data_4OJA # _entry.id 4OJA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4OJA pdb_00004oja 10.2210/pdb4oja/pdb RCSB RCSB084563 ? ? WWPDB D_1000084563 ? ? # _pdbx_database_status.entry_id 4OJA _pdbx_database_status.methods_development_category ? _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2014-01-21 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Anupama, A.' 1 'Ramaswamy, S.' 2 'Sai Sudha, P.' 3 # _citation.id primary _citation.title 'Structure of a Cu-Zn Superoxide dismutase at an evolutionary crossroad.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Subhadra, D.' 1 ? primary 'Anupama, A.' 2 ? primary 'Chirag, J.' 3 ? primary 'Ramaswamy, S.' 4 ? primary 'Sai Sudha, P.' 5 ? # _cell.length_a 70.360 _cell.length_b 70.360 _cell.length_c 148.960 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4OJA _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.entry_id 4OJA _symmetry.Int_Tables_number 181 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Superoxide dismutase [Cu-Zn]' 17802.602 1 1.15.1.1 ? 'cu-zn SOD, UNP residues 4-151' ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 68 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMSAICVLEGIVKGTIKFEDIGDGKTHVSGKITGLQPPGKHGFHIHQFGDYSGGCMSTGPH FNPFNKEHGGPEDENRHAGDLGNIVSDDYGNADVNIEDSQIPLDGPNSIIGRALVVHQNEDDLGLGGHKDSKTTGNAGAR LSCGVIGLAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMSAICVLEGIVKGTIKFEDIGDGKTHVSGKITGLQPPGKHGFHIHQFGDYSGGCMSTGPH FNPFNKEHGGPEDENRHAGDLGNIVSDDYGNADVNIEDSQIPLDGPNSIIGRALVVHQNEDDLGLGGHKDSKTTGNAGAR LSCGVIGLAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 SER n 1 23 ALA n 1 24 ILE n 1 25 CYS n 1 26 VAL n 1 27 LEU n 1 28 GLU n 1 29 GLY n 1 30 ILE n 1 31 VAL n 1 32 LYS n 1 33 GLY n 1 34 THR n 1 35 ILE n 1 36 LYS n 1 37 PHE n 1 38 GLU n 1 39 ASP n 1 40 ILE n 1 41 GLY n 1 42 ASP n 1 43 GLY n 1 44 LYS n 1 45 THR n 1 46 HIS n 1 47 VAL n 1 48 SER n 1 49 GLY n 1 50 LYS n 1 51 ILE n 1 52 THR n 1 53 GLY n 1 54 LEU n 1 55 GLN n 1 56 PRO n 1 57 PRO n 1 58 GLY n 1 59 LYS n 1 60 HIS n 1 61 GLY n 1 62 PHE n 1 63 HIS n 1 64 ILE n 1 65 HIS n 1 66 GLN n 1 67 PHE n 1 68 GLY n 1 69 ASP n 1 70 TYR n 1 71 SER n 1 72 GLY n 1 73 GLY n 1 74 CYS n 1 75 MET n 1 76 SER n 1 77 THR n 1 78 GLY n 1 79 PRO n 1 80 HIS n 1 81 PHE n 1 82 ASN n 1 83 PRO n 1 84 PHE n 1 85 ASN n 1 86 LYS n 1 87 GLU n 1 88 HIS n 1 89 GLY n 1 90 GLY n 1 91 PRO n 1 92 GLU n 1 93 ASP n 1 94 GLU n 1 95 ASN n 1 96 ARG n 1 97 HIS n 1 98 ALA n 1 99 GLY n 1 100 ASP n 1 101 LEU n 1 102 GLY n 1 103 ASN n 1 104 ILE n 1 105 VAL n 1 106 SER n 1 107 ASP n 1 108 ASP n 1 109 TYR n 1 110 GLY n 1 111 ASN n 1 112 ALA n 1 113 ASP n 1 114 VAL n 1 115 ASN n 1 116 ILE n 1 117 GLU n 1 118 ASP n 1 119 SER n 1 120 GLN n 1 121 ILE n 1 122 PRO n 1 123 LEU n 1 124 ASP n 1 125 GLY n 1 126 PRO n 1 127 ASN n 1 128 SER n 1 129 ILE n 1 130 ILE n 1 131 GLY n 1 132 ARG n 1 133 ALA n 1 134 LEU n 1 135 VAL n 1 136 VAL n 1 137 HIS n 1 138 GLN n 1 139 ASN n 1 140 GLU n 1 141 ASP n 1 142 ASP n 1 143 LEU n 1 144 GLY n 1 145 LEU n 1 146 GLY n 1 147 GLY n 1 148 HIS n 1 149 LYS n 1 150 ASP n 1 151 SER n 1 152 LYS n 1 153 THR n 1 154 THR n 1 155 GLY n 1 156 ASN n 1 157 ALA n 1 158 GLY n 1 159 ALA n 1 160 ARG n 1 161 LEU n 1 162 SER n 1 163 CYS n 1 164 GLY n 1 165 VAL n 1 166 ILE n 1 167 GLY n 1 168 LEU n 1 169 ALA n 1 170 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Hydra _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SOD1, SodA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hydra vulgaris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6087 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3* _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I3V7W8_HYDVU _struct_ref.pdbx_db_accession I3V7W8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SAICVLEGIVKGTIKFEDIGDGKTHVSGKITGLQPPGKHGFHIHQFGDYSGGCMSTGPHFNPFNKEHGGPEDENRHAGDL GNIVSDDYGNADVNIEDSQIPLDGPNSIIGRALVVHQNEDDLGLGGHKDSKTTGNAGARLSCGVIGLA ; _struct_ref.pdbx_align_begin 4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4OJA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I3V7W8 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4OJA MET A 1 ? UNP I3V7W8 ? ? 'expression tag' -17 1 1 4OJA GLY A 2 ? UNP I3V7W8 ? ? 'expression tag' -16 2 1 4OJA SER A 3 ? UNP I3V7W8 ? ? 'expression tag' -15 3 1 4OJA SER A 4 ? UNP I3V7W8 ? ? 'expression tag' -14 4 1 4OJA HIS A 5 ? UNP I3V7W8 ? ? 'expression tag' -13 5 1 4OJA HIS A 6 ? UNP I3V7W8 ? ? 'expression tag' -12 6 1 4OJA HIS A 7 ? UNP I3V7W8 ? ? 'expression tag' -11 7 1 4OJA HIS A 8 ? UNP I3V7W8 ? ? 'expression tag' -10 8 1 4OJA HIS A 9 ? UNP I3V7W8 ? ? 'expression tag' -9 9 1 4OJA HIS A 10 ? UNP I3V7W8 ? ? 'expression tag' -8 10 1 4OJA SER A 11 ? UNP I3V7W8 ? ? 'expression tag' -7 11 1 4OJA SER A 12 ? UNP I3V7W8 ? ? 'expression tag' -6 12 1 4OJA GLY A 13 ? UNP I3V7W8 ? ? 'expression tag' -5 13 1 4OJA LEU A 14 ? UNP I3V7W8 ? ? 'expression tag' -4 14 1 4OJA VAL A 15 ? UNP I3V7W8 ? ? 'expression tag' -3 15 1 4OJA PRO A 16 ? UNP I3V7W8 ? ? 'expression tag' -2 16 1 4OJA ARG A 17 ? UNP I3V7W8 ? ? 'expression tag' -1 17 1 4OJA GLY A 18 ? UNP I3V7W8 ? ? 'expression tag' 0 18 1 4OJA SER A 19 ? UNP I3V7W8 ? ? 'expression tag' 1 19 1 4OJA HIS A 20 ? UNP I3V7W8 ? ? 'expression tag' 2 20 1 4OJA MET A 21 ? UNP I3V7W8 ? ? 'expression tag' 3 21 1 4OJA ALA A 170 ? UNP I3V7W8 ? ? 'expression tag' 152 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.entry_id 4OJA _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 0.000 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 2.99 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 58.85 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.1M Sodium Acetate Trihydrate, 8% PEG 4000, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2012-02-27 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID # _reflns.entry_id 4OJA _reflns.d_resolution_high 2.277 _reflns.d_resolution_low 148.960 _reflns.number_all 9755 _reflns.number_obs 9755 _reflns.pdbx_netI_over_sigmaI 16.800 _reflns.pdbx_Rsym_value 0.101 _reflns.pdbx_redundancy 5.800 _reflns.percent_possible_obs 92.600 _reflns.B_iso_Wilson_estimate 22.860 _reflns.observed_criterion_sigma_F 1.0 _reflns.observed_criterion_sigma_I 1.0 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.280 2.400 ? 4878 ? 0 0.200 3.600 0.200 ? 3.800 ? 5.300 ? 1285 ? ? ? ? 87.200 ? 0.129 1 1 2.400 2.550 ? 5032 ? 0 0.197 3.500 0.197 ? 4.000 ? 6.200 ? 1248 ? ? ? ? 88.500 ? 0.116 2 1 2.550 2.720 ? 5051 ? 0 0.179 3.800 0.179 ? 4.300 ? 7.400 ? 1180 ? ? ? ? 88.600 ? 0.108 3 1 2.720 2.940 ? 6084 ? 0 0.169 3.800 0.169 ? 5.300 ? 10.500 ? 1139 ? ? ? ? 91.100 ? 0.085 4 1 2.940 3.220 ? 6803 ? 0 0.161 3.600 0.161 ? 6.200 ? 14.700 ? 1106 ? ? ? ? 95.200 ? 0.073 5 1 3.220 3.600 ? 6979 ? 0 0.130 4.400 0.130 ? 6.800 ? 21.900 ? 1033 ? ? ? ? 98.000 ? 0.056 6 1 3.600 4.160 ? 7215 ? 0 0.098 6.200 0.098 ? 7.800 ? 29.200 ? 929 ? ? ? ? 97.700 ? 0.039 7 1 4.160 5.090 ? 6430 ? 0 0.072 8.700 0.072 ? 8.000 ? 34.200 ? 805 ? ? ? ? 97.700 ? 0.028 8 1 5.090 7.200 ? 5101 ? 0 0.069 9.500 0.069 ? 7.900 ? 31.600 ? 645 ? ? ? ? 98.200 ? 0.026 9 1 7.200 148.960 ? 2723 ? 0 0.043 14.600 0.043 ? 7.100 ? 37.700 ? 385 ? ? ? ? 94.800 ? 0.017 10 1 # _refine.entry_id 4OJA _refine.ls_d_res_high 2.2770 _refine.ls_d_res_low 38.4920 _refine.pdbx_ls_sigma_F 2.520 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 91.6600 _refine.ls_number_reflns_obs 9740 _refine.ls_number_reflns_all 10630 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details random _refine.details ? _refine.ls_R_factor_all 0.1959 _refine.ls_R_factor_obs 0.1959 _refine.ls_R_factor_R_work 0.1909 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2399 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_number_reflns_R_free 974 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 25.3100 _refine.solvent_model_param_bsol 31.4840 _refine.solvent_model_param_ksol 0.3920 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -3.7138 _refine.aniso_B[2][2] -3.7138 _refine.aniso_B[3][3] 7.4276 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.0000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.7300 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 1SRD _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8702 _refine.B_iso_max 95.340 _refine.B_iso_min 9.630 _refine.pdbx_overall_phase_error 19.4600 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1088 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 1163 _refine_hist.d_res_high 2.2770 _refine_hist.d_res_low 38.4920 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 1115 0.013 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1505 1.523 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 158 0.087 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 207 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 398 18.328 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.redundancy_reflns_obs 2.2765 2.3965 7 86.0000 1123 . 0.2447 0.3081 . 125 . 1248 . 'X-RAY DIFFRACTION' . 2.3965 2.5466 7 87.0000 1167 . 0.2307 0.2821 . 129 . 1296 . 'X-RAY DIFFRACTION' . 2.5466 2.7432 7 88.0000 1172 . 0.2249 0.3027 . 130 . 1302 . 'X-RAY DIFFRACTION' . 2.7432 3.0192 7 91.0000 1212 . 0.1990 0.2809 . 134 . 1346 . 'X-RAY DIFFRACTION' . 3.0192 3.4558 7 96.0000 1308 . 0.1710 0.2288 . 145 . 1453 . 'X-RAY DIFFRACTION' . 3.4558 4.3530 7 97.0000 1345 . 0.1625 0.2134 . 150 . 1495 . 'X-RAY DIFFRACTION' . 4.3530 38.4973 7 96.0000 1439 . 0.1843 0.1984 . 161 . 1600 . 'X-RAY DIFFRACTION' . # _struct.entry_id 4OJA _struct.title 'Structure of Hydra Cu-Zn superoxide dismutase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4OJA _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'Greek key motif, radical oxygen dismutation, cytosolic, Oxidoreductase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 73 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 78 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 60 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 74 SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 56 A CYS 145 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc1 metalc ? ? A HIS 63 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 45 A CU 201 1_555 ? ? ? ? ? ? ? 2.391 ? ? metalc2 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 47 A CU 201 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc3 metalc ? ? A HIS 80 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 62 A ZN 202 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc4 metalc ? ? A HIS 88 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 70 A ZN 202 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc5 metalc ? ? A HIS 97 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 79 A ZN 202 1_555 ? ? ? ? ? ? ? 2.026 ? ? metalc6 metalc ? ? A ASP 100 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 82 A ZN 202 1_555 ? ? ? ? ? ? ? 2.012 ? ? metalc7 metalc ? ? A HIS 137 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 119 A CU 201 1_555 ? ? ? ? ? ? ? 2.040 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 40 A . ? ILE 22 A GLY 41 A ? GLY 23 A 1 14.79 2 GLY 41 A . ? GLY 23 A ASP 42 A ? ASP 24 A 1 11.13 3 ASP 42 A . ? ASP 24 A GLY 43 A ? GLY 25 A 1 8.31 4 GLN 55 A . ? GLN 37 A PRO 56 A ? PRO 38 A 1 -3.04 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 28 ? GLY A 29 ? GLU A 10 GLY A 11 A 2 ARG A 160 ? LEU A 168 ? ARG A 142 LEU A 150 A 3 ALA A 133 ? HIS A 137 ? ALA A 115 HIS A 119 A 4 GLY A 58 ? HIS A 65 ? GLY A 40 HIS A 47 A 5 ASP A 100 ? SER A 106 ? ASP A 82 SER A 88 A 6 ALA A 112 ? ASP A 118 ? ALA A 94 ASP A 100 A 7 THR A 45 ? THR A 52 ? THR A 27 THR A 34 A 8 LYS A 32 ? ASP A 39 ? LYS A 14 ASP A 21 A 9 ALA A 23 ? VAL A 26 ? ALA A 5 VAL A 8 A 10 ARG A 160 ? LEU A 168 ? ARG A 142 LEU A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 28 ? N GLU A 10 O CYS A 163 ? O CYS A 145 A 2 3 O LEU A 161 ? O LEU A 143 N VAL A 136 ? N VAL A 118 A 3 4 O ALA A 133 ? O ALA A 115 N HIS A 65 ? N HIS A 47 A 4 5 N HIS A 60 ? N HIS A 42 O ILE A 104 ? O ILE A 86 A 5 6 N VAL A 105 ? N VAL A 87 O ASP A 113 ? O ASP A 95 A 6 7 O ASP A 118 ? O ASP A 100 N THR A 45 ? N THR A 27 A 7 8 O SER A 48 ? O SER A 30 N LYS A 36 ? N LYS A 18 A 8 9 O ILE A 35 ? O ILE A 17 N CYS A 25 ? N CYS A 7 A 9 10 N ILE A 24 ? N ILE A 6 O GLY A 167 ? O GLY A 149 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 201 ? 4 'BINDING SITE FOR RESIDUE CU A 201' AC2 Software A ZN 202 ? 4 'BINDING SITE FOR RESIDUE ZN A 202' AC3 Software A SO4 203 ? 2 'BINDING SITE FOR RESIDUE SO4 A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 63 ? HIS A 45 . ? 1_555 ? 2 AC1 4 HIS A 65 ? HIS A 47 . ? 1_555 ? 3 AC1 4 HIS A 80 ? HIS A 62 . ? 1_555 ? 4 AC1 4 HIS A 137 ? HIS A 119 . ? 1_555 ? 5 AC2 4 HIS A 80 ? HIS A 62 . ? 1_555 ? 6 AC2 4 HIS A 88 ? HIS A 70 . ? 1_555 ? 7 AC2 4 HIS A 97 ? HIS A 79 . ? 1_555 ? 8 AC2 4 ASP A 100 ? ASP A 82 . ? 1_555 ? 9 AC3 2 GLN A 66 ? GLN A 48 . ? 10_665 ? 10 AC3 2 ARG A 132 ? ARG A 114 . ? 10_665 ? # _atom_sites.entry_id 4OJA _atom_sites.fract_transf_matrix[1][1] 0.014213 _atom_sites.fract_transf_matrix[1][2] 0.008206 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016411 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006713 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CU H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -17 ? ? ? A . n A 1 2 GLY 2 -16 ? ? ? A . n A 1 3 SER 3 -15 ? ? ? A . n A 1 4 SER 4 -14 ? ? ? A . n A 1 5 HIS 5 -13 ? ? ? A . n A 1 6 HIS 6 -12 ? ? ? A . n A 1 7 HIS 7 -11 ? ? ? A . n A 1 8 HIS 8 -10 ? ? ? A . n A 1 9 HIS 9 -9 ? ? ? A . n A 1 10 HIS 10 -8 ? ? ? A . n A 1 11 SER 11 -7 ? ? ? A . n A 1 12 SER 12 -6 ? ? ? A . n A 1 13 GLY 13 -5 ? ? ? A . n A 1 14 LEU 14 -4 ? ? ? A . n A 1 15 VAL 15 -3 ? ? ? A . n A 1 16 PRO 16 -2 ? ? ? A . n A 1 17 ARG 17 -1 ? ? ? A . n A 1 18 GLY 18 0 ? ? ? A . n A 1 19 SER 19 1 ? ? ? A . n A 1 20 HIS 20 2 ? ? ? A . n A 1 21 MET 21 3 ? ? ? A . n A 1 22 SER 22 4 4 SER SER A . n A 1 23 ALA 23 5 5 ALA ALA A . n A 1 24 ILE 24 6 6 ILE ILE A . n A 1 25 CYS 25 7 7 CYS CYS A . n A 1 26 VAL 26 8 8 VAL VAL A . n A 1 27 LEU 27 9 9 LEU LEU A . n A 1 28 GLU 28 10 10 GLU GLU A . n A 1 29 GLY 29 11 11 GLY GLY A . n A 1 30 ILE 30 12 12 ILE ILE A . n A 1 31 VAL 31 13 13 VAL VAL A . n A 1 32 LYS 32 14 14 LYS LYS A . n A 1 33 GLY 33 15 15 GLY GLY A . n A 1 34 THR 34 16 16 THR THR A . n A 1 35 ILE 35 17 17 ILE ILE A . n A 1 36 LYS 36 18 18 LYS LYS A . n A 1 37 PHE 37 19 19 PHE PHE A . n A 1 38 GLU 38 20 20 GLU GLU A . n A 1 39 ASP 39 21 21 ASP ASP A . n A 1 40 ILE 40 22 22 ILE ILE A . n A 1 41 GLY 41 23 23 GLY GLY A . n A 1 42 ASP 42 24 24 ASP ASP A . n A 1 43 GLY 43 25 25 GLY GLY A . n A 1 44 LYS 44 26 26 LYS LYS A . n A 1 45 THR 45 27 27 THR THR A . n A 1 46 HIS 46 28 28 HIS HIS A . n A 1 47 VAL 47 29 29 VAL VAL A . n A 1 48 SER 48 30 30 SER SER A . n A 1 49 GLY 49 31 31 GLY GLY A . n A 1 50 LYS 50 32 32 LYS LYS A . n A 1 51 ILE 51 33 33 ILE ILE A . n A 1 52 THR 52 34 34 THR THR A . n A 1 53 GLY 53 35 35 GLY GLY A . n A 1 54 LEU 54 36 36 LEU LEU A . n A 1 55 GLN 55 37 37 GLN GLN A . n A 1 56 PRO 56 38 38 PRO PRO A . n A 1 57 PRO 57 39 39 PRO PRO A . n A 1 58 GLY 58 40 40 GLY GLY A . n A 1 59 LYS 59 41 41 LYS LYS A . n A 1 60 HIS 60 42 42 HIS HIS A . n A 1 61 GLY 61 43 43 GLY GLY A . n A 1 62 PHE 62 44 44 PHE PHE A . n A 1 63 HIS 63 45 45 HIS HIS A . n A 1 64 ILE 64 46 46 ILE ILE A . n A 1 65 HIS 65 47 47 HIS HIS A . n A 1 66 GLN 66 48 48 GLN GLN A . n A 1 67 PHE 67 49 49 PHE PHE A . n A 1 68 GLY 68 50 50 GLY GLY A . n A 1 69 ASP 69 51 51 ASP ASP A . n A 1 70 TYR 70 52 52 TYR TYR A . n A 1 71 SER 71 53 53 SER SER A . n A 1 72 GLY 72 54 54 GLY GLY A . n A 1 73 GLY 73 55 55 GLY GLY A . n A 1 74 CYS 74 56 56 CYS CYS A . n A 1 75 MET 75 57 57 MET MET A . n A 1 76 SER 76 58 58 SER SER A . n A 1 77 THR 77 59 59 THR THR A . n A 1 78 GLY 78 60 60 GLY GLY A . n A 1 79 PRO 79 61 61 PRO PRO A . n A 1 80 HIS 80 62 62 HIS HIS A . n A 1 81 PHE 81 63 63 PHE PHE A . n A 1 82 ASN 82 64 64 ASN ASN A . n A 1 83 PRO 83 65 65 PRO PRO A . n A 1 84 PHE 84 66 66 PHE PHE A . n A 1 85 ASN 85 67 67 ASN ASN A . n A 1 86 LYS 86 68 68 LYS LYS A . n A 1 87 GLU 87 69 69 GLU GLU A . n A 1 88 HIS 88 70 70 HIS HIS A . n A 1 89 GLY 89 71 71 GLY GLY A . n A 1 90 GLY 90 72 72 GLY GLY A . n A 1 91 PRO 91 73 73 PRO PRO A . n A 1 92 GLU 92 74 74 GLU GLU A . n A 1 93 ASP 93 75 75 ASP ASP A . n A 1 94 GLU 94 76 76 GLU GLU A . n A 1 95 ASN 95 77 77 ASN ASN A . n A 1 96 ARG 96 78 78 ARG ARG A . n A 1 97 HIS 97 79 79 HIS HIS A . n A 1 98 ALA 98 80 80 ALA ALA A . n A 1 99 GLY 99 81 81 GLY GLY A . n A 1 100 ASP 100 82 82 ASP ASP A . n A 1 101 LEU 101 83 83 LEU LEU A . n A 1 102 GLY 102 84 84 GLY GLY A . n A 1 103 ASN 103 85 85 ASN ASN A . n A 1 104 ILE 104 86 86 ILE ILE A . n A 1 105 VAL 105 87 87 VAL VAL A . n A 1 106 SER 106 88 88 SER SER A . n A 1 107 ASP 107 89 89 ASP ASP A . n A 1 108 ASP 108 90 90 ASP ASP A . n A 1 109 TYR 109 91 91 TYR TYR A . n A 1 110 GLY 110 92 92 GLY GLY A . n A 1 111 ASN 111 93 93 ASN ASN A . n A 1 112 ALA 112 94 94 ALA ALA A . n A 1 113 ASP 113 95 95 ASP ASP A . n A 1 114 VAL 114 96 96 VAL VAL A . n A 1 115 ASN 115 97 97 ASN ASN A . n A 1 116 ILE 116 98 98 ILE ILE A . n A 1 117 GLU 117 99 99 GLU GLU A . n A 1 118 ASP 118 100 100 ASP ASP A . n A 1 119 SER 119 101 101 SER SER A . n A 1 120 GLN 120 102 102 GLN GLN A . n A 1 121 ILE 121 103 103 ILE ILE A . n A 1 122 PRO 122 104 104 PRO PRO A . n A 1 123 LEU 123 105 105 LEU LEU A . n A 1 124 ASP 124 106 106 ASP ASP A . n A 1 125 GLY 125 107 107 GLY GLY A . n A 1 126 PRO 126 108 108 PRO PRO A . n A 1 127 ASN 127 109 109 ASN ASN A . n A 1 128 SER 128 110 110 SER SER A . n A 1 129 ILE 129 111 111 ILE ILE A . n A 1 130 ILE 130 112 112 ILE ILE A . n A 1 131 GLY 131 113 113 GLY GLY A . n A 1 132 ARG 132 114 114 ARG ARG A . n A 1 133 ALA 133 115 115 ALA ALA A . n A 1 134 LEU 134 116 116 LEU LEU A . n A 1 135 VAL 135 117 117 VAL VAL A . n A 1 136 VAL 136 118 118 VAL VAL A . n A 1 137 HIS 137 119 119 HIS HIS A . n A 1 138 GLN 138 120 120 GLN GLN A . n A 1 139 ASN 139 121 121 ASN ASN A . n A 1 140 GLU 140 122 122 GLU GLU A . n A 1 141 ASP 141 123 123 ASP ASP A . n A 1 142 ASP 142 124 124 ASP ASP A . n A 1 143 LEU 143 125 125 LEU LEU A . n A 1 144 GLY 144 126 126 GLY GLY A . n A 1 145 LEU 145 127 127 LEU LEU A . n A 1 146 GLY 146 128 128 GLY GLY A . n A 1 147 GLY 147 129 129 GLY GLY A . n A 1 148 HIS 148 130 130 HIS HIS A . n A 1 149 LYS 149 131 131 LYS LYS A . n A 1 150 ASP 150 132 132 ASP ASP A . n A 1 151 SER 151 133 133 SER SER A . n A 1 152 LYS 152 134 134 LYS LYS A . n A 1 153 THR 153 135 135 THR THR A . n A 1 154 THR 154 136 136 THR THR A . n A 1 155 GLY 155 137 137 GLY GLY A . n A 1 156 ASN 156 138 138 ASN ASN A . n A 1 157 ALA 157 139 139 ALA ALA A . n A 1 158 GLY 158 140 140 GLY GLY A . n A 1 159 ALA 159 141 141 ALA ALA A . n A 1 160 ARG 160 142 142 ARG ARG A . n A 1 161 LEU 161 143 143 LEU LEU A . n A 1 162 SER 162 144 144 SER SER A . n A 1 163 CYS 163 145 145 CYS CYS A . n A 1 164 GLY 164 146 146 GLY GLY A . n A 1 165 VAL 165 147 147 VAL VAL A . n A 1 166 ILE 166 148 148 ILE ILE A . n A 1 167 GLY 167 149 149 GLY GLY A . n A 1 168 LEU 168 150 150 LEU LEU A . n A 1 169 ALA 169 151 151 ALA ALA A . n A 1 170 ALA 170 152 152 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 201 1 CU CU A . C 3 ZN 1 202 2 ZN ZN A . D 4 SO4 1 203 1 SO4 SO4 A . E 5 HOH 1 301 1 HOH HOH A . E 5 HOH 2 302 2 HOH HOH A . E 5 HOH 3 303 3 HOH HOH A . E 5 HOH 4 304 4 HOH HOH A . E 5 HOH 5 305 5 HOH HOH A . E 5 HOH 6 306 6 HOH HOH A . E 5 HOH 7 307 7 HOH HOH A . E 5 HOH 8 308 8 HOH HOH A . E 5 HOH 9 309 9 HOH HOH A . E 5 HOH 10 310 10 HOH HOH A . E 5 HOH 11 311 11 HOH HOH A . E 5 HOH 12 312 12 HOH HOH A . E 5 HOH 13 313 13 HOH HOH A . E 5 HOH 14 314 14 HOH HOH A . E 5 HOH 15 315 15 HOH HOH A . E 5 HOH 16 316 16 HOH HOH A . E 5 HOH 17 317 17 HOH HOH A . E 5 HOH 18 318 18 HOH HOH A . E 5 HOH 19 319 19 HOH HOH A . E 5 HOH 20 320 20 HOH HOH A . E 5 HOH 21 321 21 HOH HOH A . E 5 HOH 22 322 22 HOH HOH A . E 5 HOH 23 323 23 HOH HOH A . E 5 HOH 24 324 24 HOH HOH A . E 5 HOH 25 325 25 HOH HOH A . E 5 HOH 26 326 26 HOH HOH A . E 5 HOH 27 327 27 HOH HOH A . E 5 HOH 28 328 28 HOH HOH A . E 5 HOH 29 329 29 HOH HOH A . E 5 HOH 30 330 30 HOH HOH A . E 5 HOH 31 331 31 HOH HOH A . E 5 HOH 32 332 32 HOH HOH A . E 5 HOH 33 333 33 HOH HOH A . E 5 HOH 34 334 34 HOH HOH A . E 5 HOH 35 335 35 HOH HOH A . E 5 HOH 36 336 36 HOH HOH A . E 5 HOH 37 337 37 HOH HOH A . E 5 HOH 38 338 38 HOH HOH A . E 5 HOH 39 339 39 HOH HOH A . E 5 HOH 40 340 40 HOH HOH A . E 5 HOH 41 341 41 HOH HOH A . E 5 HOH 42 342 42 HOH HOH A . E 5 HOH 43 343 43 HOH HOH A . E 5 HOH 44 344 44 HOH HOH A . E 5 HOH 45 345 45 HOH HOH A . E 5 HOH 46 346 46 HOH HOH A . E 5 HOH 47 347 47 HOH HOH A . E 5 HOH 48 348 48 HOH HOH A . E 5 HOH 49 349 49 HOH HOH A . E 5 HOH 50 350 50 HOH HOH A . E 5 HOH 51 351 51 HOH HOH A . E 5 HOH 52 352 52 HOH HOH A . E 5 HOH 53 353 53 HOH HOH A . E 5 HOH 54 354 54 HOH HOH A . E 5 HOH 55 355 55 HOH HOH A . E 5 HOH 56 356 56 HOH HOH A . E 5 HOH 57 357 57 HOH HOH A . E 5 HOH 58 358 58 HOH HOH A . E 5 HOH 59 359 59 HOH HOH A . E 5 HOH 60 360 60 HOH HOH A . E 5 HOH 61 361 61 HOH HOH A . E 5 HOH 62 362 62 HOH HOH A . E 5 HOH 63 363 63 HOH HOH A . E 5 HOH 64 364 64 HOH HOH A . E 5 HOH 65 365 65 HOH HOH A . E 5 HOH 66 366 66 HOH HOH A . E 5 HOH 67 367 67 HOH HOH A . E 5 HOH 68 368 68 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1400 ? 1 MORE -11 ? 1 'SSA (A^2)' 12870 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/3 0.5000000000 -0.8660254038 0.0000000000 35.1800000000 -0.8660254038 -0.5000000000 0.0000000000 60.9335474103 0.0000000000 0.0000000000 -1.0000000000 49.6533333333 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 63 ? A HIS 45 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 NE2 ? A HIS 65 ? A HIS 47 ? 1_555 140.7 ? 2 ND1 ? A HIS 63 ? A HIS 45 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 NE2 ? A HIS 137 ? A HIS 119 ? 1_555 93.1 ? 3 NE2 ? A HIS 65 ? A HIS 47 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 NE2 ? A HIS 137 ? A HIS 119 ? 1_555 126.1 ? 4 ND1 ? A HIS 80 ? A HIS 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 88 ? A HIS 70 ? 1_555 95.9 ? 5 ND1 ? A HIS 80 ? A HIS 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 97 ? A HIS 79 ? 1_555 107.0 ? 6 ND1 ? A HIS 88 ? A HIS 70 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 97 ? A HIS 79 ? 1_555 123.2 ? 7 ND1 ? A HIS 80 ? A HIS 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OD1 ? A ASP 100 ? A ASP 82 ? 1_555 108.1 ? 8 ND1 ? A HIS 88 ? A HIS 70 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OD1 ? A ASP 100 ? A ASP 82 ? 1_555 109.4 ? 9 ND1 ? A HIS 97 ? A HIS 79 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OD1 ? A ASP 100 ? A ASP 82 ? 1_555 111.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-01-28 2 'Structure model' 1 1 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_ref_seq_dif 8 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.value' 19 2 'Structure model' '_struct_conn.pdbx_dist_value' 20 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 2 'Structure model' '_struct_ref_seq_dif.details' 31 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_phasing_MR.entry_id 4OJA _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.500 _pdbx_phasing_MR.d_res_low_rotation 38.490 _pdbx_phasing_MR.d_res_high_translation 2.500 _pdbx_phasing_MR.d_res_low_translation 148.960 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALA 3.3.20 2011/05/18 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 2 PHASER . ? program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 PHENIX 1.7.3_928 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 4 PDB_EXTRACT 3.14 'Dec. 10, 2013' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 PROCESS . ? ? ? ? 'data reduction' ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD1 A HIS 62 ? ? ZN A ZN 202 ? ? 1.43 2 1 HD1 A HIS 70 ? ? ZN A ZN 202 ? ? 1.45 3 1 NZ A LYS 131 ? ? O A HOH 361 ? ? 2.11 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 24 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 73.56 _pdbx_validate_torsion.psi -164.47 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -17 ? A MET 1 2 1 Y 1 A GLY -16 ? A GLY 2 3 1 Y 1 A SER -15 ? A SER 3 4 1 Y 1 A SER -14 ? A SER 4 5 1 Y 1 A HIS -13 ? A HIS 5 6 1 Y 1 A HIS -12 ? A HIS 6 7 1 Y 1 A HIS -11 ? A HIS 7 8 1 Y 1 A HIS -10 ? A HIS 8 9 1 Y 1 A HIS -9 ? A HIS 9 10 1 Y 1 A HIS -8 ? A HIS 10 11 1 Y 1 A SER -7 ? A SER 11 12 1 Y 1 A SER -6 ? A SER 12 13 1 Y 1 A GLY -5 ? A GLY 13 14 1 Y 1 A LEU -4 ? A LEU 14 15 1 Y 1 A VAL -3 ? A VAL 15 16 1 Y 1 A PRO -2 ? A PRO 16 17 1 Y 1 A ARG -1 ? A ARG 17 18 1 Y 1 A GLY 0 ? A GLY 18 19 1 Y 1 A SER 1 ? A SER 19 20 1 Y 1 A HIS 2 ? A HIS 20 21 1 Y 1 A MET 3 ? A MET 21 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 ZN ZN ZN N N 370 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'ZINC ION' ZN 4 'SULFATE ION' SO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1SRD _pdbx_initial_refinement_model.details ? #