data_4P9E # _entry.id 4P9E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4P9E pdb_00004p9e 10.2210/pdb4p9e/pdb WWPDB D_1000200964 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-11-26 2 'Structure model' 1 1 2014-12-03 3 'Structure model' 1 2 2015-01-14 4 'Structure model' 1 3 2017-11-22 5 'Structure model' 1 4 2023-09-27 6 'Structure model' 1 5 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Refinement description' 7 4 'Structure model' 'Source and taxonomy' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' 11 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' entity_src_gen 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' software 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_initial_refinement_model 10 5 'Structure model' refine_hist 11 6 'Structure model' pdbx_entry_details 12 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 4 'Structure model' '_software.classification' 6 5 'Structure model' '_database_2.pdbx_DOI' 7 5 'Structure model' '_database_2.pdbx_database_accession' 8 5 'Structure model' '_refine_hist.number_atoms_solvent' 9 5 'Structure model' '_refine_hist.number_atoms_total' 10 5 'Structure model' '_refine_hist.pdbx_number_atoms_ligand' 11 5 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 12 5 'Structure model' '_refine_hist.pdbx_number_atoms_protein' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4P9E _pdbx_database_status.recvd_initial_deposition_date 2014-04-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4P9D PDB . unspecified 4P9C PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marx, A.' 1 'Alian, A.' 2 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher ? _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country US _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full . _citation.journal_issue . _citation.journal_volume 290 _citation.language . _citation.page_first 682 _citation.page_last 690 _citation.title 'The First Crystal Structure of a dTTP-bound Deoxycytidylate Deaminase Validates and Details the Allosteric-Inhibitor Binding Site.' _citation.year 2015 _citation.database_id_CSD . _citation.pdbx_database_id_DOI 10.1074/jbc.M114.617720 _citation.pdbx_database_id_PubMed 25404739 _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marx, A.' 1 ? primary 'Alian, A.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Deoxycytidylate deaminase' 15191.383 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMKPEIKEAYMKTAELFSQVSNCKRMKVGAIVVKNGSILAHGWNGTPSGFHTNCCELEDGSTNPFVLHAEQNALVKMA KSSESIDGSELFCTHSPCPDCSKMIAQAGVKKVYYRNEYRITDGIDVLQQLGVEVEKM ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMKPEIKEAYMKTAELFSQVSNCKRMKVGAIVVKNGSILAHGWNGTPSGFHTNCCELEDGSTNPFVLHAEQNALVKMA KSSESIDGSELFCTHSPCPDCSKMIAQAGVKKVYYRNEYRITDGIDVLQQLGVEVEKM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 LYS n 1 6 PRO n 1 7 GLU n 1 8 ILE n 1 9 LYS n 1 10 GLU n 1 11 ALA n 1 12 TYR n 1 13 MET n 1 14 LYS n 1 15 THR n 1 16 ALA n 1 17 GLU n 1 18 LEU n 1 19 PHE n 1 20 SER n 1 21 GLN n 1 22 VAL n 1 23 SER n 1 24 ASN n 1 25 CYS n 1 26 LYS n 1 27 ARG n 1 28 MET n 1 29 LYS n 1 30 VAL n 1 31 GLY n 1 32 ALA n 1 33 ILE n 1 34 VAL n 1 35 VAL n 1 36 LYS n 1 37 ASN n 1 38 GLY n 1 39 SER n 1 40 ILE n 1 41 LEU n 1 42 ALA n 1 43 HIS n 1 44 GLY n 1 45 TRP n 1 46 ASN n 1 47 GLY n 1 48 THR n 1 49 PRO n 1 50 SER n 1 51 GLY n 1 52 PHE n 1 53 HIS n 1 54 THR n 1 55 ASN n 1 56 CYS n 1 57 CYS n 1 58 GLU n 1 59 LEU n 1 60 GLU n 1 61 ASP n 1 62 GLY n 1 63 SER n 1 64 THR n 1 65 ASN n 1 66 PRO n 1 67 PHE n 1 68 VAL n 1 69 LEU n 1 70 HIS n 1 71 ALA n 1 72 GLU n 1 73 GLN n 1 74 ASN n 1 75 ALA n 1 76 LEU n 1 77 VAL n 1 78 LYS n 1 79 MET n 1 80 ALA n 1 81 LYS n 1 82 SER n 1 83 SER n 1 84 GLU n 1 85 SER n 1 86 ILE n 1 87 ASP n 1 88 GLY n 1 89 SER n 1 90 GLU n 1 91 LEU n 1 92 PHE n 1 93 CYS n 1 94 THR n 1 95 HIS n 1 96 SER n 1 97 PRO n 1 98 CYS n 1 99 PRO n 1 100 ASP n 1 101 CYS n 1 102 SER n 1 103 LYS n 1 104 MET n 1 105 ILE n 1 106 ALA n 1 107 GLN n 1 108 ALA n 1 109 GLY n 1 110 VAL n 1 111 LYS n 1 112 LYS n 1 113 VAL n 1 114 TYR n 1 115 TYR n 1 116 ARG n 1 117 ASN n 1 118 GLU n 1 119 TYR n 1 120 ARG n 1 121 ILE n 1 122 THR n 1 123 ASP n 1 124 GLY n 1 125 ILE n 1 126 ASP n 1 127 VAL n 1 128 LEU n 1 129 GLN n 1 130 GLN n 1 131 LEU n 1 132 GLY n 1 133 VAL n 1 134 GLU n 1 135 VAL n 1 136 GLU n 1 137 LYS n 1 138 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cyanophage S-TIM5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1137745 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 LYS 5 2 2 LYS LYS A . n A 1 6 PRO 6 3 3 PRO PRO A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 LYS 9 6 6 LYS LYS A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 ALA 11 8 8 ALA ALA A . n A 1 12 TYR 12 9 9 TYR TYR A . n A 1 13 MET 13 10 10 MET MET A . n A 1 14 LYS 14 11 11 LYS LYS A . n A 1 15 THR 15 12 12 THR THR A . n A 1 16 ALA 16 13 13 ALA ALA A . n A 1 17 GLU 17 14 14 GLU GLU A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 PHE 19 16 16 PHE PHE A . n A 1 20 SER 20 17 17 SER SER A . n A 1 21 GLN 21 18 18 GLN GLN A . n A 1 22 VAL 22 19 19 VAL VAL A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 ASN 24 21 21 ASN ASN A . n A 1 25 CYS 25 22 22 CYS CYS A . n A 1 26 LYS 26 23 23 LYS LYS A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 MET 28 25 25 MET MET A . n A 1 29 LYS 29 26 26 LYS LYS A . n A 1 30 VAL 30 27 27 VAL VAL A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 ILE 33 30 30 ILE ILE A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 VAL 35 32 32 VAL VAL A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 ASN 37 34 34 ASN ASN A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 ILE 40 37 37 ILE ILE A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 ALA 42 39 39 ALA ALA A . n A 1 43 HIS 43 40 40 HIS HIS A . n A 1 44 GLY 44 41 41 GLY GLY A . n A 1 45 TRP 45 42 42 TRP TRP A . n A 1 46 ASN 46 43 43 ASN ASN A . n A 1 47 GLY 47 44 44 GLY GLY A . n A 1 48 THR 48 45 45 THR THR A . n A 1 49 PRO 49 46 46 PRO PRO A . n A 1 50 SER 50 47 47 SER SER A . n A 1 51 GLY 51 48 48 GLY GLY A . n A 1 52 PHE 52 49 49 PHE PHE A . n A 1 53 HIS 53 50 50 HIS HIS A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 ASN 55 52 52 ASN ASN A . n A 1 56 CYS 56 53 53 CYS CYS A . n A 1 57 CYS 57 54 54 CYS CYS A . n A 1 58 GLU 58 55 ? ? ? A . n A 1 59 LEU 59 56 ? ? ? A . n A 1 60 GLU 60 57 ? ? ? A . n A 1 61 ASP 61 58 ? ? ? A . n A 1 62 GLY 62 59 ? ? ? A . n A 1 63 SER 63 60 ? ? ? A . n A 1 64 THR 64 61 61 THR THR A . n A 1 65 ASN 65 62 62 ASN ASN A . n A 1 66 PRO 66 63 63 PRO PRO A . n A 1 67 PHE 67 64 64 PHE PHE A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 LEU 69 66 66 LEU LEU A . n A 1 70 HIS 70 67 67 HIS HIS A . n A 1 71 ALA 71 68 68 ALA ALA A . n A 1 72 GLU 72 69 69 GLU GLU A . n A 1 73 GLN 73 70 70 GLN GLN A . n A 1 74 ASN 74 71 71 ASN ASN A . n A 1 75 ALA 75 72 72 ALA ALA A . n A 1 76 LEU 76 73 73 LEU LEU A . n A 1 77 VAL 77 74 74 VAL VAL A . n A 1 78 LYS 78 75 75 LYS LYS A . n A 1 79 MET 79 76 76 MET MET A . n A 1 80 ALA 80 77 77 ALA ALA A . n A 1 81 LYS 81 78 78 LYS LYS A . n A 1 82 SER 82 79 79 SER SER A . n A 1 83 SER 83 80 80 SER SER A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 SER 85 82 82 SER SER A . n A 1 86 ILE 86 83 83 ILE ILE A . n A 1 87 ASP 87 84 84 ASP ASP A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 SER 89 86 86 SER SER A . n A 1 90 GLU 90 87 87 GLU GLU A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 CYS 93 90 90 CYS CYS A . n A 1 94 THR 94 91 91 THR THR A . n A 1 95 HIS 95 92 92 HIS HIS A . n A 1 96 SER 96 93 93 SER SER A . n A 1 97 PRO 97 94 94 PRO PRO A . n A 1 98 CYS 98 95 95 CYS CYS A . n A 1 99 PRO 99 96 96 PRO PRO A . n A 1 100 ASP 100 97 97 ASP ASP A . n A 1 101 CYS 101 98 98 CYS CYS A . n A 1 102 SER 102 99 99 SER SER A . n A 1 103 LYS 103 100 100 LYS LYS A . n A 1 104 MET 104 101 101 MET MET A . n A 1 105 ILE 105 102 102 ILE ILE A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 GLN 107 104 104 GLN GLN A . n A 1 108 ALA 108 105 105 ALA ALA A . n A 1 109 GLY 109 106 106 GLY GLY A . n A 1 110 VAL 110 107 107 VAL VAL A . n A 1 111 LYS 111 108 108 LYS LYS A . n A 1 112 LYS 112 109 109 LYS LYS A . n A 1 113 VAL 113 110 110 VAL VAL A . n A 1 114 TYR 114 111 111 TYR TYR A . n A 1 115 TYR 115 112 112 TYR TYR A . n A 1 116 ARG 116 113 113 ARG ARG A . n A 1 117 ASN 117 114 114 ASN ASN A . n A 1 118 GLU 118 115 115 GLU GLU A . n A 1 119 TYR 119 116 ? ? ? A . n A 1 120 ARG 120 117 ? ? ? A . n A 1 121 ILE 121 118 ? ? ? A . n A 1 122 THR 122 119 119 THR THR A . n A 1 123 ASP 123 120 120 ASP ASP A . n A 1 124 GLY 124 121 121 GLY GLY A . n A 1 125 ILE 125 122 122 ILE ILE A . n A 1 126 ASP 126 123 123 ASP ASP A . n A 1 127 VAL 127 124 124 VAL VAL A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 GLN 129 126 126 GLN GLN A . n A 1 130 GLN 130 127 127 GLN GLN A . n A 1 131 LEU 131 128 128 LEU LEU A . n A 1 132 GLY 132 129 129 GLY GLY A . n A 1 133 VAL 133 130 130 VAL VAL A . n A 1 134 GLU 134 131 131 GLU GLU A . n A 1 135 VAL 135 132 132 VAL VAL A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 LYS 137 134 134 LYS LYS A . n A 1 138 MET 138 135 135 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1111 ZN ZN A . C 3 CL 1 202 3333 CL CL A . D 4 HOH 1 301 11 HOH HOH A . D 4 HOH 2 302 6 HOH HOH A . D 4 HOH 3 303 3 HOH HOH A . D 4 HOH 4 304 10 HOH HOH A . D 4 HOH 5 305 1 HOH HOH A . D 4 HOH 6 306 14 HOH HOH A . D 4 HOH 7 307 12 HOH HOH A . D 4 HOH 8 308 2 HOH HOH A . D 4 HOH 9 309 4 HOH HOH A . D 4 HOH 10 310 5 HOH HOH A . D 4 HOH 11 311 7 HOH HOH A . D 4 HOH 12 312 8 HOH HOH A . D 4 HOH 13 313 9 HOH HOH A . D 4 HOH 14 314 13 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' . . . . . . . . . . . SCALA . . . . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.5.0109 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 # _cell.entry_id 4P9E _cell.length_a 78.130 _cell.length_b 78.130 _cell.length_c 80.560 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4P9E _symmetry.cell_setting . _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall . _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M . # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4P9E _exptl.crystals_number . _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 47.35 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH . _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details '1.8M Malic acid pH 7' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2012-07-15 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.Friedel_coverage ? _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 50 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.details ? _reflns.entry_id 4P9E _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_gt ? _reflns.number_obs 4840 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rmerge_I_obs 0.070 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_chi_squared ? _reflns.pdbx_d_opt ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23 _reflns.pdbx_number_measured_all ? _reflns.pdbx_ordinal 1 _reflns.pdbx_redundancy 10.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_scaling_rejects ? _reflns.percent_possible_obs 100 _reflns.phase_calculation_details ? _reflns.threshold_expression ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 8.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs . _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.283 _reflns_shell.meanI_over_sigI_gt . _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt . _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt . _reflns_shell.pdbx_redundancy 11.4 _reflns_shell.pdbx_Rsym_value . _reflns_shell.pdbx_chi_squared . _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all . _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.aniso_B[1][1] 0.04 _refine.aniso_B[1][2] 0.02 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.04 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.06 _refine.B_iso_max . _refine.B_iso_mean 51.339 _refine.B_iso_min . _refine.correlation_coeff_Fo_to_Fc 0.936 _refine.correlation_coeff_Fo_to_Fc_free 0.902 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max . _refine.diff_density_max_esd . _refine.diff_density_min . _refine.diff_density_min_esd . _refine.diff_density_rms . _refine.diff_density_rms_esd . _refine.entry_id 4P9E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details . _refine.ls_abs_structure_Flack . _refine.ls_abs_structure_Flack_esd . _refine.ls_abs_structure_Rogers . _refine.ls_abs_structure_Rogers_esd . _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 67.66 _refine.ls_extinction_coef . _refine.ls_extinction_coef_esd . _refine.ls_extinction_expression . _refine.ls_extinction_method . _refine.ls_goodness_of_fit_all . _refine.ls_goodness_of_fit_all_esd . _refine.ls_goodness_of_fit_obs . _refine.ls_goodness_of_fit_obs_esd . _refine.ls_hydrogen_treatment . _refine.ls_matrix_type . _refine.ls_number_constraints . _refine.ls_number_parameters . _refine.ls_number_reflns_all . _refine.ls_number_reflns_obs 4591 _refine.ls_number_reflns_R_free 224 _refine.ls_number_reflns_R_work . _refine.ls_number_restraints . _refine.ls_percent_reflns_obs 99.67 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all . _refine.ls_R_factor_obs 0.21466 _refine.ls_R_factor_R_free 0.27163 _refine.ls_R_factor_R_free_error . _refine.ls_R_factor_R_free_error_details . _refine.ls_R_factor_R_work 0.21229 _refine.ls_R_Fsqd_factor_obs . _refine.ls_R_I_factor_obs . _refine.ls_redundancy_reflns_all . _refine.ls_redundancy_reflns_obs . _refine.ls_restrained_S_all . _refine.ls_restrained_S_obs . _refine.ls_shift_over_esd_max . _refine.ls_shift_over_esd_mean . _refine.ls_structure_factor_coef . _refine.ls_weighting_details . _refine.ls_weighting_scheme . _refine.ls_wR_factor_all . _refine.ls_wR_factor_obs . _refine.ls_wR_factor_R_free . _refine.ls_wR_factor_R_work . _refine.occupancy_max . _refine.occupancy_min . _refine.overall_SU_B 0.008 _refine.overall_SU_ML 0.000 _refine.overall_SU_R_Cruickshank_DPI . _refine.overall_SU_R_free . _refine.overall_FOM_free_R_set . _refine.overall_FOM_work_R_set . _refine.solvent_model_details MASK _refine.solvent_model_param_bsol . _refine.solvent_model_param_ksol . _refine.ls_R_factor_gt . _refine.ls_goodness_of_fit_gt . _refine.ls_goodness_of_fit_ref . _refine.ls_shift_over_su_max . _refine.ls_shift_over_su_max_lt . _refine.ls_shift_over_su_mean . _refine.ls_shift_over_su_mean_lt . _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F . _refine.pdbx_ls_sigma_Fsqd . _refine.pdbx_data_cutoff_high_absF . _refine.pdbx_data_cutoff_high_rms_absF . _refine.pdbx_data_cutoff_low_absF . _refine.pdbx_isotropic_thermal_model . _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2HVV _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case . _refine.pdbx_overall_ESU_R 0.260 _refine.pdbx_overall_ESU_R_Free 0.332 _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R . _refine.pdbx_density_correlation . _refine.pdbx_pd_number_of_powder_patterns . _refine.pdbx_pd_number_of_points . _refine.pdbx_pd_meas_number_of_points . _refine.pdbx_pd_proc_ls_prof_R_factor . _refine.pdbx_pd_proc_ls_prof_wR_factor . _refine.pdbx_pd_Marquardt_correlation_coeff . _refine.pdbx_pd_Fsqrd_R_factor . _refine.pdbx_pd_ls_matrix_band_width . _refine.pdbx_overall_phase_error . _refine.pdbx_overall_SU_R_free_Cruickshank_DPI . _refine.pdbx_overall_SU_R_free_Blow_DPI . _refine.pdbx_overall_SU_R_Blow_DPI . _refine.pdbx_TLS_residual_ADP_flag . _refine.pdbx_diffrn_id 1 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 962 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 979 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 67.66 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.600 _refine_ls_shell.d_res_low 2.668 _refine_ls_shell.number_reflns_all . _refine_ls_shell.number_reflns_obs . _refine_ls_shell.number_reflns_R_free 22 _refine_ls_shell.number_reflns_R_work 315 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free . _refine_ls_shell.R_factor_all . _refine_ls_shell.R_factor_obs . _refine_ls_shell.R_factor_R_free 0.266 _refine_ls_shell.R_factor_R_free_error . _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.redundancy_reflns_all . _refine_ls_shell.redundancy_reflns_obs . _refine_ls_shell.wR_factor_all . _refine_ls_shell.wR_factor_obs . _refine_ls_shell.wR_factor_R_free . _refine_ls_shell.wR_factor_R_work . _refine_ls_shell.pdbx_total_number_of_bins_used . _refine_ls_shell.pdbx_phase_error . # _struct.entry_id 4P9E _struct.title 'Crystal structure of dCMP deaminase from the cyanophage S-TIM5 in apo form' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4P9E _struct_keywords.text 'dCMP deaminase, cytidine deaminase, deoxycytidylate deaminase, S-TIM5 cyanophage, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H6WFU3_9CAUD _struct_ref.pdbx_db_accession H6WFU3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKPEIKEAYMKTAELFSQVSNCKRMKVGAIVVKNGSILAHGWNGTPSGFHTNCCELEDGSTNPFVLHAEQNALVKMAKSS ESIDGSELFCTHSPCPDCSKMIAQAGVKKVYYRNEYRITDGIDVLQQLGVEVEKM ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4P9E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H6WFU3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 135 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 135 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4P9E GLY A 1 ? UNP H6WFU3 ? ? 'expression tag' -2 1 1 4P9E SER A 2 ? UNP H6WFU3 ? ? 'expression tag' -1 2 1 4P9E HIS A 3 ? UNP H6WFU3 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14040 ? 1 MORE -329 ? 1 'SSA (A^2)' 29030 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 10_554 -y,-x,-z-1/2 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -40.2800000000 5 'crystal symmetry operation' 11_554 -x+y,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -40.2800000000 6 'crystal symmetry operation' 12_554 x,x-y,-z-1/2 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -40.2800000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 5 ? GLN A 21 ? LYS A 2 GLN A 18 1 ? 17 HELX_P HELX_P2 AA2 HIS A 70 ? LYS A 81 ? HIS A 67 LYS A 78 1 ? 12 HELX_P HELX_P3 AA3 CYS A 98 ? ALA A 108 ? CYS A 95 ALA A 105 1 ? 11 HELX_P HELX_P4 AA4 ASP A 123 ? LEU A 131 ? ASP A 120 LEU A 128 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 25 SG A ? ? 1_555 A CYS 57 SG ? ? A CYS 22 A CYS 54 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc1 metalc ? ? A HIS 70 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 67 A ZN 201 1_555 ? ? ? ? ? ? ? 1.967 ? ? metalc2 metalc ? ? A CYS 98 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 95 A ZN 201 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc3 metalc ? ? A CYS 101 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 98 A ZN 201 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 201 A HOH 311 1_555 ? ? ? ? ? ? ? 2.449 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 70 ? A HIS 67 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 98 ? A CYS 95 ? 1_555 106.6 ? 2 ND1 ? A HIS 70 ? A HIS 67 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 101 ? A CYS 98 ? 1_555 102.0 ? 3 SG ? A CYS 98 ? A CYS 95 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 101 ? A CYS 98 ? 1_555 110.3 ? 4 ND1 ? A HIS 70 ? A HIS 67 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? D HOH . ? A HOH 311 ? 1_555 106.3 ? 5 SG ? A CYS 98 ? A CYS 95 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? D HOH . ? A HOH 311 ? 1_555 123.2 ? 6 SG ? A CYS 101 ? A CYS 98 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? D HOH . ? A HOH 311 ? 1_555 106.4 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 25 _pdbx_modification_feature.label_alt_id A _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 57 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 22 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 54 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 39 ? TRP A 45 ? SER A 36 TRP A 42 AA1 2 GLY A 31 ? LYS A 36 ? GLY A 28 LYS A 33 AA1 3 GLU A 90 ? HIS A 95 ? GLU A 87 HIS A 92 AA1 4 LYS A 112 ? ASN A 117 ? LYS A 109 ASN A 114 AA1 5 GLU A 134 ? LYS A 137 ? GLU A 131 LYS A 134 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 42 ? O ALA A 39 N VAL A 34 ? N VAL A 31 AA1 2 3 N VAL A 35 ? N VAL A 32 O GLU A 90 ? O GLU A 87 AA1 3 4 N CYS A 93 ? N CYS A 90 O TYR A 114 ? O TYR A 111 AA1 4 5 N VAL A 113 ? N VAL A 110 O GLU A 134 ? O GLU A 131 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'binding site for residue ZN A 201' AC2 Software A CL 202 ? 6 'binding site for residue CL A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 70 ? HIS A 67 . ? 1_555 ? 2 AC1 4 CYS A 98 ? CYS A 95 . ? 1_555 ? 3 AC1 4 CYS A 101 ? CYS A 98 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 311 . ? 1_555 ? 5 AC2 6 MET A 79 ? MET A 76 . ? 1_555 ? 6 AC2 6 MET A 79 ? MET A 76 . ? 10_554 ? 7 AC2 6 ALA A 80 ? ALA A 77 . ? 10_554 ? 8 AC2 6 SER A 82 ? SER A 79 . ? 10_554 ? 9 AC2 6 SER A 82 ? SER A 79 . ? 1_555 ? 10 AC2 6 GLU A 84 ? GLU A 81 . ? 1_555 ? # _pdbx_entry_details.entry_id 4P9E _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A GLU 55 ? A GLU 58 5 1 Y 1 A LEU 56 ? A LEU 59 6 1 Y 1 A GLU 57 ? A GLU 60 7 1 Y 1 A ASP 58 ? A ASP 61 8 1 Y 1 A GLY 59 ? A GLY 62 9 1 Y 1 A SER 60 ? A SER 63 10 1 Y 1 A TYR 116 ? A TYR 119 11 1 Y 1 A ARG 117 ? A ARG 120 12 1 Y 1 A ILE 118 ? A ILE 121 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 ZN ZN ZN N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HVV _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4P9E _atom_sites.fract_transf_matrix[1][1] 0.012799 _atom_sites.fract_transf_matrix[1][2] 0.007390 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014779 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012413 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_