data_4OO5 # _entry.id 4OO5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4OO5 pdb_00004oo5 10.2210/pdb4oo5/pdb RCSB RCSB084738 ? ? WWPDB D_1000084738 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-02-12 2 'Structure model' 1 1 2023-09-20 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_ref_seq_dif 7 3 'Structure model' pdbx_entry_details 8 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4OO5 _pdbx_database_status.recvd_initial_deposition_date 2014-01-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3M9J 'The same protein without S-nitroso modification, reduced form.' unspecified PDB 3M9K 'The same protein without S-nitroso modification, oxidized form.' unspecified PDB 2IIY 'The wildtype protein with S-nitroso modifications on C62 and C69, pH 7.' unspecified PDB 2HXK 'The wildtype protein with S-nitroso modifications on C62 and C69, pH 9.' unspecified PDB 4OO4 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'The, J.' 1 'Weichsel, A.' 2 'Montfort, W.R.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal Structure of a Thioredoxin Mutant Displays a Dynamic N-terminal Loop Surrounding an S-nitrosation Site' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Crystal structure of human thioredoxin revealing an unraveled helix and exposed S-nitrosation site.' 'Protein Sci.' 19 1801 1806 2010 PRCIEI US 0961-8368 0795 ? 20662007 10.1002/pro.455 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'The, J.' 1 ? primary 'Weichsel, A.' 2 ? primary 'Montfort, W.R.' 3 ? 1 'Weichsel, A.' 4 ? 1 'Kem, M.' 5 ? 1 'Montfort, W.R.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Thioredoxin 11747.345 1 ? 'C69S, C73S' ? ? 2 water nat water 18.015 101 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Trx, ATL-derived factor, ADF, Surface-associated sulphydryl protein, SASP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDD(SNC)QDVASESEVKSMPT FQFFKKGQKVGEFSGANKEKLEATINELV ; _entity_poly.pdbx_seq_one_letter_code_can ;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASESEVKSMPTFQFF KKGQKVGEFSGANKEKLEATINELV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 GLN n 1 5 ILE n 1 6 GLU n 1 7 SER n 1 8 LYS n 1 9 THR n 1 10 ALA n 1 11 PHE n 1 12 GLN n 1 13 GLU n 1 14 ALA n 1 15 LEU n 1 16 ASP n 1 17 ALA n 1 18 ALA n 1 19 GLY n 1 20 ASP n 1 21 LYS n 1 22 LEU n 1 23 VAL n 1 24 VAL n 1 25 VAL n 1 26 ASP n 1 27 PHE n 1 28 SER n 1 29 ALA n 1 30 THR n 1 31 TRP n 1 32 CYS n 1 33 GLY n 1 34 PRO n 1 35 CYS n 1 36 LYS n 1 37 MET n 1 38 ILE n 1 39 LYS n 1 40 PRO n 1 41 PHE n 1 42 PHE n 1 43 HIS n 1 44 SER n 1 45 LEU n 1 46 SER n 1 47 GLU n 1 48 LYS n 1 49 TYR n 1 50 SER n 1 51 ASN n 1 52 VAL n 1 53 ILE n 1 54 PHE n 1 55 LEU n 1 56 GLU n 1 57 VAL n 1 58 ASP n 1 59 VAL n 1 60 ASP n 1 61 ASP n 1 62 SNC n 1 63 GLN n 1 64 ASP n 1 65 VAL n 1 66 ALA n 1 67 SER n 1 68 GLU n 1 69 SER n 1 70 GLU n 1 71 VAL n 1 72 LYS n 1 73 SER n 1 74 MET n 1 75 PRO n 1 76 THR n 1 77 PHE n 1 78 GLN n 1 79 PHE n 1 80 PHE n 1 81 LYS n 1 82 LYS n 1 83 GLY n 1 84 GLN n 1 85 LYS n 1 86 VAL n 1 87 GLY n 1 88 GLU n 1 89 PHE n 1 90 SER n 1 91 GLY n 1 92 ALA n 1 93 ASN n 1 94 LYS n 1 95 GLU n 1 96 LYS n 1 97 LEU n 1 98 GLU n 1 99 ALA n 1 100 THR n 1 101 ILE n 1 102 ASN n 1 103 GLU n 1 104 LEU n 1 105 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TXN, TRDX, TRX, TRX1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-3a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SNC 'L-peptide linking' n S-NITROSO-CYSTEINE ? 'C3 H6 N2 O3 S' 150.156 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 SNC 62 62 62 SNC SNC A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 1 HOH HOH A . B 2 HOH 2 202 2 HOH HOH A . B 2 HOH 3 203 3 HOH HOH A . B 2 HOH 4 204 4 HOH HOH A . B 2 HOH 5 205 5 HOH HOH A . B 2 HOH 6 206 6 HOH HOH A . B 2 HOH 7 207 7 HOH HOH A . B 2 HOH 8 208 8 HOH HOH A . B 2 HOH 9 209 9 HOH HOH A . B 2 HOH 10 210 10 HOH HOH A . B 2 HOH 11 211 11 HOH HOH A . B 2 HOH 12 212 12 HOH HOH A . B 2 HOH 13 213 13 HOH HOH A . B 2 HOH 14 214 14 HOH HOH A . B 2 HOH 15 215 15 HOH HOH A . B 2 HOH 16 216 16 HOH HOH A . B 2 HOH 17 217 17 HOH HOH A . B 2 HOH 18 218 18 HOH HOH A . B 2 HOH 19 219 19 HOH HOH A . B 2 HOH 20 220 20 HOH HOH A . B 2 HOH 21 221 21 HOH HOH A . B 2 HOH 22 222 22 HOH HOH A . B 2 HOH 23 223 23 HOH HOH A . B 2 HOH 24 224 24 HOH HOH A . B 2 HOH 25 225 25 HOH HOH A . B 2 HOH 26 226 26 HOH HOH A . B 2 HOH 27 227 27 HOH HOH A . B 2 HOH 28 228 28 HOH HOH A . B 2 HOH 29 229 29 HOH HOH A . B 2 HOH 30 230 30 HOH HOH A . B 2 HOH 31 231 31 HOH HOH A . B 2 HOH 32 232 32 HOH HOH A . B 2 HOH 33 233 33 HOH HOH A . B 2 HOH 34 234 34 HOH HOH A . B 2 HOH 35 235 35 HOH HOH A . B 2 HOH 36 236 36 HOH HOH A . B 2 HOH 37 237 37 HOH HOH A . B 2 HOH 38 238 38 HOH HOH A . B 2 HOH 39 239 39 HOH HOH A . B 2 HOH 40 240 40 HOH HOH A . B 2 HOH 41 241 41 HOH HOH A . B 2 HOH 42 242 42 HOH HOH A . B 2 HOH 43 243 43 HOH HOH A . B 2 HOH 44 244 44 HOH HOH A . B 2 HOH 45 245 45 HOH HOH A . B 2 HOH 46 246 46 HOH HOH A . B 2 HOH 47 247 47 HOH HOH A . B 2 HOH 48 248 48 HOH HOH A . B 2 HOH 49 249 49 HOH HOH A . B 2 HOH 50 250 50 HOH HOH A . B 2 HOH 51 251 51 HOH HOH A . B 2 HOH 52 252 52 HOH HOH A . B 2 HOH 53 253 53 HOH HOH A . B 2 HOH 54 254 54 HOH HOH A . B 2 HOH 55 255 55 HOH HOH A . B 2 HOH 56 256 56 HOH HOH A . B 2 HOH 57 257 57 HOH HOH A . B 2 HOH 58 258 58 HOH HOH A . B 2 HOH 59 259 59 HOH HOH A . B 2 HOH 60 260 60 HOH HOH A . B 2 HOH 61 261 61 HOH HOH A . B 2 HOH 62 262 62 HOH HOH A . B 2 HOH 63 263 63 HOH HOH A . B 2 HOH 64 264 64 HOH HOH A . B 2 HOH 65 265 65 HOH HOH A . B 2 HOH 66 266 66 HOH HOH A . B 2 HOH 67 267 67 HOH HOH A . B 2 HOH 68 268 68 HOH HOH A . B 2 HOH 69 269 69 HOH HOH A . B 2 HOH 70 270 70 HOH HOH A . B 2 HOH 71 271 71 HOH HOH A . B 2 HOH 72 272 72 HOH HOH A . B 2 HOH 73 273 73 HOH HOH A . B 2 HOH 74 274 74 HOH HOH A . B 2 HOH 75 275 75 HOH HOH A . B 2 HOH 76 276 76 HOH HOH A . B 2 HOH 77 277 77 HOH HOH A . B 2 HOH 78 278 78 HOH HOH A . B 2 HOH 79 279 79 HOH HOH A . B 2 HOH 80 280 80 HOH HOH A . B 2 HOH 81 281 81 HOH HOH A . B 2 HOH 82 282 82 HOH HOH A . B 2 HOH 83 283 83 HOH HOH A . B 2 HOH 84 284 84 HOH HOH A . B 2 HOH 85 285 85 HOH HOH A . B 2 HOH 86 286 86 HOH HOH A . B 2 HOH 87 287 87 HOH HOH A . B 2 HOH 88 288 88 HOH HOH A . B 2 HOH 89 289 89 HOH HOH A . B 2 HOH 90 290 90 HOH HOH A . B 2 HOH 91 291 91 HOH HOH A . B 2 HOH 92 292 92 HOH HOH A . B 2 HOH 93 293 93 HOH HOH A . B 2 HOH 94 294 94 HOH HOH A . B 2 HOH 95 295 95 HOH HOH A . B 2 HOH 96 296 96 HOH HOH A . B 2 HOH 97 297 97 HOH HOH A . B 2 HOH 98 298 98 HOH HOH A . B 2 HOH 99 299 99 HOH HOH A . B 2 HOH 100 300 100 HOH HOH A . B 2 HOH 101 301 101 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data scaling' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.8.0049 ? 3 HKL-2000 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # _cell.entry_id 4OO5 _cell.length_a 67.008 _cell.length_b 26.038 _cell.length_c 51.090 _cell.angle_alpha 90.00 _cell.angle_beta 94.83 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4OO5 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? # _exptl.entry_id 4OO5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.89 _exptl_crystal.density_percent_sol 34.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4 _exptl_crystal_grow.pdbx_details '21% PEG 3350, 0.1 M sodium acetate, pH 4, VAPOR DIFFUSION, HANGING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.pdbx_collection_date 2012-01-06 _diffrn_detector.details 'RH COATED FLAT MIRROR, TOROIDAL FOCUSING MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111) DOUBLE CRYSTAL MONOCHROMATOR' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9795 # _reflns.entry_id 4OO5 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 25.45 _reflns.d_resolution_high 1.54 _reflns.number_obs 12978 _reflns.number_all 12978 _reflns.percent_possible_obs 98.7 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.2 _reflns.B_iso_Wilson_estimate 17.9 _reflns.pdbx_redundancy 3.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.54 _reflns_shell.d_res_low 1.63 _reflns_shell.percent_possible_all 95.9 _reflns_shell.Rmerge_I_obs 0.326 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1837 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4OO5 _refine.ls_number_reflns_obs 12317 _refine.ls_number_reflns_all 12317 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 25.45 _refine.ls_d_res_high 1.54 _refine.ls_percent_reflns_obs 98.20 _refine.ls_R_factor_obs 0.19396 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19131 _refine.ls_R_factor_R_free 0.24836 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 632 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.930 _refine.B_iso_mean 29.765 _refine.aniso_B[1][1] 0.06 _refine.aniso_B[2][2] 1.63 _refine.aniso_B[3][3] -1.64 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.17 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 1ERT' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model Isotropic _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.107 _refine.pdbx_overall_ESU_R_Free 0.114 _refine.overall_SU_ML 0.101 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.969 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 4OO5 _refine_analyze.Luzzati_coordinate_error_obs 0.209 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 823 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 101 _refine_hist.number_atoms_total 924 _refine_hist.d_res_high 1.54 _refine_hist.d_res_low 25.45 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.021 0.019 ? 963 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 902 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2.025 1.968 ? 1313 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.936 3.000 ? 2122 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.378 5.000 ? 132 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 35.640 26.786 ? 42 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.367 15.000 ? 189 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.129 0.200 ? 139 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.009 0.020 ? 1155 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.003 0.020 ? 203 ? 'X-RAY DIFFRACTION' r_mcbond_it 2.470 2.711 ? 489 ? 'X-RAY DIFFRACTION' r_mcbond_other 2.465 2.709 ? 488 ? 'X-RAY DIFFRACTION' r_mcangle_it 3.371 4.054 ? 634 ? 'X-RAY DIFFRACTION' r_mcangle_other 3.368 4.056 ? 635 ? 'X-RAY DIFFRACTION' r_scbond_it 3.879 3.028 ? 472 ? 'X-RAY DIFFRACTION' r_scbond_other 3.877 3.029 ? 472 ? 'X-RAY DIFFRACTION' r_scangle_other 5.743 4.404 ? 678 ? 'X-RAY DIFFRACTION' r_long_range_B_refined 7.366 22.848 ? 1162 ? 'X-RAY DIFFRACTION' r_long_range_B_other 7.308 22.386 ? 1128 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.544 _refine_ls_shell.d_res_low 1.584 _refine_ls_shell.number_reflns_R_work 816 _refine_ls_shell.R_factor_R_work 0.302 _refine_ls_shell.percent_reflns_obs 90.04 _refine_ls_shell.R_factor_R_free 0.387 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 43 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 816 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 4OO5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 4OO5 _struct.title 'Crystal Structure of S-nitrosated Human Thioredoxin Mutant' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4OO5 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'S-nitrosation, S-nitrosocysteine, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THIO_HUMAN _struct_ref.pdbx_db_accession P10599 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFF KKGQKVGEFSGANKEKLEATINELV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4OO5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10599 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4OO5 SER A 69 ? UNP P10599 CYS 69 'engineered mutation' 69 1 1 4OO5 SER A 73 ? UNP P10599 CYS 73 'engineered mutation' 73 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 7 ? ALA A 18 ? SER A 7 ALA A 18 1 ? 12 HELX_P HELX_P2 2 CYS A 32 ? TYR A 49 ? CYS A 32 TYR A 49 1 ? 18 HELX_P HELX_P3 3 SNC A 62 ? SER A 69 ? SNC A 62 SER A 69 1 ? 8 HELX_P HELX_P4 4 ASN A 93 ? VAL A 105 ? ASN A 93 VAL A 105 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 32 A CYS 35 1_555 ? ? ? ? ? ? ? 2.099 ? ? covale1 covale both ? A ASP 61 C ? ? ? 1_555 A SNC 62 N ? ? A ASP 61 A SNC 62 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale2 covale both ? A SNC 62 C ? ? ? 1_555 A GLN 63 N ? ? A SNC 62 A GLN 63 1_555 ? ? ? ? ? ? ? 1.324 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 SNC A 62 ? . . . . SNC A 62 ? 1_555 . . . . . . . CYS 1 SNC Nitrosylation 'Named protein modification' 2 CYS A 32 ? CYS A 35 ? CYS A 32 ? 1_555 CYS A 35 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 74 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 74 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 75 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 75 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -12.97 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 2 ? ILE A 5 ? VAL A 2 ILE A 5 A 2 ILE A 53 ? ASP A 58 ? ILE A 53 ASP A 58 A 3 VAL A 23 ? SER A 28 ? VAL A 23 SER A 28 A 4 THR A 76 ? LYS A 81 ? THR A 76 LYS A 81 A 5 GLN A 84 ? SER A 90 ? GLN A 84 SER A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 3 ? N LYS A 3 O PHE A 54 ? O PHE A 54 A 2 3 O ILE A 53 ? O ILE A 53 N VAL A 24 ? N VAL A 24 A 3 4 N VAL A 25 ? N VAL A 25 O GLN A 78 ? O GLN A 78 A 4 5 N PHE A 77 ? N PHE A 77 O PHE A 89 ? O PHE A 89 # _pdbx_entry_details.entry_id 4OO5 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A GLY 33 ? ? N A PRO 34 ? ? CA A PRO 34 ? ? 128.45 119.30 9.15 1.50 Y 2 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD2 A ASP 61 ? ? 112.48 118.30 -5.82 0.90 N 3 1 CB A ASP 64 ? ? CG A ASP 64 ? ? OD1 A ASP 64 ? ? 125.31 118.30 7.01 0.90 N 4 1 CB A ASP 64 ? ? CG A ASP 64 ? ? OD2 A ASP 64 ? ? 111.31 118.30 -6.99 0.90 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 72 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -124.18 _pdbx_validate_torsion.psi -54.73 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SNC _pdbx_struct_mod_residue.label_seq_id 62 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SNC _pdbx_struct_mod_residue.auth_seq_id 62 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details S-NITROSO-CYSTEINE # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 208 ? B HOH . 2 1 A HOH 274 ? B HOH . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 HOH O O N N 131 HOH H1 H N N 132 HOH H2 H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 PRO N N N N 246 PRO CA C N S 247 PRO C C N N 248 PRO O O N N 249 PRO CB C N N 250 PRO CG C N N 251 PRO CD C N N 252 PRO OXT O N N 253 PRO H H N N 254 PRO HA H N N 255 PRO HB2 H N N 256 PRO HB3 H N N 257 PRO HG2 H N N 258 PRO HG3 H N N 259 PRO HD2 H N N 260 PRO HD3 H N N 261 PRO HXT H N N 262 SER N N N N 263 SER CA C N S 264 SER C C N N 265 SER O O N N 266 SER CB C N N 267 SER OG O N N 268 SER OXT O N N 269 SER H H N N 270 SER H2 H N N 271 SER HA H N N 272 SER HB2 H N N 273 SER HB3 H N N 274 SER HG H N N 275 SER HXT H N N 276 SNC N N N N 277 SNC CA C N R 278 SNC CB C N N 279 SNC SG S N N 280 SNC ND N N N 281 SNC OE O N N 282 SNC C C N N 283 SNC O O N N 284 SNC OXT O N N 285 SNC H H N N 286 SNC H2 H N N 287 SNC HA H N N 288 SNC HB2 H N N 289 SNC HB3 H N N 290 SNC HXT H N N 291 THR N N N N 292 THR CA C N S 293 THR C C N N 294 THR O O N N 295 THR CB C N R 296 THR OG1 O N N 297 THR CG2 C N N 298 THR OXT O N N 299 THR H H N N 300 THR H2 H N N 301 THR HA H N N 302 THR HB H N N 303 THR HG1 H N N 304 THR HG21 H N N 305 THR HG22 H N N 306 THR HG23 H N N 307 THR HXT H N N 308 TRP N N N N 309 TRP CA C N S 310 TRP C C N N 311 TRP O O N N 312 TRP CB C N N 313 TRP CG C Y N 314 TRP CD1 C Y N 315 TRP CD2 C Y N 316 TRP NE1 N Y N 317 TRP CE2 C Y N 318 TRP CE3 C Y N 319 TRP CZ2 C Y N 320 TRP CZ3 C Y N 321 TRP CH2 C Y N 322 TRP OXT O N N 323 TRP H H N N 324 TRP H2 H N N 325 TRP HA H N N 326 TRP HB2 H N N 327 TRP HB3 H N N 328 TRP HD1 H N N 329 TRP HE1 H N N 330 TRP HE3 H N N 331 TRP HZ2 H N N 332 TRP HZ3 H N N 333 TRP HH2 H N N 334 TRP HXT H N N 335 TYR N N N N 336 TYR CA C N S 337 TYR C C N N 338 TYR O O N N 339 TYR CB C N N 340 TYR CG C Y N 341 TYR CD1 C Y N 342 TYR CD2 C Y N 343 TYR CE1 C Y N 344 TYR CE2 C Y N 345 TYR CZ C Y N 346 TYR OH O N N 347 TYR OXT O N N 348 TYR H H N N 349 TYR H2 H N N 350 TYR HA H N N 351 TYR HB2 H N N 352 TYR HB3 H N N 353 TYR HD1 H N N 354 TYR HD2 H N N 355 TYR HE1 H N N 356 TYR HE2 H N N 357 TYR HH H N N 358 TYR HXT H N N 359 VAL N N N N 360 VAL CA C N S 361 VAL C C N N 362 VAL O O N N 363 VAL CB C N N 364 VAL CG1 C N N 365 VAL CG2 C N N 366 VAL OXT O N N 367 VAL H H N N 368 VAL H2 H N N 369 VAL HA H N N 370 VAL HB H N N 371 VAL HG11 H N N 372 VAL HG12 H N N 373 VAL HG13 H N N 374 VAL HG21 H N N 375 VAL HG22 H N N 376 VAL HG23 H N N 377 VAL HXT H N N 378 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 HOH O H1 sing N N 124 HOH O H2 sing N N 125 ILE N CA sing N N 126 ILE N H sing N N 127 ILE N H2 sing N N 128 ILE CA C sing N N 129 ILE CA CB sing N N 130 ILE CA HA sing N N 131 ILE C O doub N N 132 ILE C OXT sing N N 133 ILE CB CG1 sing N N 134 ILE CB CG2 sing N N 135 ILE CB HB sing N N 136 ILE CG1 CD1 sing N N 137 ILE CG1 HG12 sing N N 138 ILE CG1 HG13 sing N N 139 ILE CG2 HG21 sing N N 140 ILE CG2 HG22 sing N N 141 ILE CG2 HG23 sing N N 142 ILE CD1 HD11 sing N N 143 ILE CD1 HD12 sing N N 144 ILE CD1 HD13 sing N N 145 ILE OXT HXT sing N N 146 LEU N CA sing N N 147 LEU N H sing N N 148 LEU N H2 sing N N 149 LEU CA C sing N N 150 LEU CA CB sing N N 151 LEU CA HA sing N N 152 LEU C O doub N N 153 LEU C OXT sing N N 154 LEU CB CG sing N N 155 LEU CB HB2 sing N N 156 LEU CB HB3 sing N N 157 LEU CG CD1 sing N N 158 LEU CG CD2 sing N N 159 LEU CG HG sing N N 160 LEU CD1 HD11 sing N N 161 LEU CD1 HD12 sing N N 162 LEU CD1 HD13 sing N N 163 LEU CD2 HD21 sing N N 164 LEU CD2 HD22 sing N N 165 LEU CD2 HD23 sing N N 166 LEU OXT HXT sing N N 167 LYS N CA sing N N 168 LYS N H sing N N 169 LYS N H2 sing N N 170 LYS CA C sing N N 171 LYS CA CB sing N N 172 LYS CA HA sing N N 173 LYS C O doub N N 174 LYS C OXT sing N N 175 LYS CB CG sing N N 176 LYS CB HB2 sing N N 177 LYS CB HB3 sing N N 178 LYS CG CD sing N N 179 LYS CG HG2 sing N N 180 LYS CG HG3 sing N N 181 LYS CD CE sing N N 182 LYS CD HD2 sing N N 183 LYS CD HD3 sing N N 184 LYS CE NZ sing N N 185 LYS CE HE2 sing N N 186 LYS CE HE3 sing N N 187 LYS NZ HZ1 sing N N 188 LYS NZ HZ2 sing N N 189 LYS NZ HZ3 sing N N 190 LYS OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PHE N CA sing N N 211 PHE N H sing N N 212 PHE N H2 sing N N 213 PHE CA C sing N N 214 PHE CA CB sing N N 215 PHE CA HA sing N N 216 PHE C O doub N N 217 PHE C OXT sing N N 218 PHE CB CG sing N N 219 PHE CB HB2 sing N N 220 PHE CB HB3 sing N N 221 PHE CG CD1 doub Y N 222 PHE CG CD2 sing Y N 223 PHE CD1 CE1 sing Y N 224 PHE CD1 HD1 sing N N 225 PHE CD2 CE2 doub Y N 226 PHE CD2 HD2 sing N N 227 PHE CE1 CZ doub Y N 228 PHE CE1 HE1 sing N N 229 PHE CE2 CZ sing Y N 230 PHE CE2 HE2 sing N N 231 PHE CZ HZ sing N N 232 PHE OXT HXT sing N N 233 PRO N CA sing N N 234 PRO N CD sing N N 235 PRO N H sing N N 236 PRO CA C sing N N 237 PRO CA CB sing N N 238 PRO CA HA sing N N 239 PRO C O doub N N 240 PRO C OXT sing N N 241 PRO CB CG sing N N 242 PRO CB HB2 sing N N 243 PRO CB HB3 sing N N 244 PRO CG CD sing N N 245 PRO CG HG2 sing N N 246 PRO CG HG3 sing N N 247 PRO CD HD2 sing N N 248 PRO CD HD3 sing N N 249 PRO OXT HXT sing N N 250 SER N CA sing N N 251 SER N H sing N N 252 SER N H2 sing N N 253 SER CA C sing N N 254 SER CA CB sing N N 255 SER CA HA sing N N 256 SER C O doub N N 257 SER C OXT sing N N 258 SER CB OG sing N N 259 SER CB HB2 sing N N 260 SER CB HB3 sing N N 261 SER OG HG sing N N 262 SER OXT HXT sing N N 263 SNC N CA sing N N 264 SNC N H sing N N 265 SNC N H2 sing N N 266 SNC CA CB sing N N 267 SNC CA C sing N N 268 SNC CA HA sing N N 269 SNC CB SG sing N N 270 SNC CB HB2 sing N N 271 SNC CB HB3 sing N N 272 SNC SG ND sing N N 273 SNC ND OE doub N N 274 SNC C O doub N N 275 SNC C OXT sing N N 276 SNC OXT HXT sing N N 277 THR N CA sing N N 278 THR N H sing N N 279 THR N H2 sing N N 280 THR CA C sing N N 281 THR CA CB sing N N 282 THR CA HA sing N N 283 THR C O doub N N 284 THR C OXT sing N N 285 THR CB OG1 sing N N 286 THR CB CG2 sing N N 287 THR CB HB sing N N 288 THR OG1 HG1 sing N N 289 THR CG2 HG21 sing N N 290 THR CG2 HG22 sing N N 291 THR CG2 HG23 sing N N 292 THR OXT HXT sing N N 293 TRP N CA sing N N 294 TRP N H sing N N 295 TRP N H2 sing N N 296 TRP CA C sing N N 297 TRP CA CB sing N N 298 TRP CA HA sing N N 299 TRP C O doub N N 300 TRP C OXT sing N N 301 TRP CB CG sing N N 302 TRP CB HB2 sing N N 303 TRP CB HB3 sing N N 304 TRP CG CD1 doub Y N 305 TRP CG CD2 sing Y N 306 TRP CD1 NE1 sing Y N 307 TRP CD1 HD1 sing N N 308 TRP CD2 CE2 doub Y N 309 TRP CD2 CE3 sing Y N 310 TRP NE1 CE2 sing Y N 311 TRP NE1 HE1 sing N N 312 TRP CE2 CZ2 sing Y N 313 TRP CE3 CZ3 doub Y N 314 TRP CE3 HE3 sing N N 315 TRP CZ2 CH2 doub Y N 316 TRP CZ2 HZ2 sing N N 317 TRP CZ3 CH2 sing Y N 318 TRP CZ3 HZ3 sing N N 319 TRP CH2 HH2 sing N N 320 TRP OXT HXT sing N N 321 TYR N CA sing N N 322 TYR N H sing N N 323 TYR N H2 sing N N 324 TYR CA C sing N N 325 TYR CA CB sing N N 326 TYR CA HA sing N N 327 TYR C O doub N N 328 TYR C OXT sing N N 329 TYR CB CG sing N N 330 TYR CB HB2 sing N N 331 TYR CB HB3 sing N N 332 TYR CG CD1 doub Y N 333 TYR CG CD2 sing Y N 334 TYR CD1 CE1 sing Y N 335 TYR CD1 HD1 sing N N 336 TYR CD2 CE2 doub Y N 337 TYR CD2 HD2 sing N N 338 TYR CE1 CZ doub Y N 339 TYR CE1 HE1 sing N N 340 TYR CE2 CZ sing Y N 341 TYR CE2 HE2 sing N N 342 TYR CZ OH sing N N 343 TYR OH HH sing N N 344 TYR OXT HXT sing N N 345 VAL N CA sing N N 346 VAL N H sing N N 347 VAL N H2 sing N N 348 VAL CA C sing N N 349 VAL CA CB sing N N 350 VAL CA HA sing N N 351 VAL C O doub N N 352 VAL C OXT sing N N 353 VAL CB CG1 sing N N 354 VAL CB CG2 sing N N 355 VAL CB HB sing N N 356 VAL CG1 HG11 sing N N 357 VAL CG1 HG12 sing N N 358 VAL CG1 HG13 sing N N 359 VAL CG2 HG21 sing N N 360 VAL CG2 HG22 sing N N 361 VAL CG2 HG23 sing N N 362 VAL OXT HXT sing N N 363 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ERT _pdbx_initial_refinement_model.details 'PDB ENTRY 1ERT' # _atom_sites.entry_id 4OO5 _atom_sites.fract_transf_matrix[1][1] 0.014924 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001260 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.038405 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019643 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_