 36 ? ASN A 705 . ? 1_555 ? 3 AC1 11 LEU A 38 ? LEU A 707 . ? 1_555 ? 4 AC1 11 GLN A 42 ? GLN A 711 . ? 1_555 ? 5 AC1 11 MET A 76 ? MET A 745 . ? 1_555 ? 6 AC1 11 VAL A 77 ? VAL A 746 . ? 1_555 ? 7 AC1 11 MET A 80 ? MET A 749 . ? 1_555 ? 8 AC1 11 ARG A 83 ? ARG A 752 . ? 1_555 ? 9 AC1 11 PHE A 95 ? PHE A 764 . ? 1_555 ? 10 AC1 11 LEU A 204 ? LEU A 873 . ? 1_555 ? 11 AC1 11 MET A 226 ? MET A 895 . ? 1_555 ? # _database_PDB_matrix.entry_id 4OIL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4OIL _atom_sites.fract_transf_matrix[1][1] 0.018377 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015246 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014228 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 670 670 GLN GLN A . n A 1 2 PRO 2 671 671 PRO PRO A . n A 1 3 ILE 3 672 672 ILE ILE A . n A 1 4 PHE 4 673 673 PHE PHE A . n A 1 5 LEU 5 674 674 LEU LEU A . n A 1 6 ASN 6 675 675 ASN ASN A . n A 1 7 VAL 7 676 676 VAL VAL A . n A 1 8 LEU 8 677 677 LEU LEU A . n A 1 9 GLU 9 678 678 GLU GLU A . n A 1 10 ALA 10 679 679 ALA ALA A . n A 1 11 ILE 11 680 680 ILE ILE A . n A 1 12 GLU 12 681 681 GLU GLU A . n A 1 13 PRO 13 682 682 PRO PRO A . n A 1 14 GLY 14 683 683 GLY GLY A . n A 1 15 VAL 15 684 684 VAL VAL A . n A 1 16 VAL 16 685 685 VAL VAL A . n A 1 17 CYS 17 686 686 CYS CYS A . n A 1 18 ALA 18 687 687 ALA ALA A . n A 1 19 GLY 19 688 688 GLY GLY A . n A 1 20 HIS 20 689 689 HIS HIS A . n A 1 21 ASP 21 690 690 ASP ASP A . n A 1 22 ASN 22 691 691 ASN ASN A . n A 1 23 ASN 23 692 692 ASN ASN A . n A 1 24 GLN 24 693 693 GLN GLN A . n A 1 25 PRO 25 694 694 PRO PRO A . n A 1 26 ASP 26 695 695 ASP ASP A . n A 1 27 SER 27 696 696 SER SER A . n A 1 28 PHE 28 697 697 PHE PHE A . n A 1 29 ALA 29 698 698 ALA ALA A . n A 1 30 ALA 30 699 699 ALA ALA A . n A 1 31 LEU 31 700 700 LEU LEU A . n A 1 32 LEU 32 701 701 LEU LEU A . n A 1 33 SER 33 702 702 SER SER A . n A 1 34 SER 34 703 703 SER SER A . n A 1 35 LEU 35 704 704 LEU LEU A . n A 1 36 ASN 36 705 705 ASN ASN A . n A 1 37 GLU 37 706 706 GLU GLU A . n A 1 38 LEU 38 707 707 LEU LEU A . n A 1 39 GLY 39 708 708 GLY GLY A . n A 1 40 GLU 40 709 709 GLU GLU A . n A 1 41 ARG 41 710 710 ARG ARG A . n A 1 42 GLN 42 711 711 GLN GLN A . n A 1 43 LEU 43 712 712 LEU LEU A . n A 1 44 VAL 44 713 713 VAL VAL A . n A 1 45 HIS 45 714 714 HIS HIS A . n A 1 46 VAL 46 715 715 VAL VAL A . n A 1 47 VAL 47 716 716 VAL VAL A . n A 1 48 LYS 48 717 717 LYS LYS A . n A 1 49 TRP 49 718 718 TRP TRP A . n A 1 50 ALA 50 719 719 ALA ALA A . n A 1 51 LYS 51 720 720 LYS LYS A . n A 1 52 ALA 52 721 721 ALA ALA A . n A 1 53 LEU 53 722 722 LEU LEU A . n A 1 54 PRO 54 723 723 PRO PRO A . n A 1 55 GLY 55 724 724 GLY GLY A . n A 1 56 PHE 56 725 725 PHE PHE A . n A 1 57 ARG 57 726 726 ARG ARG A . n A 1 58 ASN 58 727 727 ASN ASN A . n A 1 59 LEU 59 728 728 LEU LEU A . n A 1 60 HIS 60 729 729 HIS HIS A . n A 1 61 VAL 61 730 730 VAL VAL A . n A 1 62 ASP 62 731 731 ASP ASP A . n A 1 63 ASP 63 732 732 ASP ASP A . n A 1 64 GLN 64 733 733 GLN GLN A . n A 1 65 MET 65 734 734 MET MET A . n A 1 66 ALA 66 735 735 ALA ALA A . n A 1 67 VAL 67 736 736 VAL VAL A . n A 1 68 ILE 68 737 737 ILE ILE A . n A 1 69 GLN 69 738 738 GLN GLN A . n A 1 70 TYR 70 739 739 TYR TYR A . n A 1 71 SER 71 740 740 SER SER A . n A 1 72 TRP 72 741 741 TRP TRP A . n A 1 73 MET 73 742 742 MET MET A . n A 1 74 GLY 74 743 743 GLY GLY A . n A 1 75 LEU 75 744 744 LEU LEU A . n A 1 76 MET 76 745 745 MET MET A . n A 1 77 VAL 77 746 746 VAL VAL A . n A 1 78 PHE 78 747 747 PHE PHE A . n A 1 79 ALA 79 748 748 ALA ALA A . n A 1 80 MET 80 749 749 MET MET A . n A 1 81 GLY 81 750 750 GLY GLY A . n A 1 82 TRP 82 751 751 TRP TRP A . n A 1 83 ARG 83 752 752 ARG ARG A . n A 1 84 SER 84 753 753 SER SER A . n A 1 85 PHE 85 754 754 PHE PHE A . n A 1 86 THR 86 755 755 THR THR A . n A 1 87 ASN 87 756 756 ASN ASN A . n A 1 88 VAL 88 757 757 VAL VAL A . n A 1 89 ASN 89 758 758 ASN ASN A . n A 1 90 SER 90 759 759 SER SER A . n A 1 91 ALA 91 760 760 ALA ALA A . n A 1 92 MET 92 761 761 MET MET A . n A 1 93 LEU 93 762 762 LEU LEU A . n A 1 94 TYR 94 763 763 TYR TYR A . n A 1 95 PHE 95 764 764 PHE PHE A . n A 1 96 ALA 96 765 765 ALA ALA A . n A 1 97 PRO 97 766 766 PRO PRO A . n A 1 98 ASP 98 767 767 ASP ASP A . n A 1 99 LEU 99 768 768 LEU LEU A . n A 1 100 VAL 100 769 769 VAL VAL A . n A 1 101 PHE 101 770 770 PHE PHE A . n A 1 102 ASN 102 771 771 ASN ASN A . n A 1 103 GLU 103 772 772 GLU GLU A . n A 1 104 TYR 104 773 773 TYR TYR A . n A 1 105 ARG 105 774 774 ARG ARG A . n A 1 106 MET 106 775 775 MET MET A . n A 1 107 HIS 107 776 776 HIS HIS A . n A 1 108 LYS 108 777 777 LYS LYS A . n A 1 109 SER 109 778 778 SER SER A . n A 1 110 ARG 110 779 779 ARG ARG A . n A 1 111 MET 111 780 780 MET MET A . n A 1 112 TYR 112 781 781 TYR TYR A . n A 1 113 SER 113 782 782 SER SER A . n A 1 114 GLN 114 783 783 GLN GLN A . n A 1 115 CYS 115 784 784 CYS CYS A . n A 1 116 VAL 116 785 785 VAL VAL A . n A 1 117 ARG 117 786 786 ARG ARG A . n A 1 118 MET 118 787 787 MET MET A . n A 1 119 ARG 119 788 788 ARG ARG A . n A 1 120 HIS 120 789 789 HIS HIS A . n A 1 121 LEU 121 790 790 LEU LEU A . n A 1 122 SER 122 791 791 SER SER A . n A 1 123 GLN 123 792 792 GLN GLN A . n A 1 124 GLU 124 793 793 GLU GLU A . n A 1 125 PHE 125 794 794 PHE PHE A . n A 1 126 GLY 126 795 795 GLY GLY A . n A 1 127 TRP 127 796 796 TRP TRP A . n A 1 128 LEU 128 797 797 LEU LEU A . n A 1 129 GLN 129 798 798 GLN GLN A . n A 1 130 ILE 130 799 799 ILE ILE A . n A 1 131 THR 131 800 800 THR THR A . n A 1 132 PRO 132 801 801 PRO PRO A . n A 1 133 GLN 133 802 802 GLN GLN A . n A 1 134 GLU 134 803 803 GLU GLU A . n A 1 135 PHE 135 804 804 PHE PHE A . n A 1 136 LEU 136 805 805 LEU LEU A . n A 1 137 CYS 137 806 806 CYS CYS A . n A 1 138 MET 138 807 807 MET MET A . n A 1 139 LYS 139 808 808 LYS LYS A . n A 1 140 ALA 140 809 809 ALA ALA A . n A 1 141 LEU 141 810 810 LEU LEU A . n A 1 142 LEU 142 811 811 LEU LEU A . n A 1 143 LEU 143 812 812 LEU LEU A . n A 1 144 PHE 144 813 813 PHE PHE A . n A 1 145 SER 145 814 814 SER SER A . n A 1 146 ILE 146 815 815 ILE ILE A . n A 1 147 ILE 147 816 816 ILE ILE A . n A 1 148 PRO 148 817 817 PRO PRO A . n A 1 149 VAL 149 818 818 VAL VAL A . n A 1 150 ASP 150 819 819 ASP ASP A . n A 1 151 GLY 151 820 820 GLY GLY A . n A 1 152 LEU 152 821 821 LEU LEU A . n A 1 153 LYS 153 822 822 LYS LYS A . n A 1 154 ASN 154 823 823 ASN ASN A . n A 1 155 GLN 155 824 824 GLN GLN A . n A 1 156 LYS 156 825 825 LYS LYS A . n A 1 157 PHE 157 826 826 PHE PHE A . n A 1 158 PHE 158 827 827 PHE PHE A . n A 1 159 ASP 159 828 828 ASP ASP A . n A 1 160 GLU 160 829 829 GLU GLU A . n A 1 161 LEU 161 830 830 LEU LEU A . n A 1 162 ARG 162 831 831 ARG ARG A . n A 1 163 MET 163 832 832 MET MET A . n A 1 164 ASN 164 833 833 ASN ASN A . n A 1 165 TYR 165 834 834 TYR TYR A . n A 1 166 ILE 166 835 835 ILE ILE A . n A 1 167 LYS 167 836 836 LYS LYS A . n A 1 168 GLU 168 837 837 GLU GLU A . n A 1 169 LEU 169 838 838 LEU LEU A . n A 1 170 ASP 170 839 839 ASP ASP A . n A 1 171 ARG 171 840 840 ARG ARG A . n A 1 172 ILE 172 841 841 ILE ILE A . n A 1 173 ILE 173 842 842 ILE ILE A . n A 1 174 ALA 174 843 843 ALA ALA A . n A 1 175 CYS 175 844 ? ? ? A . n A 1 176 LYS 176 845 ? ? ? A . n A 1 177 ARG 177 846 ? ? ? A . n A 1 178 LYS 178 847 ? ? ? A . n A 1 179 ASN 179 848 ? ? ? A . n A 1 180 PRO 180 849 ? ? ? A . n A 1 181 THR 181 850 ? ? ? A . n A 1 182 SER 182 851 851 SER SER A . n A 1 183 CYS 183 852 852 CYS CYS A . n A 1 184 SER 184 853 853 SER SER A . n A 1 185 ARG 185 854 854 ARG ARG A . n A 1 186 ARG 186 855 855 ARG ARG A . n A 1 187 PHE 187 856 856 PHE PHE A . n A 1 188 TYR 188 857 857 TYR TYR A . n A 1 189 GLN 189 858 858 GLN GLN A . n A 1 190 LEU 190 859 859 LEU LEU A . n A 1 191 THR 191 860 860 THR THR A . n A 1 192 LYS 192 861 861 LYS LYS A . n A 1 193 LEU 193 862 862 LEU LEU A . n A 1 194 LEU 194 863 863 LEU LEU A . n A 1 195 ASP 195 864 864 ASP ASP A . n A 1 196 SER 196 865 865 SER SER A . n A 1 197 VAL 197 866 866 VAL VAL A . n A 1 198 GLN 198 867 867 GLN GLN A . n A 1 199 PRO 199 868 868 PRO PRO A . n A 1 200 ILE 200 869 869 ILE ILE A . n A 1 201 ALA 201 870 870 ALA ALA A . n A 1 202 ARG 202 871 871 ARG ARG A . n A 1 203 GLU 203 872 872 GLU GLU A . n A 1 204 LEU 204 873 873 LEU LEU A . n A 1 205 HIS 205 874 874 HIS HIS A . n A 1 206 GLN 206 875 875 GLN GLN A . n A 1 207 PHE 207 876 876 PHE PHE A . n A 1 208 ALA 208 877 877 ALA ALA A . n A 1 209 PHE 209 878 878 PHE PHE A . n A 1 210 ASP 210 879 879 ASP ASP A . n A 1 211 LEU 211 880 880 LEU LEU A . n A 1 212 LEU 212 881 881 LEU LEU A . n A 1 213 ILE 213 882 882 ILE ILE A . n A 1 214 LYS 214 883 883 LYS LYS A . n A 1 215 SER 215 884 884 SER SER A . n A 1 216 HIS 216 885 885 HIS HIS A . n A 1 217 MET 217 886 886 MET MET A . n A 1 218 VAL 218 887 887 VAL VAL A . n A 1 219 SER 219 888 888 SER SER A . n A 1 220 VAL 220 889 889 VAL VAL A . n A 1 221 ASP 221 890 890 ASP ASP A . n A 1 222 PHE 222 891 891 PHE PHE A . n A 1 223 PRO 223 892 892 PRO PRO A . n A 1 224 GLU 224 893 893 GLU GLU A . n A 1 225 MET 225 894 894 MET MET A . n A 1 226 MET 226 895 895 MET MET A . n A 1 227 ALA 227 896 896 ALA ALA A . n A 1 228 GLU 228 897 897 GLU GLU A . n A 1 229 ILE 229 898 898 ILE ILE A . n A 1 230 ILE 230 899 899 ILE ILE A . n A 1 231 SER 231 900 900 SER SER A . n A 1 232 VAL 232 901 901 VAL VAL A . n A 1 233 GLN 233 902 902 GLN GLN A . n A 1 234 VAL 234 903 903 VAL VAL A . n A 1 235 PRO 235 904 904 PRO PRO A . n A 1 236 LYS 236 905 905 LYS LYS A . n A 1 237 ILE 237 906 906 ILE ILE A . n A 1 238 LEU 238 907 907 LEU LEU A . n A 1 239 SER 239 908 908 SER SER A . n A 1 240 GLY 240 909 909 GLY GLY A . n A 1 241 LYS 241 910 910 LYS LYS A . n A 1 242 VAL 242 911 911 VAL VAL A . n A 1 243 LYS 243 912 912 LYS LYS A . n A 1 244 PRO 244 913 913 PRO PRO A . n A 1 245 ILE 245 914 914 ILE ILE A . n A 1 246 TYR 246 915 915 TYR TYR A . n A 1 247 PHE 247 916 916 PHE PHE A . n A 1 248 HIS 248 917 917 HIS HIS A . n A 1 249 THR 249 918 918 THR THR A . n A 1 250 GLN 250 919 ? ? ? A . n B 2 1 ASN 1 -3 ? ? ? B . n B 2 2 THR 2 -2 ? ? ? B . n B 2 3 THR 3 -1 ? ? ? B . n B 2 4 ASP 4 0 ? ? ? B . n B 2 5 THR 5 1 1 THR THR B . n B 2 6 LEU 6 2 2 LEU LEU B . n B 2 7 PHE 7 3 3 PHE PHE B . n B 2 8 SER 8 4 4 SER SER B . n B 2 9 GLN 9 5 5 GLN GLN B . n B 2 10 HIS 10 6 6 HIS HIS B . n B 2 11 TYR 11 7 7 TYR TYR B . n B 2 12 ARG 12 8 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1380 ? 1 MORE -7 ? 1 'SSA (A^2)' 11530 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-08-20 2 'Structure model' 1 1 2014-12-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 AMoRE phasing . ? 2 REFMAC refinement 5.7.0029 ? 3 HKL-2000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 757 ? ? -143.92 30.43 2 1 ASN A 758 ? ? 49.35 28.71 3 1 LEU A 768 ? ? -161.81 74.76 4 1 CYS A 852 ? ? 88.79 -47.41 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A CYS 844 ? A CYS 175 2 1 Y 1 A LYS 845 ? A LYS 176 3 1 Y 1 A ARG 846 ? A ARG 177 4 1 Y 1 A LYS 847 ? A LYS 178 5 1 Y 1 A ASN 848 ? A ASN 179 6 1 Y 1 A PRO 849 ? A PRO 180 7 1 Y 1 A THR 850 ? A THR 181 8 1 Y 1 A GLN 919 ? A GLN 250 9 1 Y 1 B ASN -3 ? B ASN 1 10 1 Y 1 B THR -2 ? B THR 2 11 1 Y 1 B THR -1 ? B THR 3 12 1 Y 1 B ASP 0 ? B ASP 4 13 1 Y 1 B ARG 8 ? B ARG 12 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 HYDROXYFLUTAMIDE HFT 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HFT 1 1001 1001 HFT HFT A . D 4 HOH 1 1101 1101 HOH HOH A . D 4 HOH 2 1102 1102 HOH HOH A . D 4 HOH 3 1103 1103 HOH HOH A . D 4 HOH 4 1104 1104 HOH HOH A . D 4 HOH 5 1105 1105 HOH HOH A . D 4 HOH 6 1106 1106 HOH HOH A . D 4 HOH 7 1107 1107 HOH HOH A . D 4 HOH 8 1108 1108 HOH HOH A . D 4 HOH 9 1109 1109 HOH HOH A . D 4 HOH 10 1110 1110 HOH HOH A . D 4 HOH 11 1111 1111 HOH HOH A . D 4 HOH 12 1112 1112 HOH HOH A . D 4 HOH 13 1113 1113 HOH HOH A . D 4 HOH 14 1114 1114 HOH HOH A . D 4 HOH 15 1115 1115 HOH HOH A . D 4 HOH 16 1116 1116 HOH HOH A . D 4 HOH 17 1117 1117 HOH HOH A . #