data_4OZS # _entry.id 4OZS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4OZS pdb_00004ozs 10.2210/pdb4ozs/pdb WWPDB D_1000200111 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-22 2 'Structure model' 1 1 2017-11-22 3 'Structure model' 2 0 2018-08-22 4 'Structure model' 2 1 2023-12-27 5 'Structure model' 2 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 2 'Structure model' 'Refinement description' 6 2 'Structure model' 'Source and taxonomy' 7 3 'Structure model' Advisory 8 3 'Structure model' 'Atomic model' 9 3 'Structure model' 'Data collection' 10 3 'Structure model' 'Derived calculations' 11 3 'Structure model' 'Refinement description' 12 4 'Structure model' 'Data collection' 13 4 'Structure model' 'Database references' 14 4 'Structure model' 'Derived calculations' 15 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 2 'Structure model' entity_src_gen 3 2 'Structure model' pdbx_database_status 4 2 'Structure model' pdbx_struct_oper_list 5 2 'Structure model' pdbx_validate_symm_contact 6 2 'Structure model' software 7 3 'Structure model' atom_site 8 3 'Structure model' pdbx_nonpoly_scheme 9 3 'Structure model' pdbx_struct_assembly 10 3 'Structure model' pdbx_struct_assembly_gen 11 3 'Structure model' pdbx_struct_assembly_prop 12 3 'Structure model' pdbx_struct_oper_list 13 3 'Structure model' pdbx_validate_close_contact 14 3 'Structure model' pdbx_validate_symm_contact 15 3 'Structure model' refine_hist 16 3 'Structure model' struct_conn 17 4 'Structure model' chem_comp_atom 18 4 'Structure model' chem_comp_bond 19 4 'Structure model' database_2 20 4 'Structure model' struct_conn 21 5 'Structure model' pdbx_entry_details 22 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 2 'Structure model' '_pdbx_database_status.pdb_format_compatible' 4 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 2 'Structure model' '_pdbx_validate_symm_contact.auth_atom_id_2' 6 2 'Structure model' '_pdbx_validate_symm_contact.dist' 7 2 'Structure model' '_software.classification' 8 3 'Structure model' '_atom_site.B_iso_or_equiv' 9 3 'Structure model' '_atom_site.Cartn_x' 10 3 'Structure model' '_atom_site.Cartn_y' 11 3 'Structure model' '_atom_site.Cartn_z' 12 3 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 13 3 'Structure model' '_pdbx_struct_assembly.details' 14 3 'Structure model' '_pdbx_struct_assembly.method_details' 15 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 16 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 17 3 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 18 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 19 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 20 3 'Structure model' '_refine_hist.number_atoms_solvent' 21 3 'Structure model' '_refine_hist.number_atoms_total' 22 3 'Structure model' '_refine_hist.pdbx_number_atoms_ligand' 23 3 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 24 3 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 25 4 'Structure model' '_database_2.pdbx_DOI' 26 4 'Structure model' '_database_2.pdbx_database_accession' 27 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4OZS _pdbx_database_status.recvd_initial_deposition_date 2014-02-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gully, B.S.' 1 'Bond, C.S.' 2 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher ? _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country US _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_id_ASTM ABCRE6 _citation.journal_id_CSD ? _citation.journal_id_ISSN 1399-0047 _citation.journal_full . _citation.journal_issue . _citation.journal_volume 71 _citation.language . _citation.page_first 196 _citation.page_last 208 _citation.title 'The design and structural characterization of a synthetic pentatricopeptide repeat protein.' _citation.year 2015 _citation.database_id_CSD . _citation.pdbx_database_id_DOI 10.1107/S1399004714024869 _citation.pdbx_database_id_PubMed 25664731 _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gully, B.S.' 1 ? primary 'Shah, K.R.' 2 ? primary 'Lee, M.' 3 ? primary 'Shearston, K.' 4 ? primary 'Smith, N.M.' 5 ? primary 'Sadowska, A.' 6 ? primary 'Blythe, A.J.' 7 ? primary 'Bernath-Levin, K.' 8 ? primary 'Stanley, W.A.' 9 ? primary 'Small, I.D.' 10 ? primary 'Bond, C.S.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Alpha solenoid protein' 19480.521 1 ? ? ? ? 2 water nat water 18.015 45 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DVVTYNTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLID GLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLIDGLAKAGRLEE ALQLFQEMKEKGVKP ; _entity_poly.pdbx_seq_one_letter_code_can ;DVVTYNTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLID GLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLIDGLAKAGRLEEALQLFQEMKEKGVKPDVVTYNTLIDGLAKAGRLEE ALQLFQEMKEKGVKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 VAL n 1 3 VAL n 1 4 THR n 1 5 TYR n 1 6 ASN n 1 7 THR n 1 8 LEU n 1 9 ILE n 1 10 ASP n 1 11 GLY n 1 12 LEU n 1 13 ALA n 1 14 LYS n 1 15 ALA n 1 16 GLY n 1 17 ARG n 1 18 LEU n 1 19 GLU n 1 20 GLU n 1 21 ALA n 1 22 LEU n 1 23 GLN n 1 24 LEU n 1 25 PHE n 1 26 GLN n 1 27 GLU n 1 28 MET n 1 29 LYS n 1 30 GLU n 1 31 LYS n 1 32 GLY n 1 33 VAL n 1 34 LYS n 1 35 PRO n 1 36 ASP n 1 37 VAL n 1 38 VAL n 1 39 THR n 1 40 TYR n 1 41 ASN n 1 42 THR n 1 43 LEU n 1 44 ILE n 1 45 ASP n 1 46 GLY n 1 47 LEU n 1 48 ALA n 1 49 LYS n 1 50 ALA n 1 51 GLY n 1 52 ARG n 1 53 LEU n 1 54 GLU n 1 55 GLU n 1 56 ALA n 1 57 LEU n 1 58 GLN n 1 59 LEU n 1 60 PHE n 1 61 GLN n 1 62 GLU n 1 63 MET n 1 64 LYS n 1 65 GLU n 1 66 LYS n 1 67 GLY n 1 68 VAL n 1 69 LYS n 1 70 PRO n 1 71 ASP n 1 72 VAL n 1 73 VAL n 1 74 THR n 1 75 TYR n 1 76 ASN n 1 77 THR n 1 78 LEU n 1 79 ILE n 1 80 ASP n 1 81 GLY n 1 82 LEU n 1 83 ALA n 1 84 LYS n 1 85 ALA n 1 86 GLY n 1 87 ARG n 1 88 LEU n 1 89 GLU n 1 90 GLU n 1 91 ALA n 1 92 LEU n 1 93 GLN n 1 94 LEU n 1 95 PHE n 1 96 GLN n 1 97 GLU n 1 98 MET n 1 99 LYS n 1 100 GLU n 1 101 LYS n 1 102 GLY n 1 103 VAL n 1 104 LYS n 1 105 PRO n 1 106 ASP n 1 107 VAL n 1 108 VAL n 1 109 THR n 1 110 TYR n 1 111 ASN n 1 112 THR n 1 113 LEU n 1 114 ILE n 1 115 ASP n 1 116 GLY n 1 117 LEU n 1 118 ALA n 1 119 LYS n 1 120 ALA n 1 121 GLY n 1 122 ARG n 1 123 LEU n 1 124 GLU n 1 125 GLU n 1 126 ALA n 1 127 LEU n 1 128 GLN n 1 129 LEU n 1 130 PHE n 1 131 GLN n 1 132 GLU n 1 133 MET n 1 134 LYS n 1 135 GLU n 1 136 LYS n 1 137 GLY n 1 138 VAL n 1 139 LYS n 1 140 PRO n 1 141 ASP n 1 142 VAL n 1 143 VAL n 1 144 THR n 1 145 TYR n 1 146 ASN n 1 147 THR n 1 148 LEU n 1 149 ILE n 1 150 ASP n 1 151 GLY n 1 152 LEU n 1 153 ALA n 1 154 LYS n 1 155 ALA n 1 156 GLY n 1 157 ARG n 1 158 LEU n 1 159 GLU n 1 160 GLU n 1 161 ALA n 1 162 LEU n 1 163 GLN n 1 164 LEU n 1 165 PHE n 1 166 GLN n 1 167 GLU n 1 168 MET n 1 169 LYS n 1 170 GLU n 1 171 LYS n 1 172 GLY n 1 173 VAL n 1 174 LYS n 1 175 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 175 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 TYR 40 40 40 TYR TYR A A n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 MET 168 168 168 MET MET A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 PRO 175 175 175 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 182 HOH HOH A . B 2 HOH 2 202 181 HOH HOH A . B 2 HOH 3 203 180 HOH HOH A . B 2 HOH 4 204 204 HOH HOH A . B 2 HOH 5 205 199 HOH HOH A . B 2 HOH 6 206 187 HOH HOH A . B 2 HOH 7 207 178 HOH HOH A . B 2 HOH 8 208 184 HOH HOH A . B 2 HOH 9 209 177 HOH HOH A . B 2 HOH 10 210 185 HOH HOH A . B 2 HOH 11 211 183 HOH HOH A . B 2 HOH 12 212 211 HOH HOH A . B 2 HOH 13 213 209 HOH HOH A . B 2 HOH 14 214 210 HOH HOH A . B 2 HOH 15 215 186 HOH HOH A . B 2 HOH 16 216 189 HOH HOH A . B 2 HOH 17 217 193 HOH HOH A . B 2 HOH 18 218 212 HOH HOH A . B 2 HOH 19 219 192 HOH HOH A . B 2 HOH 20 220 179 HOH HOH A . B 2 HOH 21 221 214 HOH HOH A . B 2 HOH 22 222 207 HOH HOH A . B 2 HOH 23 223 197 HOH HOH A . B 2 HOH 24 224 219 HOH HOH A . B 2 HOH 25 225 215 HOH HOH A . B 2 HOH 26 226 196 HOH HOH A . B 2 HOH 27 227 191 HOH HOH A . B 2 HOH 28 228 203 HOH HOH A . B 2 HOH 29 229 188 HOH HOH A . B 2 HOH 30 230 190 HOH HOH A . B 2 HOH 31 231 206 HOH HOH A . B 2 HOH 32 232 222 HOH HOH A . B 2 HOH 33 233 208 HOH HOH A . B 2 HOH 34 234 198 HOH HOH A . B 2 HOH 35 235 216 HOH HOH A . B 2 HOH 36 236 220 HOH HOH A . B 2 HOH 37 237 202 HOH HOH A . B 2 HOH 38 238 221 HOH HOH A . B 2 HOH 39 239 213 HOH HOH A . B 2 HOH 40 240 195 HOH HOH A . B 2 HOH 41 241 205 HOH HOH A . B 2 HOH 42 242 201 HOH HOH A . B 2 HOH 43 243 200 HOH HOH A . B 2 HOH 44 244 218 HOH HOH A . B 2 HOH 45 245 217 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.6.0117 1 ? 'data scaling' . . . . . . . . . . . XDS . . . . 2 ? 'data scaling' . . . . . . . . . . . SCALA . . . . 3 ? phasing . . . . . . . . . . . PHENIX . . . . 4 ? refinement . . . . . . . . . . . PHENIX . . . . 5 ? 'data extraction' . . . . . . . . . . . PDB_EXTRACT . . . 3.14 6 # _cell.entry_id 4OZS _cell.length_a 54.025 _cell.length_b 75.023 _cell.length_c 85.117 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4OZS _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4OZS _exptl.crystals_number 1 _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 4.43 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 72.22 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH 3.35 _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details ;Diffraction quality crystals grew from 3 uL drops in 24-well sitting drop Cryschem plates (Hampton Research) in 2:1 ratios of crystallant 100 mM Sodium citrate pH 3.35, 8 % (w/v) PEG 3350 and protein equilibrated against 1 mL of crystallant at 293 K. ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2013-07-05 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l . _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.980 1.0 2 0.954 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list '0.980, 0.954' _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate . _reflns.entry_id 4OZS _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 2.17 _reflns.d_resolution_low 56.28 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all 37530 _reflns.number_obs 18791 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F . _reflns.observed_criterion_sigma_I . _reflns.percent_possible_obs 99.78 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 2.0 _reflns.pdbx_Rmerge_I_obs 0.01873 _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value . _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 24.44 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.17 _reflns_shell.d_res_low 2.25 _reflns_shell.meanI_over_sigI_all . _reflns_shell.meanI_over_sigI_obs 2.68 _reflns_shell.number_measured_all . _reflns_shell.number_measured_obs . _reflns_shell.number_possible . _reflns_shell.number_unique_all . _reflns_shell.number_unique_obs . _reflns_shell.percent_possible_all 98.43 _reflns_shell.percent_possible_obs . _reflns_shell.Rmerge_F_all . _reflns_shell.Rmerge_F_obs . _reflns_shell.Rmerge_I_all . _reflns_shell.Rmerge_I_obs 0.3134 _reflns_shell.meanI_over_sigI_gt . _reflns_shell.meanI_over_uI_all . _reflns_shell.meanI_over_uI_gt . _reflns_shell.number_measured_gt . _reflns_shell.number_unique_gt . _reflns_shell.percent_possible_gt . _reflns_shell.Rmerge_F_gt . _reflns_shell.Rmerge_I_gt . _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_Rsym_value . _reflns_shell.pdbx_chi_squared . _reflns_shell.pdbx_netI_over_sigmaI_all . _reflns_shell.pdbx_netI_over_sigmaI_obs . _reflns_shell.pdbx_Rrim_I_all . _reflns_shell.pdbx_Rpim_I_all . _reflns_shell.pdbx_rejects . _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4OZS _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 17825 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 56.28 _refine.ls_d_res_high 2.17 _refine.ls_percent_reflns_obs 99.77 _refine.ls_R_factor_obs 0.21933 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21691 _refine.ls_R_factor_R_free 0.26549 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 966 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.938 _refine.B_iso_mean 53.438 _refine.aniso_B[1][1] 0.85 _refine.aniso_B[2][2] -0.99 _refine.aniso_B[3][3] 0.14 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.164 _refine.pdbx_overall_ESU_R_Free 0.166 _refine.overall_SU_ML 0.127 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 5.134 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1365 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 1410 _refine_hist.d_res_high 2.17 _refine_hist.d_res_low 56.28 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.021 0.020 ? 1386 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.442 2.012 ? 1863 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.539 5.000 ? 176 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 44.576 26.721 ? 61 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.679 15.000 ? 282 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 7.426 15.000 ? 5 'X-RAY DIFFRACTION' ? r_chiral_restr 0.154 0.200 ? 216 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.021 ? 1004 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.17 _refine_ls_shell.d_res_low 2.229 _refine_ls_shell.number_reflns_R_work 1155 _refine_ls_shell.R_factor_R_work 0.289 _refine_ls_shell.percent_reflns_obs 97.67 _refine_ls_shell.R_factor_R_free 0.289 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 59 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 4OZS _struct.title 'RNA binding protein' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4OZS _struct_keywords.text 'RNA, Specificity, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 4OZS _struct_ref.pdbx_db_accession 4OZS _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4OZS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 175 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 4OZS _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 175 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 175 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+3/2,-y,z+1/2 -1.0000000000 0.0000000000 0.0000000000 81.0375000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 42.5585000000 3 'crystal symmetry operation' 2_654 -x+3/2,-y,z-1/2 -1.0000000000 0.0000000000 0.0000000000 81.0375000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -42.5585000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 1 ? ALA A 15 ? ASP A 1 ALA A 15 1 ? 15 HELX_P HELX_P2 AA2 ARG A 17 ? LYS A 31 ? ARG A 17 LYS A 31 1 ? 15 HELX_P HELX_P3 AA3 ASP A 36 ? ALA A 50 ? ASP A 36 ALA A 50 1 ? 15 HELX_P HELX_P4 AA4 ARG A 52 ? LYS A 66 ? ARG A 52 LYS A 66 1 ? 15 HELX_P HELX_P5 AA5 ASP A 71 ? ALA A 85 ? ASP A 71 ALA A 85 1 ? 15 HELX_P HELX_P6 AA6 ARG A 87 ? LYS A 101 ? ARG A 87 LYS A 101 1 ? 15 HELX_P HELX_P7 AA7 ASP A 106 ? ALA A 120 ? ASP A 106 ALA A 120 1 ? 15 HELX_P HELX_P8 AA8 ARG A 122 ? LYS A 136 ? ARG A 122 LYS A 136 1 ? 15 HELX_P HELX_P9 AA9 ASP A 141 ? ALA A 155 ? ASP A 141 ALA A 155 1 ? 15 HELX_P HELX_P10 AB1 ARG A 157 ? LYS A 171 ? ARG A 157 LYS A 171 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id PRO _struct_conn.ptnr2_label_seq_id 175 _struct_conn.ptnr2_label_atom_id C _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PRO _struct_conn.ptnr2_auth_seq_id 175 _struct_conn.ptnr2_symmetry 2_654 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.742 _struct_conn.pdbx_value_order sing _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ASP _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id PRO _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 175 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id ASP _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id PRO _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 175 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 2_654 _pdbx_modification_feature.comp_id_linking_atom N _pdbx_modification_feature.modified_residue_id_linking_atom C _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # _pdbx_entry_details.entry_id 4OZS _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 231 ? ? O A HOH 243 ? ? 2.11 2 1 OE2 A GLU 55 ? ? O A HOH 201 ? ? 2.11 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 N _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 1 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 PRO _pdbx_validate_symm_contact.auth_seq_id_2 175 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_654 _pdbx_validate_symm_contact.dist 2.14 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 90 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 90 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.320 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.068 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 28 ? ? SD A MET 28 ? ? CE A MET 28 ? ? 88.36 100.20 -11.84 1.60 N 2 1 CG A MET 63 ? ? SD A MET 63 ? ? CE A MET 63 ? ? 90.49 100.20 -9.71 1.60 N 3 1 CG A MET 98 ? ? SD A MET 98 ? ? CE A MET 98 ? ? 90.57 100.20 -9.63 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 36 ? ? -122.47 -167.18 2 1 PRO A 140 ? ? -57.57 -172.57 3 1 THR A 144 ? ? -62.32 -75.84 4 1 TYR A 145 ? ? -23.70 -57.70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 PRO N N N N 238 PRO CA C N S 239 PRO C C N N 240 PRO O O N N 241 PRO CB C N N 242 PRO CG C N N 243 PRO CD C N N 244 PRO OXT O N N 245 PRO H H N N 246 PRO HA H N N 247 PRO HB2 H N N 248 PRO HB3 H N N 249 PRO HG2 H N N 250 PRO HG3 H N N 251 PRO HD2 H N N 252 PRO HD3 H N N 253 PRO HXT H N N 254 THR N N N N 255 THR CA C N S 256 THR C C N N 257 THR O O N N 258 THR CB C N R 259 THR OG1 O N N 260 THR CG2 C N N 261 THR OXT O N N 262 THR H H N N 263 THR H2 H N N 264 THR HA H N N 265 THR HB H N N 266 THR HG1 H N N 267 THR HG21 H N N 268 THR HG22 H N N 269 THR HG23 H N N 270 THR HXT H N N 271 TYR N N N N 272 TYR CA C N S 273 TYR C C N N 274 TYR O O N N 275 TYR CB C N N 276 TYR CG C Y N 277 TYR CD1 C Y N 278 TYR CD2 C Y N 279 TYR CE1 C Y N 280 TYR CE2 C Y N 281 TYR CZ C Y N 282 TYR OH O N N 283 TYR OXT O N N 284 TYR H H N N 285 TYR H2 H N N 286 TYR HA H N N 287 TYR HB2 H N N 288 TYR HB3 H N N 289 TYR HD1 H N N 290 TYR HD2 H N N 291 TYR HE1 H N N 292 TYR HE2 H N N 293 TYR HH H N N 294 TYR HXT H N N 295 VAL N N N N 296 VAL CA C N S 297 VAL C C N N 298 VAL O O N N 299 VAL CB C N N 300 VAL CG1 C N N 301 VAL CG2 C N N 302 VAL OXT O N N 303 VAL H H N N 304 VAL H2 H N N 305 VAL HA H N N 306 VAL HB H N N 307 VAL HG11 H N N 308 VAL HG12 H N N 309 VAL HG13 H N N 310 VAL HG21 H N N 311 VAL HG22 H N N 312 VAL HG23 H N N 313 VAL HXT H N N 314 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 THR N CA sing N N 243 THR N H sing N N 244 THR N H2 sing N N 245 THR CA C sing N N 246 THR CA CB sing N N 247 THR CA HA sing N N 248 THR C O doub N N 249 THR C OXT sing N N 250 THR CB OG1 sing N N 251 THR CB CG2 sing N N 252 THR CB HB sing N N 253 THR OG1 HG1 sing N N 254 THR CG2 HG21 sing N N 255 THR CG2 HG22 sing N N 256 THR CG2 HG23 sing N N 257 THR OXT HXT sing N N 258 TYR N CA sing N N 259 TYR N H sing N N 260 TYR N H2 sing N N 261 TYR CA C sing N N 262 TYR CA CB sing N N 263 TYR CA HA sing N N 264 TYR C O doub N N 265 TYR C OXT sing N N 266 TYR CB CG sing N N 267 TYR CB HB2 sing N N 268 TYR CB HB3 sing N N 269 TYR CG CD1 doub Y N 270 TYR CG CD2 sing Y N 271 TYR CD1 CE1 sing Y N 272 TYR CD1 HD1 sing N N 273 TYR CD2 CE2 doub Y N 274 TYR CD2 HD2 sing N N 275 TYR CE1 CZ doub Y N 276 TYR CE1 HE1 sing N N 277 TYR CE2 CZ sing Y N 278 TYR CE2 HE2 sing N N 279 TYR CZ OH sing N N 280 TYR OH HH sing N N 281 TYR OXT HXT sing N N 282 VAL N CA sing N N 283 VAL N H sing N N 284 VAL N H2 sing N N 285 VAL CA C sing N N 286 VAL CA CB sing N N 287 VAL CA HA sing N N 288 VAL C O doub N N 289 VAL C OXT sing N N 290 VAL CB CG1 sing N N 291 VAL CB CG2 sing N N 292 VAL CB HB sing N N 293 VAL CG1 HG11 sing N N 294 VAL CG1 HG12 sing N N 295 VAL CG1 HG13 sing N N 296 VAL CG2 HG21 sing N N 297 VAL CG2 HG22 sing N N 298 VAL CG2 HG23 sing N N 299 VAL OXT HXT sing N N 300 # _atom_sites.entry_id 4OZS _atom_sites.fract_transf_matrix[1][1] 0.018510 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013329 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011749 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_