data_4OS1 # _entry.id 4OS1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.342 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4OS1 RCSB RCSB084878 WWPDB D_1000084878 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4GLY 'Human urokinase-type plasminogen activator uPA in complex with the two-disulfide bridge peptide UK504' unspecified PDB 4OS2 'Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK602 (bicyclic 1)' unspecified PDB 4OS4 'Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK603 (bicyclic 1)' unspecified PDB 4OS5 'Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK603 (bicyclic 2)' unspecified PDB 4OS6 'Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK604 (bicyclic 2)' unspecified PDB 4OS7 'Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK607 (bicyclic)' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4OS1 _pdbx_database_status.recvd_initial_deposition_date 2014-02-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, S.' 1 'Pojer, F.' 2 'Heinis, C.' 3 # _citation.id primary _citation.title 'Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.' _citation.journal_abbrev 'Nat Chem' _citation.journal_volume 6 _citation.page_first 1009 _citation.page_last 1016 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1755-4349 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25343607 _citation.pdbx_database_id_DOI 10.1038/nchem.2043 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, S.' 1 ? primary 'Gopalakrishnan, R.' 2 ? primary 'Schaer, T.' 3 ? primary 'Marger, F.' 4 ? primary 'Hovius, R.' 5 ? primary 'Bertrand, D.' 6 ? primary 'Pojer, F.' 7 ? primary 'Heinis, C.' 8 ? # _cell.entry_id 4OS1 _cell.length_a 52.402 _cell.length_b 53.728 _cell.length_c 84.995 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4OS1 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Urokinase-type plasminogen activator' 27586.420 1 3.4.21.73 'C122A, N145Q' 'catalytic domain (UNP residues 179-423)' ? 2 polymer syn 'bicyclic peptide UK601 (bicyclic 1)' 1549.869 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 5 water nat water 18.015 130 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;U-plasminogen activator, uPA, Urokinase-type plasminogen activator long chain A, Urokinase-type plasminogen activator short chain A, Urokinase-type plasminogen activator chain B ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHT ; ;IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHT ; A ? 2 'polypeptide(L)' no yes 'G(81S)ALGRGCENHRCL(NH2)' GXALGRGCENHRCLX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ILE n 1 3 GLY n 1 4 GLY n 1 5 GLU n 1 6 PHE n 1 7 THR n 1 8 THR n 1 9 ILE n 1 10 GLU n 1 11 ASN n 1 12 GLN n 1 13 PRO n 1 14 TRP n 1 15 PHE n 1 16 ALA n 1 17 ALA n 1 18 ILE n 1 19 TYR n 1 20 ARG n 1 21 ARG n 1 22 HIS n 1 23 ARG n 1 24 GLY n 1 25 GLY n 1 26 SER n 1 27 VAL n 1 28 THR n 1 29 TYR n 1 30 VAL n 1 31 CYS n 1 32 GLY n 1 33 GLY n 1 34 SER n 1 35 LEU n 1 36 ILE n 1 37 SER n 1 38 PRO n 1 39 CYS n 1 40 TRP n 1 41 VAL n 1 42 ILE n 1 43 SER n 1 44 ALA n 1 45 THR n 1 46 HIS n 1 47 CYS n 1 48 PHE n 1 49 ILE n 1 50 ASP n 1 51 TYR n 1 52 PRO n 1 53 LYS n 1 54 LYS n 1 55 GLU n 1 56 ASP n 1 57 TYR n 1 58 ILE n 1 59 VAL n 1 60 TYR n 1 61 LEU n 1 62 GLY n 1 63 ARG n 1 64 SER n 1 65 ARG n 1 66 LEU n 1 67 ASN n 1 68 SER n 1 69 ASN n 1 70 THR n 1 71 GLN n 1 72 GLY n 1 73 GLU n 1 74 MET n 1 75 LYS n 1 76 PHE n 1 77 GLU n 1 78 VAL n 1 79 GLU n 1 80 ASN n 1 81 LEU n 1 82 ILE n 1 83 LEU n 1 84 HIS n 1 85 LYS n 1 86 ASP n 1 87 TYR n 1 88 SER n 1 89 ALA n 1 90 ASP n 1 91 THR n 1 92 LEU n 1 93 ALA n 1 94 HIS n 1 95 HIS n 1 96 ASN n 1 97 ASP n 1 98 ILE n 1 99 ALA n 1 100 LEU n 1 101 LEU n 1 102 LYS n 1 103 ILE n 1 104 ARG n 1 105 SER n 1 106 LYS n 1 107 GLU n 1 108 GLY n 1 109 ARG n 1 110 CYS n 1 111 ALA n 1 112 GLN n 1 113 PRO n 1 114 SER n 1 115 ARG n 1 116 THR n 1 117 ILE n 1 118 GLN n 1 119 THR n 1 120 ILE n 1 121 ALA n 1 122 LEU n 1 123 PRO n 1 124 SER n 1 125 MET n 1 126 TYR n 1 127 ASN n 1 128 ASP n 1 129 PRO n 1 130 GLN n 1 131 PHE n 1 132 GLY n 1 133 THR n 1 134 SER n 1 135 CYS n 1 136 GLU n 1 137 ILE n 1 138 THR n 1 139 GLY n 1 140 PHE n 1 141 GLY n 1 142 LYS n 1 143 GLU n 1 144 GLN n 1 145 SER n 1 146 THR n 1 147 ASP n 1 148 TYR n 1 149 LEU n 1 150 TYR n 1 151 PRO n 1 152 GLU n 1 153 GLN n 1 154 LEU n 1 155 LYS n 1 156 MET n 1 157 THR n 1 158 VAL n 1 159 VAL n 1 160 LYS n 1 161 LEU n 1 162 ILE n 1 163 SER n 1 164 HIS n 1 165 ARG n 1 166 GLU n 1 167 CYS n 1 168 GLN n 1 169 GLN n 1 170 PRO n 1 171 HIS n 1 172 TYR n 1 173 TYR n 1 174 GLY n 1 175 SER n 1 176 GLU n 1 177 VAL n 1 178 THR n 1 179 THR n 1 180 LYS n 1 181 MET n 1 182 LEU n 1 183 CYS n 1 184 ALA n 1 185 ALA n 1 186 ASP n 1 187 PRO n 1 188 GLN n 1 189 TRP n 1 190 LYS n 1 191 THR n 1 192 ASP n 1 193 SER n 1 194 CYS n 1 195 GLN n 1 196 GLY n 1 197 ASP n 1 198 SER n 1 199 GLY n 1 200 GLY n 1 201 PRO n 1 202 LEU n 1 203 VAL n 1 204 CYS n 1 205 SER n 1 206 LEU n 1 207 GLN n 1 208 GLY n 1 209 ARG n 1 210 MET n 1 211 THR n 1 212 LEU n 1 213 THR n 1 214 GLY n 1 215 ILE n 1 216 VAL n 1 217 SER n 1 218 TRP n 1 219 GLY n 1 220 ARG n 1 221 GLY n 1 222 CYS n 1 223 ALA n 1 224 LEU n 1 225 LYS n 1 226 ASP n 1 227 LYS n 1 228 PRO n 1 229 GLY n 1 230 VAL n 1 231 TYR n 1 232 THR n 1 233 ARG n 1 234 VAL n 1 235 SER n 1 236 HIS n 1 237 PHE n 1 238 LEU n 1 239 PRO n 1 240 TRP n 1 241 ILE n 1 242 ARG n 1 243 SER n 1 244 HIS n 1 245 THR n 2 1 GLY n 2 2 81S n 2 3 ALA n 2 4 LEU n 2 5 GLY n 2 6 ARG n 2 7 GLY n 2 8 CYS n 2 9 GLU n 2 10 ASN n 2 11 HIS n 2 12 ARG n 2 13 CYS n 2 14 LEU n 2 15 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PLAU _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line HEK293 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSecTagA _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP UROK_HUMAN P00749 1 ;IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHT ; 179 ? 2 PDB 4OS1 4OS1 2 'G(81S)ALGRGCENHRCL(NH2)' 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4OS1 A 1 ? 245 ? P00749 179 ? 423 ? 16 242 2 2 4OS1 B 1 ? 15 ? 4OS1 1 ? 15 ? 1 15 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4OS1 ALA A 121 ? UNP P00749 CYS 299 'engineered mutation' 122 1 1 4OS1 GLN A 144 ? UNP P00749 ASN 322 'engineered mutation' 145 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 81S 'L-peptide linking' . '(4S)-4,5-disulfanyl-L-norvaline' ? 'C5 H11 N O2 S2' 181.276 ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4OS1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_percent_sol 40.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pdbx_details '21% PEG4000, 15% glycerol, 0.17 M ammonium sulfate, 0.1 M sodium acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 2M-F' _diffrn_detector.pdbx_collection_date 2013-10-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1 # _reflns.entry_id 4OS1 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 45.41 _reflns.d_resolution_high 2.2 _reflns.number_obs 12754 _reflns.number_all 12754 _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 22.3 _reflns.B_iso_Wilson_estimate 16.602 _reflns.pdbx_redundancy 4.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.2 2.32 100 0.086 ? 15.4 4.8 ? 1821 ? ? ? ? 1 1 6.96 45.42 99.6 0.037 ? 28.0 3.9 ? 472 ? ? ? ? 2 1 # _refine.entry_id 4OS1 _refine.ls_number_reflns_obs 12091 _refine.ls_number_reflns_all 12754 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.65 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 99.97 _refine.ls_R_factor_obs 0.17714 _refine.ls_R_factor_all 0.17714 _refine.ls_R_factor_R_work 0.17457 _refine.ls_R_factor_R_free 0.22688 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 623 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.B_iso_mean 22.516 _refine.aniso_B[1][1] -1.47 _refine.aniso_B[2][2] -0.74 _refine.aniso_B[3][3] 2.21 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.316 _refine.pdbx_overall_ESU_R_Free 0.216 _refine.overall_SU_ML 0.132 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 5.064 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2038 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 130 _refine_hist.number_atoms_total 2182 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 44.65 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.006 0.019 ? 2105 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.002 0.020 ? 1957 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.185 1.955 ? 2853 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.731 3.005 ? 4497 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.241 5.000 ? 257 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 29.833 23.043 ? 92 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 14.934 15.000 ? 351 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 16.164 15.000 ? 15 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.071 0.200 ? 306 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.004 0.021 ? 2363 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 496 ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.200 _refine_ls_shell.d_res_low 2.257 _refine_ls_shell.number_reflns_R_work 882 _refine_ls_shell.R_factor_R_work 0.181 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.285 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 50 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4OS1 _struct.title 'Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK601 (bicyclic 1)' _struct.pdbx_descriptor 'Urokinase-type plasminogen activator (E.C.3.4.21.73), bicyclic peptide UK601 (bicyclic 1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4OS1 _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' _struct_keywords.text 'bicyclic peptide, inhibitor, protease, disulfide bridges, cyclization, extracellular, HYDROLASE-HYDROLASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 8 ? GLN A 12 ? THR A 23 GLN A 27 5 ? 5 HELX_P HELX_P2 2 ALA A 44 ? PHE A 48 ? ALA A 55 PHE A 59 5 ? 5 HELX_P HELX_P3 3 LYS A 53 ? GLU A 55 A LYS A 61 GLU A 62 5 ? 3 HELX_P HELX_P4 4 SER A 163 ? GLN A 168 ? SER A 164 GLN A 169 1 ? 6 HELX_P HELX_P5 5 TYR A 173 ? VAL A 177 ? TYR A 172 VAL A 176 5 ? 5 HELX_P HELX_P6 6 PHE A 237 ? THR A 245 ? PHE A 234 THR A 242 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf2 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 50 A CYS 111 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf3 disulf ? ? A CYS 135 SG ? ? ? 1_555 A CYS 204 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf4 disulf ? ? A CYS 167 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf5 disulf ? ? A CYS 194 SG ? ? ? 1_555 A CYS 222 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.036 ? ? covale1 covale both ? B GLY 1 C ? ? ? 1_555 B 81S 2 N ? ? B GLY 1 B 81S 2 1_555 ? ? ? ? ? ? ? 1.331 sing ? covale2 covale both ? B 81S 2 C ? ? ? 1_555 B ALA 3 N ? ? B 81S 2 B ALA 3 1_555 ? ? ? ? ? ? ? 1.332 sing ? covale3 covale one ? B 81S 2 SE ? ? ? 1_555 B CYS 8 SG ? ? B 81S 2 B CYS 8 1_555 ? ? ? ? ? ? ? 2.045 sing ? covale4 covale one ? B 81S 2 SD2 ? ? ? 1_555 B CYS 13 SG ? ? B 81S 2 B CYS 13 1_555 ? ? ? ? ? ? ? 2.052 sing ? covale5 covale both ? B LEU 14 C ? ? ? 1_555 B NH2 15 N ? ? B LEU 14 B NH2 15 1_555 ? ? ? ? ? ? ? 1.369 sing ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 7 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 5 ? PHE A 6 ? GLU A 20 PHE A 21 A 2 LYS A 155 ? ILE A 162 ? LYS A 156 ILE A 163 A 3 MET A 181 ? ALA A 185 ? MET A 180 ALA A 184 A 4 GLY A 229 ? ARG A 233 ? GLY A 226 ARG A 230 A 5 ARG A 209 ? TRP A 218 ? ARG A 206 TRP A 215 A 6 PRO A 201 ? LEU A 206 ? PRO A 198 LEU A 203 A 7 SER A 134 ? GLY A 139 ? SER A 135 GLY A 140 A 8 LYS A 155 ? ILE A 162 ? LYS A 156 ILE A 163 B 1 PHE A 15 ? ARG A 21 ? PHE A 30 ARG A 36 B 2 VAL A 27 ? SER A 37 ? VAL A 38 SER A 48 B 3 TRP A 40 ? SER A 43 ? TRP A 51 SER A 54 B 4 ALA A 99 ? ARG A 104 ? ALA A 104 ARG A 109 B 5 MET A 74 ? LEU A 83 ? MET A 81 LEU A 90 B 6 TYR A 57 ? LEU A 61 ? TYR A 64 LEU A 68 B 7 PHE A 15 ? ARG A 21 ? PHE A 30 ARG A 36 C 1 SER A 88 ? ALA A 89 ? SER A 95 ALA A 96 C 2 HIS A 94 ? HIS A 95 ? HIS A 99 HIS A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 5 ? N GLU A 20 O MET A 156 ? O MET A 157 A 2 3 N ILE A 162 ? N ILE A 163 O CYS A 183 ? O CYS A 182 A 3 4 N LEU A 182 ? N LEU A 181 O TYR A 231 ? O TYR A 228 A 4 5 O VAL A 230 ? O VAL A 227 N TRP A 218 ? N TRP A 215 A 5 6 O THR A 211 ? O THR A 208 N CYS A 204 ? N CYS A 201 A 6 7 O VAL A 203 ? O VAL A 200 N GLU A 136 ? N GLU A 137 A 7 8 N CYS A 135 ? N CYS A 136 O VAL A 159 ? O VAL A 160 B 1 2 N ALA A 16 ? N ALA A 31 O GLY A 33 ? O GLY A 44 B 2 3 N SER A 34 ? N SER A 45 O ILE A 42 ? O ILE A 53 B 3 4 N VAL A 41 ? N VAL A 52 O LEU A 101 ? O LEU A 106 B 4 5 O LEU A 100 ? O LEU A 105 N ILE A 82 ? N ILE A 89 B 5 6 O MET A 74 ? O MET A 81 N LEU A 61 ? N LEU A 68 B 6 7 O TYR A 60 ? O TYR A 67 N ALA A 17 ? N ALA A 32 C 1 2 N SER A 88 ? N SER A 95 O HIS A 95 ? O HIS A 100 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 6 'BINDING SITE FOR RESIDUE SO4 A 301' AC2 Software A SO4 302 ? 4 'BINDING SITE FOR RESIDUE SO4 A 302' AC3 Software A ACT 303 ? 3 'BINDING SITE FOR RESIDUE ACT A 303' AC4 Software ? ? ? ? 29 'BINDING SITE FOR CHAIN B OF BICYCLIC PEPTIDE UK601 (BICYCLIC 1)' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LYS A 53 ? LYS A 61 . ? 4_555 ? 2 AC1 6 HIS A 95 ? HIS A 100 . ? 1_555 ? 3 AC1 6 THR A 178 ? THR A 177 . ? 1_555 ? 4 AC1 6 LYS A 180 ? LYS A 179 . ? 1_555 ? 5 AC1 6 MET A 181 ? MET A 180 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 417 . ? 1_555 ? 7 AC2 4 ARG A 20 ? ARG A 35 . ? 1_555 ? 8 AC2 4 HIS A 22 ? HIS A 37 . ? 1_555 ? 9 AC2 4 ARG A 23 A ARG A 37 . ? 1_555 ? 10 AC2 4 LYS A 190 ? LYS A 187 . ? 3_654 ? 11 AC3 3 LYS A 106 A LYS A 110 . ? 1_555 ? 12 AC3 3 LYS A 225 ? LYS A 223 . ? 1_455 ? 13 AC3 3 HOH F . ? HOH A 490 . ? 1_455 ? 14 AC4 29 GLU A 5 ? GLU A 20 . ? 3_654 ? 15 AC4 29 PHE A 6 ? PHE A 21 . ? 3_654 ? 16 AC4 29 THR A 8 ? THR A 23 . ? 3_654 ? 17 AC4 29 ARG A 20 ? ARG A 35 . ? 1_555 ? 18 AC4 29 HIS A 46 ? HIS A 57 . ? 1_555 ? 19 AC4 29 CYS A 47 ? CYS A 58 . ? 1_555 ? 20 AC4 29 ASP A 50 A ASP A 60 . ? 1_555 ? 21 AC4 29 TYR A 51 B TYR A 60 . ? 1_555 ? 22 AC4 29 TYR A 57 ? TYR A 64 . ? 1_555 ? 23 AC4 29 HIS A 94 ? HIS A 99 . ? 1_555 ? 24 AC4 29 SER A 175 ? SER A 174 . ? 4_455 ? 25 AC4 29 ASP A 192 ? ASP A 189 . ? 1_555 ? 26 AC4 29 SER A 193 ? SER A 190 . ? 1_555 ? 27 AC4 29 CYS A 194 ? CYS A 191 . ? 1_555 ? 28 AC4 29 GLN A 195 ? GLN A 192 . ? 1_555 ? 29 AC4 29 GLY A 196 ? GLY A 193 . ? 1_555 ? 30 AC4 29 SER A 198 ? SER A 195 . ? 1_555 ? 31 AC4 29 SER A 217 ? SER A 214 . ? 1_555 ? 32 AC4 29 TRP A 218 ? TRP A 215 . ? 1_555 ? 33 AC4 29 GLY A 221 ? GLY A 218 . ? 1_555 ? 34 AC4 29 GLY A 229 ? GLY A 226 . ? 1_555 ? 35 AC4 29 HOH F . ? HOH A 444 . ? 1_555 ? 36 AC4 29 HOH F . ? HOH A 469 . ? 3_654 ? 37 AC4 29 HOH F . ? HOH A 471 . ? 1_555 ? 38 AC4 29 HOH G . ? HOH B 101 . ? 1_555 ? 39 AC4 29 HOH G . ? HOH B 102 . ? 1_555 ? 40 AC4 29 HOH G . ? HOH B 103 . ? 1_555 ? 41 AC4 29 HOH G . ? HOH B 104 . ? 1_555 ? 42 AC4 29 HOH G . ? HOH B 105 . ? 1_555 ? # _database_PDB_matrix.entry_id 4OS1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4OS1 _atom_sites.fract_transf_matrix[1][1] 0.019083 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018612 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011765 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 ILE 2 17 17 ILE ILE A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 GLU 5 20 20 GLU GLU A . n A 1 6 PHE 6 21 21 PHE PHE A . n A 1 7 THR 7 22 22 THR THR A . n A 1 8 THR 8 23 23 THR THR A . n A 1 9 ILE 9 24 24 ILE ILE A . n A 1 10 GLU 10 25 25 GLU GLU A . n A 1 11 ASN 11 26 26 ASN ASN A . n A 1 12 GLN 12 27 27 GLN GLN A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TRP 14 29 29 TRP TRP A . n A 1 15 PHE 15 30 30 PHE PHE A . n A 1 16 ALA 16 31 31 ALA ALA A . n A 1 17 ALA 17 32 32 ALA ALA A . n A 1 18 ILE 18 33 33 ILE ILE A . n A 1 19 TYR 19 34 34 TYR TYR A . n A 1 20 ARG 20 35 35 ARG ARG A . n A 1 21 ARG 21 36 36 ARG ARG A . n A 1 22 HIS 22 37 37 HIS HIS A . n A 1 23 ARG 23 37 37 ARG ARG A A n A 1 24 GLY 24 37 37 GLY GLY A B n A 1 25 GLY 25 37 37 GLY GLY A C n A 1 26 SER 26 37 37 SER SER A D n A 1 27 VAL 27 38 38 VAL VAL A . n A 1 28 THR 28 39 39 THR THR A . n A 1 29 TYR 29 40 40 TYR TYR A . n A 1 30 VAL 30 41 41 VAL VAL A . n A 1 31 CYS 31 42 42 CYS CYS A . n A 1 32 GLY 32 43 43 GLY GLY A . n A 1 33 GLY 33 44 44 GLY GLY A . n A 1 34 SER 34 45 45 SER SER A . n A 1 35 LEU 35 46 46 LEU LEU A . n A 1 36 ILE 36 47 47 ILE ILE A . n A 1 37 SER 37 48 48 SER SER A . n A 1 38 PRO 38 49 49 PRO PRO A . n A 1 39 CYS 39 50 50 CYS CYS A . n A 1 40 TRP 40 51 51 TRP TRP A . n A 1 41 VAL 41 52 52 VAL VAL A . n A 1 42 ILE 42 53 53 ILE ILE A . n A 1 43 SER 43 54 54 SER SER A . n A 1 44 ALA 44 55 55 ALA ALA A . n A 1 45 THR 45 56 56 THR THR A . n A 1 46 HIS 46 57 57 HIS HIS A . n A 1 47 CYS 47 58 58 CYS CYS A . n A 1 48 PHE 48 59 59 PHE PHE A . n A 1 49 ILE 49 60 60 ILE ILE A . n A 1 50 ASP 50 60 60 ASP ASP A A n A 1 51 TYR 51 60 60 TYR TYR A B n A 1 52 PRO 52 60 60 PRO PRO A C n A 1 53 LYS 53 61 61 LYS LYS A . n A 1 54 LYS 54 62 62 LYS LYS A . n A 1 55 GLU 55 62 62 GLU GLU A A n A 1 56 ASP 56 63 63 ASP ASP A . n A 1 57 TYR 57 64 64 TYR TYR A . n A 1 58 ILE 58 65 65 ILE ILE A . n A 1 59 VAL 59 66 66 VAL VAL A . n A 1 60 TYR 60 67 67 TYR TYR A . n A 1 61 LEU 61 68 68 LEU LEU A . n A 1 62 GLY 62 69 69 GLY GLY A . n A 1 63 ARG 63 70 70 ARG ARG A . n A 1 64 SER 64 71 71 SER SER A . n A 1 65 ARG 65 72 72 ARG ARG A . n A 1 66 LEU 66 73 73 LEU LEU A . n A 1 67 ASN 67 74 74 ASN ASN A . n A 1 68 SER 68 75 75 SER SER A . n A 1 69 ASN 69 76 76 ASN ASN A . n A 1 70 THR 70 77 77 THR THR A . n A 1 71 GLN 71 78 78 GLN GLN A . n A 1 72 GLY 72 79 79 GLY GLY A . n A 1 73 GLU 73 80 80 GLU GLU A . n A 1 74 MET 74 81 81 MET MET A . n A 1 75 LYS 75 82 82 LYS LYS A . n A 1 76 PHE 76 83 83 PHE PHE A . n A 1 77 GLU 77 84 84 GLU GLU A . n A 1 78 VAL 78 85 85 VAL VAL A . n A 1 79 GLU 79 86 86 GLU GLU A . n A 1 80 ASN 80 87 87 ASN ASN A . n A 1 81 LEU 81 88 88 LEU LEU A . n A 1 82 ILE 82 89 89 ILE ILE A . n A 1 83 LEU 83 90 90 LEU LEU A . n A 1 84 HIS 84 91 91 HIS HIS A . n A 1 85 LYS 85 92 92 LYS LYS A . n A 1 86 ASP 86 93 93 ASP ASP A . n A 1 87 TYR 87 94 94 TYR TYR A . n A 1 88 SER 88 95 95 SER SER A . n A 1 89 ALA 89 96 96 ALA ALA A . n A 1 90 ASP 90 97 97 ASP ASP A . n A 1 91 THR 91 97 97 THR THR A A n A 1 92 LEU 92 97 97 LEU LEU A B n A 1 93 ALA 93 98 98 ALA ALA A . n A 1 94 HIS 94 99 99 HIS HIS A . n A 1 95 HIS 95 100 100 HIS HIS A . n A 1 96 ASN 96 101 101 ASN ASN A . n A 1 97 ASP 97 102 102 ASP ASP A . n A 1 98 ILE 98 103 103 ILE ILE A . n A 1 99 ALA 99 104 104 ALA ALA A . n A 1 100 LEU 100 105 105 LEU LEU A . n A 1 101 LEU 101 106 106 LEU LEU A . n A 1 102 LYS 102 107 107 LYS LYS A . n A 1 103 ILE 103 108 108 ILE ILE A . n A 1 104 ARG 104 109 109 ARG ARG A . n A 1 105 SER 105 110 110 SER SER A . n A 1 106 LYS 106 110 110 LYS LYS A A n A 1 107 GLU 107 110 110 GLU GLU A B n A 1 108 GLY 108 110 110 GLY GLY A C n A 1 109 ARG 109 110 110 ARG ARG A D n A 1 110 CYS 110 111 111 CYS CYS A . n A 1 111 ALA 111 112 112 ALA ALA A . n A 1 112 GLN 112 113 113 GLN GLN A . n A 1 113 PRO 113 114 114 PRO PRO A . n A 1 114 SER 114 115 115 SER SER A . n A 1 115 ARG 115 116 116 ARG ARG A . n A 1 116 THR 116 117 117 THR THR A . n A 1 117 ILE 117 118 118 ILE ILE A . n A 1 118 GLN 118 119 119 GLN GLN A . n A 1 119 THR 119 120 120 THR THR A . n A 1 120 ILE 120 121 121 ILE ILE A . n A 1 121 ALA 121 122 122 ALA ALA A . n A 1 122 LEU 122 123 123 LEU LEU A . n A 1 123 PRO 123 124 124 PRO PRO A . n A 1 124 SER 124 125 125 SER SER A . n A 1 125 MET 125 126 126 MET MET A . n A 1 126 TYR 126 127 127 TYR TYR A . n A 1 127 ASN 127 128 128 ASN ASN A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 PRO 129 130 130 PRO PRO A . n A 1 130 GLN 130 131 131 GLN GLN A . n A 1 131 PHE 131 132 132 PHE PHE A . n A 1 132 GLY 132 133 133 GLY GLY A . n A 1 133 THR 133 134 134 THR THR A . n A 1 134 SER 134 135 135 SER SER A . n A 1 135 CYS 135 136 136 CYS CYS A . n A 1 136 GLU 136 137 137 GLU GLU A . n A 1 137 ILE 137 138 138 ILE ILE A . n A 1 138 THR 138 139 139 THR THR A . n A 1 139 GLY 139 140 140 GLY GLY A . n A 1 140 PHE 140 141 141 PHE PHE A . n A 1 141 GLY 141 142 142 GLY GLY A . n A 1 142 LYS 142 143 143 LYS LYS A . n A 1 143 GLU 143 144 144 GLU GLU A . n A 1 144 GLN 144 145 145 GLN GLN A . n A 1 145 SER 145 146 146 SER SER A . n A 1 146 THR 146 147 147 THR THR A . n A 1 147 ASP 147 148 148 ASP ASP A . n A 1 148 TYR 148 149 149 TYR TYR A . n A 1 149 LEU 149 150 150 LEU LEU A . n A 1 150 TYR 150 151 151 TYR TYR A . n A 1 151 PRO 151 152 152 PRO PRO A . n A 1 152 GLU 152 153 153 GLU GLU A . n A 1 153 GLN 153 154 154 GLN GLN A . n A 1 154 LEU 154 155 155 LEU LEU A . n A 1 155 LYS 155 156 156 LYS LYS A . n A 1 156 MET 156 157 157 MET MET A . n A 1 157 THR 157 158 158 THR THR A . n A 1 158 VAL 158 159 159 VAL VAL A . n A 1 159 VAL 159 160 160 VAL VAL A . n A 1 160 LYS 160 161 161 LYS LYS A . n A 1 161 LEU 161 162 162 LEU LEU A . n A 1 162 ILE 162 163 163 ILE ILE A . n A 1 163 SER 163 164 164 SER SER A . n A 1 164 HIS 164 165 165 HIS HIS A . n A 1 165 ARG 165 166 166 ARG ARG A . n A 1 166 GLU 166 167 167 GLU GLU A . n A 1 167 CYS 167 168 168 CYS CYS A . n A 1 168 GLN 168 169 169 GLN GLN A . n A 1 169 GLN 169 170 170 GLN GLN A . n A 1 170 PRO 170 170 170 PRO PRO A A n A 1 171 HIS 171 170 170 HIS HIS A B n A 1 172 TYR 172 171 171 TYR TYR A . n A 1 173 TYR 173 172 172 TYR TYR A . n A 1 174 GLY 174 173 173 GLY GLY A . n A 1 175 SER 175 174 174 SER SER A . n A 1 176 GLU 176 175 175 GLU GLU A . n A 1 177 VAL 177 176 176 VAL VAL A . n A 1 178 THR 178 177 177 THR THR A . n A 1 179 THR 179 178 178 THR THR A . n A 1 180 LYS 180 179 179 LYS LYS A . n A 1 181 MET 181 180 180 MET MET A . n A 1 182 LEU 182 181 181 LEU LEU A . n A 1 183 CYS 183 182 182 CYS CYS A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 ALA 185 184 184 ALA ALA A . n A 1 186 ASP 186 185 185 ASP ASP A . n A 1 187 PRO 187 185 185 PRO PRO A A n A 1 188 GLN 188 185 185 GLN GLN A B n A 1 189 TRP 189 186 186 TRP TRP A . n A 1 190 LYS 190 187 187 LYS LYS A . n A 1 191 THR 191 188 188 THR THR A . n A 1 192 ASP 192 189 189 ASP ASP A . n A 1 193 SER 193 190 190 SER SER A . n A 1 194 CYS 194 191 191 CYS CYS A . n A 1 195 GLN 195 192 192 GLN GLN A . n A 1 196 GLY 196 193 193 GLY GLY A . n A 1 197 ASP 197 194 194 ASP ASP A . n A 1 198 SER 198 195 195 SER SER A . n A 1 199 GLY 199 196 196 GLY GLY A . n A 1 200 GLY 200 197 197 GLY GLY A . n A 1 201 PRO 201 198 198 PRO PRO A . n A 1 202 LEU 202 199 199 LEU LEU A . n A 1 203 VAL 203 200 200 VAL VAL A . n A 1 204 CYS 204 201 201 CYS CYS A . n A 1 205 SER 205 202 202 SER SER A . n A 1 206 LEU 206 203 203 LEU LEU A . n A 1 207 GLN 207 204 204 GLN GLN A . n A 1 208 GLY 208 205 205 GLY GLY A . n A 1 209 ARG 209 206 206 ARG ARG A . n A 1 210 MET 210 207 207 MET MET A . n A 1 211 THR 211 208 208 THR THR A . n A 1 212 LEU 212 209 209 LEU LEU A . n A 1 213 THR 213 210 210 THR THR A . n A 1 214 GLY 214 211 211 GLY GLY A . n A 1 215 ILE 215 212 212 ILE ILE A . n A 1 216 VAL 216 213 213 VAL VAL A . n A 1 217 SER 217 214 214 SER SER A . n A 1 218 TRP 218 215 215 TRP TRP A . n A 1 219 GLY 219 216 216 GLY GLY A . n A 1 220 ARG 220 217 217 ARG ARG A . n A 1 221 GLY 221 218 218 GLY GLY A . n A 1 222 CYS 222 220 220 CYS CYS A . n A 1 223 ALA 223 221 221 ALA ALA A . n A 1 224 LEU 224 222 222 LEU LEU A . n A 1 225 LYS 225 223 223 LYS LYS A . n A 1 226 ASP 226 223 223 ASP ASP A A n A 1 227 LYS 227 224 224 LYS LYS A . n A 1 228 PRO 228 225 225 PRO PRO A . n A 1 229 GLY 229 226 226 GLY GLY A . n A 1 230 VAL 230 227 227 VAL VAL A . n A 1 231 TYR 231 228 228 TYR TYR A . n A 1 232 THR 232 229 229 THR THR A . n A 1 233 ARG 233 230 230 ARG ARG A . n A 1 234 VAL 234 231 231 VAL VAL A . n A 1 235 SER 235 232 232 SER SER A . n A 1 236 HIS 236 233 233 HIS HIS A . n A 1 237 PHE 237 234 234 PHE PHE A . n A 1 238 LEU 238 235 235 LEU LEU A . n A 1 239 PRO 239 236 236 PRO PRO A . n A 1 240 TRP 240 237 237 TRP TRP A . n A 1 241 ILE 241 238 238 ILE ILE A . n A 1 242 ARG 242 239 239 ARG ARG A . n A 1 243 SER 243 240 240 SER SER A . n A 1 244 HIS 244 241 241 HIS HIS A . n A 1 245 THR 245 242 242 THR THR A . n B 2 1 GLY 1 1 1 GLY GLY B . n B 2 2 81S 2 2 2 81S B1S B . n B 2 3 ALA 3 3 3 ALA ALA B . n B 2 4 LEU 4 4 4 LEU LEU B . n B 2 5 GLY 5 5 5 GLY GLY B . n B 2 6 ARG 6 6 6 ARG ARG B . n B 2 7 GLY 7 7 7 GLY GLY B . n B 2 8 CYS 8 8 8 CYS CYS B . n B 2 9 GLU 9 9 9 GLU GLU B . n B 2 10 ASN 10 10 10 ASN ASN B . n B 2 11 HIS 11 11 11 HIS HIS B . n B 2 12 ARG 12 12 12 ARG ARG B . n B 2 13 CYS 13 13 13 CYS CYS B . n B 2 14 LEU 14 14 14 LEU LEU B . n B 2 15 NH2 15 15 15 NH2 NH2 B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 301 1 SO4 SO4 A . D 3 SO4 1 302 2 SO4 SO4 A . E 4 ACT 1 303 1 ACT ACT A . F 5 HOH 1 401 1 HOH HOH A . F 5 HOH 2 402 2 HOH HOH A . F 5 HOH 3 403 3 HOH HOH A . F 5 HOH 4 404 4 HOH HOH A . F 5 HOH 5 405 5 HOH HOH A . F 5 HOH 6 406 7 HOH HOH A . F 5 HOH 7 407 8 HOH HOH A . F 5 HOH 8 408 9 HOH HOH A . F 5 HOH 9 409 10 HOH HOH A . F 5 HOH 10 410 11 HOH HOH A . F 5 HOH 11 411 12 HOH HOH A . F 5 HOH 12 412 13 HOH HOH A . F 5 HOH 13 413 14 HOH HOH A . F 5 HOH 14 414 15 HOH HOH A . F 5 HOH 15 415 17 HOH HOH A . F 5 HOH 16 416 18 HOH HOH A . F 5 HOH 17 417 19 HOH HOH A . F 5 HOH 18 418 20 HOH HOH A . F 5 HOH 19 419 21 HOH HOH A . F 5 HOH 20 420 22 HOH HOH A . F 5 HOH 21 421 23 HOH HOH A . F 5 HOH 22 422 24 HOH HOH A . F 5 HOH 23 423 25 HOH HOH A . F 5 HOH 24 424 26 HOH HOH A . F 5 HOH 25 425 27 HOH HOH A . F 5 HOH 26 426 30 HOH HOH A . F 5 HOH 27 427 31 HOH HOH A . F 5 HOH 28 428 32 HOH HOH A . F 5 HOH 29 429 33 HOH HOH A . F 5 HOH 30 430 34 HOH HOH A . F 5 HOH 31 431 35 HOH HOH A . F 5 HOH 32 432 36 HOH HOH A . F 5 HOH 33 433 37 HOH HOH A . F 5 HOH 34 434 38 HOH HOH A . F 5 HOH 35 435 40 HOH HOH A . F 5 HOH 36 436 41 HOH HOH A . F 5 HOH 37 437 42 HOH HOH A . F 5 HOH 38 438 43 HOH HOH A . F 5 HOH 39 439 44 HOH HOH A . F 5 HOH 40 440 45 HOH HOH A . F 5 HOH 41 441 46 HOH HOH A . F 5 HOH 42 442 47 HOH HOH A . F 5 HOH 43 443 48 HOH HOH A . F 5 HOH 44 444 49 HOH HOH A . F 5 HOH 45 445 50 HOH HOH A . F 5 HOH 46 446 52 HOH HOH A . F 5 HOH 47 447 53 HOH HOH A . F 5 HOH 48 448 54 HOH HOH A . F 5 HOH 49 449 55 HOH HOH A . F 5 HOH 50 450 57 HOH HOH A . F 5 HOH 51 451 58 HOH HOH A . F 5 HOH 52 452 59 HOH HOH A . F 5 HOH 53 453 60 HOH HOH A . F 5 HOH 54 454 61 HOH HOH A . F 5 HOH 55 455 62 HOH HOH A . F 5 HOH 56 456 63 HOH HOH A . F 5 HOH 57 457 64 HOH HOH A . F 5 HOH 58 458 65 HOH HOH A . F 5 HOH 59 459 66 HOH HOH A . F 5 HOH 60 460 67 HOH HOH A . F 5 HOH 61 461 69 HOH HOH A . F 5 HOH 62 462 70 HOH HOH A . F 5 HOH 63 463 71 HOH HOH A . F 5 HOH 64 464 72 HOH HOH A . F 5 HOH 65 465 75 HOH HOH A . F 5 HOH 66 466 76 HOH HOH A . F 5 HOH 67 467 77 HOH HOH A . F 5 HOH 68 468 79 HOH HOH A . F 5 HOH 69 469 80 HOH HOH A . F 5 HOH 70 470 81 HOH HOH A . F 5 HOH 71 471 82 HOH HOH A . F 5 HOH 72 472 83 HOH HOH A . F 5 HOH 73 473 84 HOH HOH A . F 5 HOH 74 474 85 HOH HOH A . F 5 HOH 75 475 86 HOH HOH A . F 5 HOH 76 476 87 HOH HOH A . F 5 HOH 77 477 88 HOH HOH A . F 5 HOH 78 478 90 HOH HOH A . F 5 HOH 79 479 91 HOH HOH A . F 5 HOH 80 480 92 HOH HOH A . F 5 HOH 81 481 93 HOH HOH A . F 5 HOH 82 482 94 HOH HOH A . F 5 HOH 83 483 95 HOH HOH A . F 5 HOH 84 484 96 HOH HOH A . F 5 HOH 85 485 97 HOH HOH A . F 5 HOH 86 486 98 HOH HOH A . F 5 HOH 87 487 99 HOH HOH A . F 5 HOH 88 488 102 HOH HOH A . F 5 HOH 89 489 103 HOH HOH A . F 5 HOH 90 490 105 HOH HOH A . F 5 HOH 91 491 106 HOH HOH A . F 5 HOH 92 492 111 HOH HOH A . F 5 HOH 93 493 112 HOH HOH A . F 5 HOH 94 494 113 HOH HOH A . F 5 HOH 95 495 116 HOH HOH A . F 5 HOH 96 496 117 HOH HOH A . F 5 HOH 97 497 118 HOH HOH A . F 5 HOH 98 498 120 HOH HOH A . F 5 HOH 99 499 121 HOH HOH A . F 5 HOH 100 500 122 HOH HOH A . F 5 HOH 101 501 123 HOH HOH A . F 5 HOH 102 502 124 HOH HOH A . F 5 HOH 103 503 125 HOH HOH A . F 5 HOH 104 504 126 HOH HOH A . F 5 HOH 105 505 127 HOH HOH A . F 5 HOH 106 506 131 HOH HOH A . F 5 HOH 107 507 132 HOH HOH A . F 5 HOH 108 508 133 HOH HOH A . F 5 HOH 109 509 135 HOH HOH A . F 5 HOH 110 510 141 HOH HOH A . F 5 HOH 111 511 142 HOH HOH A . F 5 HOH 112 512 143 HOH HOH A . F 5 HOH 113 513 144 HOH HOH A . F 5 HOH 114 514 145 HOH HOH A . F 5 HOH 115 515 146 HOH HOH A . F 5 HOH 116 516 147 HOH HOH A . F 5 HOH 117 517 148 HOH HOH A . F 5 HOH 118 518 149 HOH HOH A . F 5 HOH 119 519 151 HOH HOH A . F 5 HOH 120 520 153 HOH HOH A . F 5 HOH 121 521 154 HOH HOH A . F 5 HOH 122 522 155 HOH HOH A . F 5 HOH 123 523 156 HOH HOH A . F 5 HOH 124 524 158 HOH HOH A . F 5 HOH 125 525 164 HOH HOH A . G 5 HOH 1 101 6 HOH HOH B . G 5 HOH 2 102 16 HOH HOH B . G 5 HOH 3 103 28 HOH HOH B . G 5 HOH 4 104 39 HOH HOH B . G 5 HOH 5 105 128 HOH HOH B . # _pdbx_molecule_features.prd_id PRD_001222 _pdbx_molecule_features.name 'bicyclic peptide UK601 (bicyclic 1)' _pdbx_molecule_features.type 'Cyclic peptide' _pdbx_molecule_features.class Inhibitor _pdbx_molecule_features.details ? # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_001222 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2050 ? 1 MORE -28 ? 1 'SSA (A^2)' 11540 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-09-24 2 'Structure model' 1 1 2014-11-05 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2021-06-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' entity_src_gen 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 2 4 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 3 4 'Structure model' '_struct_conn.pdbx_dist_value' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_ref_seq_dif.details' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHASES phasing . ? 1 REFMAC refinement 5.7.0029 ? 2 XDS 'data reduction' . ? 3 SCALA 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 27 ? ? -143.50 53.00 2 1 VAL A 41 ? ? -104.58 -63.39 3 1 SER A 54 ? ? -149.68 -155.72 4 1 ASP A 97 ? ? -102.57 -167.58 5 1 TYR A 171 ? ? -88.29 -109.09 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 'ACETATE ION' ACT 5 water HOH #