data_4P9V # _entry.id 4P9V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4P9V pdb_00004p9v 10.2210/pdb4p9v/pdb WWPDB D_1000200998 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-06-18 2 'Structure model' 1 1 2014-07-16 3 'Structure model' 1 2 2014-12-24 4 'Structure model' 1 3 2017-08-09 5 'Structure model' 1 4 2017-09-27 6 'Structure model' 1 5 2019-11-27 7 'Structure model' 1 6 2023-09-27 8 'Structure model' 1 7 2023-11-15 9 'Structure model' 1 8 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Source and taxonomy' 7 5 'Structure model' 'Author supporting evidence' 8 6 'Structure model' 'Author supporting evidence' 9 7 'Structure model' 'Data collection' 10 7 'Structure model' 'Database references' 11 7 'Structure model' 'Refinement description' 12 8 'Structure model' 'Data collection' 13 9 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' entity_src_gen 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_entity_src_syn 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' pdbx_audit_support 7 6 'Structure model' pdbx_audit_support 8 7 'Structure model' chem_comp_atom 9 7 'Structure model' chem_comp_bond 10 7 'Structure model' database_2 11 7 'Structure model' pdbx_initial_refinement_model 12 7 'Structure model' refine_hist 13 8 'Structure model' chem_comp_atom 14 8 'Structure model' chem_comp_bond 15 9 'Structure model' pdbx_entry_details 16 9 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 4 4 'Structure model' '_pdbx_entity_src_syn.pdbx_alt_source_flag' 5 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 5 'Structure model' '_pdbx_audit_support.funding_organization' 7 6 'Structure model' '_pdbx_audit_support.funding_organization' 8 7 'Structure model' '_database_2.pdbx_DOI' 9 7 'Structure model' '_database_2.pdbx_database_accession' 10 7 'Structure model' '_refine_hist.number_atoms_solvent' 11 7 'Structure model' '_refine_hist.number_atoms_total' 12 7 'Structure model' '_refine_hist.pdbx_number_atoms_ligand' 13 7 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 14 7 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 15 8 'Structure model' '_chem_comp_atom.atom_id' 16 8 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4P9V _pdbx_database_status.recvd_initial_deposition_date 2014-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '3S8O contains the same protein complexed with a similar ligand' 3S8O unspecified PDB . 4P9Z unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clements, J.H.' 1 'Martin, S.F.' 2 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher ? _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country UK _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full . _citation.journal_issue . _citation.journal_volume 24 _citation.language . _citation.page_first 3164 _citation.page_last 3167 _citation.title 'Protein-ligand interactions: Probing the energetics of a putative cation-pi interaction.' _citation.year 2014 _citation.database_id_CSD . _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2014.04.114 _citation.pdbx_database_id_PubMed 24856058 _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Myslinski, J.M.' 1 ? primary 'Clements, J.H.' 2 ? primary 'Martin, S.F.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth factor receptor-bound protein 2' 13758.543 1 ? ? 'UNP residues 53-163' ? 2 polymer syn PHQ-PTR-02K-ASN-NH2 651.025 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adapter protein GRB2,Protein Ash,SH2/SH3 adapter GRB2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH ; ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH ; A ? 2 'polypeptide(L)' no yes '(PHQ)(PTR)(02K)N(NH2)' XYANX B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 GLU n 1 3 MET n 1 4 LYS n 1 5 PRO n 1 6 HIS n 1 7 PRO n 1 8 TRP n 1 9 PHE n 1 10 PHE n 1 11 GLY n 1 12 LYS n 1 13 ILE n 1 14 PRO n 1 15 ARG n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 GLU n 1 20 GLU n 1 21 MET n 1 22 LEU n 1 23 SER n 1 24 LYS n 1 25 GLN n 1 26 ARG n 1 27 HIS n 1 28 ASP n 1 29 GLY n 1 30 ALA n 1 31 PHE n 1 32 LEU n 1 33 ILE n 1 34 ARG n 1 35 GLU n 1 36 SER n 1 37 GLU n 1 38 SER n 1 39 ALA n 1 40 PRO n 1 41 GLY n 1 42 ASP n 1 43 PHE n 1 44 SER n 1 45 LEU n 1 46 SER n 1 47 VAL n 1 48 LYS n 1 49 PHE n 1 50 GLY n 1 51 ASN n 1 52 ASP n 1 53 VAL n 1 54 GLN n 1 55 HIS n 1 56 PHE n 1 57 LYS n 1 58 VAL n 1 59 LEU n 1 60 ARG n 1 61 ASP n 1 62 GLY n 1 63 ALA n 1 64 GLY n 1 65 LYS n 1 66 TYR n 1 67 PHE n 1 68 LEU n 1 69 TRP n 1 70 VAL n 1 71 VAL n 1 72 LYS n 1 73 PHE n 1 74 ASN n 1 75 SER n 1 76 LEU n 1 77 ASN n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 ASP n 1 82 TYR n 1 83 HIS n 1 84 ARG n 1 85 SER n 1 86 THR n 1 87 SER n 1 88 VAL n 1 89 SER n 1 90 ARG n 1 91 ASN n 1 92 GLN n 1 93 GLN n 1 94 ILE n 1 95 PHE n 1 96 LEU n 1 97 ARG n 1 98 ASP n 1 99 ILE n 1 100 GLU n 1 101 GLN n 1 102 VAL n 1 103 PRO n 1 104 GLN n 1 105 GLN n 1 106 PRO n 1 107 THR n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 ALA n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n 1 117 HIS n 2 1 PHQ n 2 2 PTR n 2 3 02K n 2 4 ASN n 2 5 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 117 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GRB2, ASH' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain SG13009 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE-60 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 02K 'peptide linking' n '1-aminocyclohexanecarboxylic acid' ? 'C7 H13 N O2' 143.184 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PHQ non-polymer . 'benzyl chlorocarbonate' ? 'C8 H7 Cl O2' 170.593 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 53 ? ? ? A . n A 1 2 GLU 2 54 54 GLU GLU A . n A 1 3 MET 3 55 55 MET MET A . n A 1 4 LYS 4 56 56 LYS LYS A . n A 1 5 PRO 5 57 57 PRO PRO A . n A 1 6 HIS 6 58 58 HIS HIS A . n A 1 7 PRO 7 59 59 PRO PRO A . n A 1 8 TRP 8 60 60 TRP TRP A . n A 1 9 PHE 9 61 61 PHE PHE A . n A 1 10 PHE 10 62 62 PHE PHE A . n A 1 11 GLY 11 63 63 GLY GLY A . n A 1 12 LYS 12 64 64 LYS LYS A . n A 1 13 ILE 13 65 65 ILE ILE A . n A 1 14 PRO 14 66 66 PRO PRO A . n A 1 15 ARG 15 67 67 ARG ARG A . n A 1 16 ALA 16 68 68 ALA ALA A . n A 1 17 LYS 17 69 69 LYS LYS A . n A 1 18 ALA 18 70 70 ALA ALA A . n A 1 19 GLU 19 71 71 GLU GLU A . n A 1 20 GLU 20 72 72 GLU GLU A . n A 1 21 MET 21 73 73 MET MET A . n A 1 22 LEU 22 74 74 LEU LEU A . n A 1 23 SER 23 75 75 SER SER A . n A 1 24 LYS 24 76 76 LYS LYS A . n A 1 25 GLN 25 77 77 GLN GLN A . n A 1 26 ARG 26 78 78 ARG ARG A . n A 1 27 HIS 27 79 79 HIS HIS A . n A 1 28 ASP 28 80 80 ASP ASP A . n A 1 29 GLY 29 81 81 GLY GLY A . n A 1 30 ALA 30 82 82 ALA ALA A . n A 1 31 PHE 31 83 83 PHE PHE A . n A 1 32 LEU 32 84 84 LEU LEU A . n A 1 33 ILE 33 85 85 ILE ILE A . n A 1 34 ARG 34 86 86 ARG ARG A . n A 1 35 GLU 35 87 87 GLU GLU A . n A 1 36 SER 36 88 88 SER SER A . n A 1 37 GLU 37 89 89 GLU GLU A . n A 1 38 SER 38 90 90 SER SER A . n A 1 39 ALA 39 91 91 ALA ALA A . n A 1 40 PRO 40 92 92 PRO PRO A . n A 1 41 GLY 41 93 93 GLY GLY A . n A 1 42 ASP 42 94 94 ASP ASP A . n A 1 43 PHE 43 95 95 PHE PHE A . n A 1 44 SER 44 96 96 SER SER A . n A 1 45 LEU 45 97 97 LEU LEU A . n A 1 46 SER 46 98 98 SER SER A . n A 1 47 VAL 47 99 99 VAL VAL A . n A 1 48 LYS 48 100 100 LYS LYS A . n A 1 49 PHE 49 101 101 PHE PHE A . n A 1 50 GLY 50 102 102 GLY GLY A . n A 1 51 ASN 51 103 103 ASN ASN A . n A 1 52 ASP 52 104 104 ASP ASP A . n A 1 53 VAL 53 105 105 VAL VAL A . n A 1 54 GLN 54 106 106 GLN GLN A . n A 1 55 HIS 55 107 107 HIS HIS A . n A 1 56 PHE 56 108 108 PHE PHE A . n A 1 57 LYS 57 109 109 LYS LYS A . n A 1 58 VAL 58 110 110 VAL VAL A . n A 1 59 LEU 59 111 111 LEU LEU A . n A 1 60 ARG 60 112 112 ARG ARG A . n A 1 61 ASP 61 113 113 ASP ASP A . n A 1 62 GLY 62 114 114 GLY GLY A . n A 1 63 ALA 63 115 115 ALA ALA A . n A 1 64 GLY 64 116 116 GLY GLY A . n A 1 65 LYS 65 117 117 LYS LYS A . n A 1 66 TYR 66 118 118 TYR TYR A . n A 1 67 PHE 67 119 119 PHE PHE A . n A 1 68 LEU 68 120 120 LEU LEU A . n A 1 69 TRP 69 121 121 TRP TRP A . n A 1 70 VAL 70 122 122 VAL VAL A . n A 1 71 VAL 71 123 123 VAL VAL A . n A 1 72 LYS 72 124 124 LYS LYS A . n A 1 73 PHE 73 125 125 PHE PHE A . n A 1 74 ASN 74 126 126 ASN ASN A . n A 1 75 SER 75 127 127 SER SER A . n A 1 76 LEU 76 128 128 LEU LEU A . n A 1 77 ASN 77 129 129 ASN ASN A . n A 1 78 GLU 78 130 130 GLU GLU A . n A 1 79 LEU 79 131 131 LEU LEU A . n A 1 80 VAL 80 132 132 VAL VAL A . n A 1 81 ASP 81 133 133 ASP ASP A . n A 1 82 TYR 82 134 134 TYR TYR A . n A 1 83 HIS 83 135 135 HIS HIS A . n A 1 84 ARG 84 136 136 ARG ARG A . n A 1 85 SER 85 137 137 SER SER A . n A 1 86 THR 86 138 138 THR THR A . n A 1 87 SER 87 139 139 SER SER A . n A 1 88 VAL 88 140 140 VAL VAL A . n A 1 89 SER 89 141 141 SER SER A . n A 1 90 ARG 90 142 142 ARG ARG A . n A 1 91 ASN 91 143 143 ASN ASN A . n A 1 92 GLN 92 144 144 GLN GLN A . n A 1 93 GLN 93 145 145 GLN GLN A . n A 1 94 ILE 94 146 146 ILE ILE A . n A 1 95 PHE 95 147 147 PHE PHE A . n A 1 96 LEU 96 148 148 LEU LEU A . n A 1 97 ARG 97 149 149 ARG ARG A . n A 1 98 ASP 98 150 150 ASP ASP A . n A 1 99 ILE 99 151 151 ILE ILE A . n A 1 100 GLU 100 152 152 GLU GLU A . n A 1 101 GLN 101 153 153 GLN GLN A . n A 1 102 VAL 102 154 ? ? ? A . n A 1 103 PRO 103 155 ? ? ? A . n A 1 104 GLN 104 156 ? ? ? A . n A 1 105 GLN 105 157 ? ? ? A . n A 1 106 PRO 106 158 ? ? ? A . n A 1 107 THR 107 159 ? ? ? A . n A 1 108 TYR 108 160 ? ? ? A . n A 1 109 VAL 109 161 ? ? ? A . n A 1 110 GLN 110 162 ? ? ? A . n A 1 111 ALA 111 163 ? ? ? A . n A 1 112 HIS 112 164 ? ? ? A . n A 1 113 HIS 113 165 ? ? ? A . n A 1 114 HIS 114 166 ? ? ? A . n A 1 115 HIS 115 167 ? ? ? A . n A 1 116 HIS 116 168 ? ? ? A . n A 1 117 HIS 117 169 ? ? ? A . n B 2 1 PHQ 1 1 1 PHQ DRG B . n B 2 2 PTR 2 2 1 PTR DRG B . n B 2 3 02K 3 3 1 02K DRG B . n B 2 4 ASN 4 4 1 ASN DRG B . n B 2 5 NH2 5 5 1 NH2 DRG B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 201 1 CL CL A . D 4 HOH 1 301 5 HOH HOH A . D 4 HOH 2 302 11 HOH HOH A . D 4 HOH 3 303 57 HOH HOH A . D 4 HOH 4 304 24 HOH HOH A . D 4 HOH 5 305 8 HOH HOH A . D 4 HOH 6 306 18 HOH HOH A . D 4 HOH 7 307 6 HOH HOH A . D 4 HOH 8 308 52 HOH HOH A . D 4 HOH 9 309 26 HOH HOH A . D 4 HOH 10 310 29 HOH HOH A . D 4 HOH 11 311 31 HOH HOH A . D 4 HOH 12 312 34 HOH HOH A . D 4 HOH 13 313 37 HOH HOH A . D 4 HOH 14 314 28 HOH HOH A . D 4 HOH 15 315 38 HOH HOH A . D 4 HOH 16 316 47 HOH HOH A . D 4 HOH 17 317 21 HOH HOH A . D 4 HOH 18 318 4 HOH HOH A . D 4 HOH 19 319 56 HOH HOH A . D 4 HOH 20 320 48 HOH HOH A . D 4 HOH 21 321 20 HOH HOH A . D 4 HOH 22 322 49 HOH HOH A . D 4 HOH 23 323 27 HOH HOH A . D 4 HOH 24 324 13 HOH HOH A . D 4 HOH 25 325 54 HOH HOH A . D 4 HOH 26 326 17 HOH HOH A . D 4 HOH 27 327 55 HOH HOH A . D 4 HOH 28 328 45 HOH HOH A . D 4 HOH 29 329 2 HOH HOH A . D 4 HOH 30 330 3 HOH HOH A . D 4 HOH 31 331 7 HOH HOH A . D 4 HOH 32 332 9 HOH HOH A . D 4 HOH 33 333 10 HOH HOH A . D 4 HOH 34 334 14 HOH HOH A . D 4 HOH 35 335 15 HOH HOH A . D 4 HOH 36 336 16 HOH HOH A . D 4 HOH 37 337 19 HOH HOH A . D 4 HOH 38 338 22 HOH HOH A . D 4 HOH 39 339 23 HOH HOH A . D 4 HOH 40 340 25 HOH HOH A . D 4 HOH 41 341 30 HOH HOH A . D 4 HOH 42 342 32 HOH HOH A . D 4 HOH 43 343 33 HOH HOH A . D 4 HOH 44 344 35 HOH HOH A . D 4 HOH 45 345 36 HOH HOH A . D 4 HOH 46 346 39 HOH HOH A . D 4 HOH 47 347 40 HOH HOH A . D 4 HOH 48 348 41 HOH HOH A . D 4 HOH 49 349 42 HOH HOH A . D 4 HOH 50 350 46 HOH HOH A . D 4 HOH 51 351 50 HOH HOH A . D 4 HOH 52 352 51 HOH HOH A . D 4 HOH 53 353 53 HOH HOH A . E 4 HOH 1 101 43 HOH HOH B . E 4 HOH 2 102 1 HOH HOH B . E 4 HOH 3 103 44 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 54 ? N ? A GLU 2 N 2 1 Y 1 A GLU 54 ? CG ? A GLU 2 CG 3 1 Y 1 A GLU 54 ? CD ? A GLU 2 CD 4 1 Y 1 A GLU 54 ? OE1 ? A GLU 2 OE1 5 1 Y 1 A GLU 54 ? OE2 ? A GLU 2 OE2 6 1 Y 1 A MET 55 ? SD ? A MET 3 SD 7 1 Y 1 A MET 55 ? CE ? A MET 3 CE 8 1 Y 1 A LYS 56 ? CD ? A LYS 4 CD 9 1 Y 1 A LYS 56 ? CE ? A LYS 4 CE 10 1 Y 1 A LYS 56 ? NZ ? A LYS 4 NZ 11 1 Y 1 A GLN 153 ? CD ? A GLN 101 CD 12 1 Y 1 A GLN 153 ? OE1 ? A GLN 101 OE1 13 1 Y 1 A GLN 153 ? NE2 ? A GLN 101 NE2 # _software.citation_id ? _software.classification refinement _software.compiler_name . _software.compiler_version . _software.contact_author . _software.contact_author_email . _software.date . _software.description . _software.dependencies . _software.hardware . _software.language . _software.location . _software.mods . _software.name REFMAC _software.os . _software.os_version . _software.type . _software.version 5.6.0117 _software.pdbx_ordinal 1 # _cell.entry_id 4P9V _cell.length_a 41.935 _cell.length_b 41.935 _cell.length_c 108.715 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4P9V _symmetry.cell_setting . _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall . _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M . # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4P9V _exptl.crystals_number 1 _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 1.66 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 25.83 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details '0.2 M magnesium chloride hexahydrate, 0.1 M TRIS hydrochloride, 30% w/v polyethylene glycol 4000' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2013-01-18 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target . _diffrn_source.type 'RIGAKU RU200' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline . _diffrn_source.pdbx_synchrotron_site . # _reflns.B_iso_Wilson_estimate . _reflns.entry_id 4P9V _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 1.64 _reflns.d_resolution_low 50.00 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all . _reflns.number_obs 11451 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F . _reflns.observed_criterion_sigma_I . _reflns.percent_possible_obs 90.3 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 11.1 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value . _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 31.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.64 _reflns_shell.d_res_low 1.70 _reflns_shell.meanI_over_sigI_all . _reflns_shell.meanI_over_sigI_obs 19.2 _reflns_shell.number_measured_all . _reflns_shell.number_measured_obs . _reflns_shell.number_possible . _reflns_shell.number_unique_all . _reflns_shell.number_unique_obs . _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs . _reflns_shell.Rmerge_F_all . _reflns_shell.Rmerge_F_obs . _reflns_shell.Rmerge_I_all . _reflns_shell.Rmerge_I_obs 0.176 _reflns_shell.meanI_over_sigI_gt . _reflns_shell.meanI_over_uI_all . _reflns_shell.meanI_over_uI_gt . _reflns_shell.number_measured_gt . _reflns_shell.number_unique_gt . _reflns_shell.percent_possible_gt . _reflns_shell.Rmerge_F_gt . _reflns_shell.Rmerge_I_gt . _reflns_shell.pdbx_redundancy 12.6 _reflns_shell.pdbx_Rsym_value . _reflns_shell.pdbx_chi_squared . _reflns_shell.pdbx_netI_over_sigmaI_all . _reflns_shell.pdbx_netI_over_sigmaI_obs . _reflns_shell.pdbx_Rrim_I_all . _reflns_shell.pdbx_Rpim_I_all . _reflns_shell.pdbx_rejects . _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.aniso_B[1][1] -0.72 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.72 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 1.45 _refine.B_iso_max . _refine.B_iso_mean 20.403 _refine.B_iso_min . _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.899 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max . _refine.diff_density_max_esd . _refine.diff_density_min . _refine.diff_density_min_esd . _refine.diff_density_rms . _refine.diff_density_rms_esd . _refine.entry_id 4P9V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details . _refine.ls_abs_structure_Flack . _refine.ls_abs_structure_Flack_esd . _refine.ls_abs_structure_Rogers . _refine.ls_abs_structure_Rogers_esd . _refine.ls_d_res_high 1.64 _refine.ls_d_res_low 39.13 _refine.ls_extinction_coef . _refine.ls_extinction_coef_esd . _refine.ls_extinction_expression . _refine.ls_extinction_method . _refine.ls_goodness_of_fit_all . _refine.ls_goodness_of_fit_all_esd . _refine.ls_goodness_of_fit_obs . _refine.ls_goodness_of_fit_obs_esd . _refine.ls_hydrogen_treatment . _refine.ls_matrix_type . _refine.ls_number_constraints . _refine.ls_number_parameters . _refine.ls_number_reflns_all . _refine.ls_number_reflns_obs 10836 _refine.ls_number_reflns_R_free 560 _refine.ls_number_reflns_R_work . _refine.ls_number_restraints . _refine.ls_percent_reflns_obs 90.17 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all . _refine.ls_R_factor_obs 0.20614 _refine.ls_R_factor_R_free 0.25720 _refine.ls_R_factor_R_free_error . _refine.ls_R_factor_R_free_error_details . _refine.ls_R_factor_R_work 0.20370 _refine.ls_R_Fsqd_factor_obs . _refine.ls_R_I_factor_obs . _refine.ls_redundancy_reflns_all . _refine.ls_redundancy_reflns_obs . _refine.ls_restrained_S_all . _refine.ls_restrained_S_obs . _refine.ls_shift_over_esd_max . _refine.ls_shift_over_esd_mean . _refine.ls_structure_factor_coef . _refine.ls_weighting_details . _refine.ls_weighting_scheme . _refine.ls_wR_factor_all . _refine.ls_wR_factor_obs . _refine.ls_wR_factor_R_free . _refine.ls_wR_factor_R_work . _refine.occupancy_max . _refine.occupancy_min . _refine.overall_SU_B 1.726 _refine.overall_SU_ML 0.061 _refine.overall_SU_R_Cruickshank_DPI . _refine.overall_SU_R_free . _refine.overall_FOM_free_R_set . _refine.overall_FOM_work_R_set . _refine.solvent_model_details MASK _refine.solvent_model_param_bsol . _refine.solvent_model_param_ksol . _refine.ls_R_factor_gt . _refine.ls_goodness_of_fit_gt . _refine.ls_goodness_of_fit_ref . _refine.ls_shift_over_su_max . _refine.ls_shift_over_su_max_lt . _refine.ls_shift_over_su_mean . _refine.ls_shift_over_su_mean_lt . _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F . _refine.pdbx_ls_sigma_Fsqd . _refine.pdbx_data_cutoff_high_absF . _refine.pdbx_data_cutoff_high_rms_absF . _refine.pdbx_data_cutoff_low_absF . _refine.pdbx_isotropic_thermal_model . _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3S8O _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case . _refine.pdbx_overall_ESU_R 0.126 _refine.pdbx_overall_ESU_R_Free 0.129 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R . _refine.pdbx_density_correlation . _refine.pdbx_pd_number_of_powder_patterns . _refine.pdbx_pd_number_of_points . _refine.pdbx_pd_meas_number_of_points . _refine.pdbx_pd_proc_ls_prof_R_factor . _refine.pdbx_pd_proc_ls_prof_wR_factor . _refine.pdbx_pd_Marquardt_correlation_coeff . _refine.pdbx_pd_Fsqrd_R_factor . _refine.pdbx_pd_ls_matrix_band_width . _refine.pdbx_overall_phase_error . _refine.pdbx_overall_SU_R_free_Cruickshank_DPI . _refine.pdbx_overall_SU_R_free_Blow_DPI . _refine.pdbx_overall_SU_R_Blow_DPI . _refine.pdbx_TLS_residual_ADP_flag . _refine.pdbx_diffrn_id 1 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 858 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 915 _refine_hist.d_res_high 1.64 _refine_hist.d_res_low 39.13 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' . 0.022 0.020 891 . r_bond_refined_d . . 'X-RAY DIFFRACTION' . . . . . r_bond_other_d . . 'X-RAY DIFFRACTION' . 2.192 1.979 1203 . r_angle_refined_deg . . 'X-RAY DIFFRACTION' . . . . . r_angle_other_deg . . 'X-RAY DIFFRACTION' . 7.237 5.000 101 . r_dihedral_angle_1_deg . . 'X-RAY DIFFRACTION' . 30.668 22.955 44 . r_dihedral_angle_2_deg . . 'X-RAY DIFFRACTION' . 12.949 15.000 145 . r_dihedral_angle_3_deg . . 'X-RAY DIFFRACTION' . 18.635 15.000 7 . r_dihedral_angle_4_deg . . 'X-RAY DIFFRACTION' . 0.443 0.200 119 . r_chiral_restr . . 'X-RAY DIFFRACTION' . 0.013 0.021 700 . r_gen_planes_refined . . 'X-RAY DIFFRACTION' . . . . . r_gen_planes_other . . 'X-RAY DIFFRACTION' . . . . . r_nbd_refined . . 'X-RAY DIFFRACTION' . . . . . r_nbd_other . . 'X-RAY DIFFRACTION' . . . . . r_nbtor_refined . . 'X-RAY DIFFRACTION' . . . . . r_nbtor_other . . 'X-RAY DIFFRACTION' . . . . . r_xyhbond_nbd_refined . . 'X-RAY DIFFRACTION' . . . . . r_xyhbond_nbd_other . . 'X-RAY DIFFRACTION' . . . . . r_metal_ion_refined . . 'X-RAY DIFFRACTION' . . . . . r_metal_ion_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_vdw_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_vdw_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_hbond_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_hbond_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_metal_ion_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_metal_ion_other . . 'X-RAY DIFFRACTION' . . . . . r_mcbond_it . . 'X-RAY DIFFRACTION' . . . . . r_mcbond_other . . 'X-RAY DIFFRACTION' . . . . . r_mcangle_it . . 'X-RAY DIFFRACTION' . . . . . r_mcangle_other . . 'X-RAY DIFFRACTION' . . . . . r_scbond_it . . 'X-RAY DIFFRACTION' . . . . . r_scbond_other . . 'X-RAY DIFFRACTION' . . . . . r_scangle_it . . 'X-RAY DIFFRACTION' . . . . . r_scangle_other . . 'X-RAY DIFFRACTION' . . . . . r_long_range_B_refined . . 'X-RAY DIFFRACTION' . . . . . r_long_range_B_other . . 'X-RAY DIFFRACTION' . . . . . r_rigid_bond_restr . . 'X-RAY DIFFRACTION' . . . . . r_sphericity_free . . 'X-RAY DIFFRACTION' . . . . . r_sphericity_bonded . . # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.64 _refine_ls_shell.d_res_low 1.681 _refine_ls_shell.number_reflns_all . _refine_ls_shell.number_reflns_obs . _refine_ls_shell.number_reflns_R_free 50 _refine_ls_shell.number_reflns_R_work 730 _refine_ls_shell.percent_reflns_obs 97.62 _refine_ls_shell.percent_reflns_R_free . _refine_ls_shell.R_factor_all . _refine_ls_shell.R_factor_obs . _refine_ls_shell.R_factor_R_free 0.370 _refine_ls_shell.R_factor_R_free_error . _refine_ls_shell.R_factor_R_work 0.256 _refine_ls_shell.redundancy_reflns_all . _refine_ls_shell.redundancy_reflns_obs . _refine_ls_shell.wR_factor_all . _refine_ls_shell.wR_factor_obs . _refine_ls_shell.wR_factor_R_free . _refine_ls_shell.wR_factor_R_work . _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error . # _struct.entry_id 4P9V _struct.title 'Grb2 SH2 complexed with a pTyr-Ac6cN-Asn tripeptide' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4P9V _struct_keywords.text 'Grb2 SH2, Cation-Pi Interaction, Signaling Protein-Antagonist complex' _struct_keywords.pdbx_keywords 'Signaling Protein/Antagonist' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP GRB2_HUMAN P62993 1 ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQA ; 53 ? 2 PDB 4P9V 4P9V 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4P9V A 1 ? 111 ? P62993 53 ? 163 ? 53 163 2 2 4P9V B 1 ? 5 ? 4P9V 1 ? 5 ? 1 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4P9V HIS A 112 ? UNP P62993 ? ? 'expression tag' 164 1 1 4P9V HIS A 113 ? UNP P62993 ? ? 'expression tag' 165 2 1 4P9V HIS A 114 ? UNP P62993 ? ? 'expression tag' 166 3 1 4P9V HIS A 115 ? UNP P62993 ? ? 'expression tag' 167 4 1 4P9V HIS A 116 ? UNP P62993 ? ? 'expression tag' 168 5 1 4P9V HIS A 117 ? UNP P62993 ? ? 'expression tag' 169 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1310 ? 1 MORE -10 ? 1 'SSA (A^2)' 6080 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 14 ? LYS A 24 ? PRO A 66 LYS A 76 1 ? 11 HELX_P HELX_P2 AA2 SER A 75 ? HIS A 83 ? SER A 127 HIS A 135 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B PHQ 1 C1 ? ? ? 1_555 B PTR 2 N ? ? B PHQ 1 B PTR 2 1_555 ? ? ? ? ? ? ? 1.347 ? ? covale2 covale both ? B PTR 2 C ? ? ? 1_555 B 02K 3 N ? ? B PTR 2 B 02K 3 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale3 covale both ? B 02K 3 C ? ? ? 1_555 B ASN 4 N ? ? B 02K 3 B ASN 4 1_555 ? ? ? ? ? ? ? 1.387 ? ? covale4 covale both ? B ASN 4 C ? ? ? 1_555 B NH2 5 N ? ? B ASN 4 B NH2 5 1_555 ? ? ? ? ? ? ? 1.303 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PTR B 2 ? . . . . PTR B 2 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 2 PHQ B 1 ? . . . . PHQ B 1 ? 1_555 . . . . . . . ? 1 PHQ None 'Non-standard residue' 3 02K B 3 ? . . . . 02K B 3 ? 1_555 . . . . . . . ALA 1 02K None 'Non-standard residue' 4 NH2 B 5 ? ASN B 4 ? NH2 B 5 ? 1_555 ASN B 4 ? 1_555 . . ASN 17 NH2 None 'Terminal amidation' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 31 ? GLU A 35 ? PHE A 83 GLU A 87 AA1 2 PHE A 43 ? PHE A 49 ? PHE A 95 PHE A 101 AA1 3 ASP A 52 ? LYS A 57 ? ASP A 104 LYS A 109 AA2 1 LEU A 59 ? ARG A 60 ? LEU A 111 ARG A 112 AA2 2 TYR A 66 ? PHE A 67 ? TYR A 118 PHE A 119 AA2 3 LYS A 72 ? PHE A 73 ? LYS A 124 PHE A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 32 ? N LEU A 84 O SER A 46 ? O SER A 98 AA1 2 3 N LEU A 45 ? N LEU A 97 O PHE A 56 ? O PHE A 108 AA2 1 2 N LEU A 59 ? N LEU A 111 O PHE A 67 ? O PHE A 119 AA2 2 3 N TYR A 66 ? N TYR A 118 O PHE A 73 ? O PHE A 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 201 ? 3 'binding site for residue CL A 201' AC2 Software B PHQ 1 ? 16 'binding site for PHQ-PTR-02K-ASN-NH2' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 SER A 87 ? SER A 139 . ? 1_555 ? 2 AC1 3 GLN A 93 ? GLN A 145 . ? 1_555 ? 3 AC1 3 HOH D . ? HOH A 327 . ? 6_445 ? 4 AC2 16 ARG A 15 ? ARG A 67 . ? 1_555 ? 5 AC2 16 ARG A 26 ? ARG A 78 . ? 7_655 ? 6 AC2 16 ARG A 34 ? ARG A 86 . ? 1_555 ? 7 AC2 16 SER A 36 ? SER A 88 . ? 1_555 ? 8 AC2 16 SER A 38 ? SER A 90 . ? 1_555 ? 9 AC2 16 SER A 44 ? SER A 96 . ? 1_555 ? 10 AC2 16 HIS A 55 ? HIS A 107 . ? 1_555 ? 11 AC2 16 PHE A 56 ? PHE A 108 . ? 1_555 ? 12 AC2 16 LYS A 57 ? LYS A 109 . ? 1_555 ? 13 AC2 16 LEU A 68 ? LEU A 120 . ? 1_555 ? 14 AC2 16 TRP A 69 ? TRP A 121 . ? 1_555 ? 15 AC2 16 HOH D . ? HOH A 301 . ? 7_655 ? 16 AC2 16 HOH D . ? HOH A 307 . ? 1_555 ? 17 AC2 16 HOH E . ? HOH B 101 . ? 1_555 ? 18 AC2 16 HOH E . ? HOH B 102 . ? 1_555 ? 19 AC2 16 HOH E . ? HOH B 103 . ? 1_555 ? # _pdbx_entry_details.entry_id 4P9V _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 80 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 80 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 80 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.92 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.62 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 55 ? ? -26.39 99.55 2 1 TRP A 121 ? ? -127.43 -67.10 3 1 VAL A 122 ? ? -135.67 -45.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 53 ? A ILE 1 2 1 Y 1 A VAL 154 ? A VAL 102 3 1 Y 1 A PRO 155 ? A PRO 103 4 1 Y 1 A GLN 156 ? A GLN 104 5 1 Y 1 A GLN 157 ? A GLN 105 6 1 Y 1 A PRO 158 ? A PRO 106 7 1 Y 1 A THR 159 ? A THR 107 8 1 Y 1 A TYR 160 ? A TYR 108 9 1 Y 1 A VAL 161 ? A VAL 109 10 1 Y 1 A GLN 162 ? A GLN 110 11 1 Y 1 A ALA 163 ? A ALA 111 12 1 Y 1 A HIS 164 ? A HIS 112 13 1 Y 1 A HIS 165 ? A HIS 113 14 1 Y 1 A HIS 166 ? A HIS 114 15 1 Y 1 A HIS 167 ? A HIS 115 16 1 Y 1 A HIS 168 ? A HIS 116 17 1 Y 1 A HIS 169 ? A HIS 117 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 02K O O N N 1 02K CD C N N 2 02K CG C N N 3 02K CE C N N 4 02K CB C N N 5 02K CH C N N 6 02K N N N N 7 02K C C N N 8 02K CA C N N 9 02K HAP H N N 10 02K HAPA H N N 11 02K HAQ H N N 12 02K HAQA H N N 13 02K HAR H N N 14 02K HARA H N N 15 02K HB1 H N N 16 02K HB2 H N N 17 02K HAT H N N 18 02K HATA H N N 19 02K H H N N 20 02K OXT O N N 21 02K HXT H N N 22 02K H2 H N N 23 ALA N N N N 24 ALA CA C N S 25 ALA C C N N 26 ALA O O N N 27 ALA CB C N N 28 ALA OXT O N N 29 ALA H H N N 30 ALA H2 H N N 31 ALA HA H N N 32 ALA HB1 H N N 33 ALA HB2 H N N 34 ALA HB3 H N N 35 ALA HXT H N N 36 ARG N N N N 37 ARG CA C N S 38 ARG C C N N 39 ARG O O N N 40 ARG CB C N N 41 ARG CG C N N 42 ARG CD C N N 43 ARG NE N N N 44 ARG CZ C N N 45 ARG NH1 N N N 46 ARG NH2 N N N 47 ARG OXT O N N 48 ARG H H N N 49 ARG H2 H N N 50 ARG HA H N N 51 ARG HB2 H N N 52 ARG HB3 H N N 53 ARG HG2 H N N 54 ARG HG3 H N N 55 ARG HD2 H N N 56 ARG HD3 H N N 57 ARG HE H N N 58 ARG HH11 H N N 59 ARG HH12 H N N 60 ARG HH21 H N N 61 ARG HH22 H N N 62 ARG HXT H N N 63 ASN N N N N 64 ASN CA C N S 65 ASN C C N N 66 ASN O O N N 67 ASN CB C N N 68 ASN CG C N N 69 ASN OD1 O N N 70 ASN ND2 N N N 71 ASN OXT O N N 72 ASN H H N N 73 ASN H2 H N N 74 ASN HA H N N 75 ASN HB2 H N N 76 ASN HB3 H N N 77 ASN HD21 H N N 78 ASN HD22 H N N 79 ASN HXT H N N 80 ASP N N N N 81 ASP CA C N S 82 ASP C C N N 83 ASP O O N N 84 ASP CB C N N 85 ASP CG C N N 86 ASP OD1 O N N 87 ASP OD2 O N N 88 ASP OXT O N N 89 ASP H H N N 90 ASP H2 H N N 91 ASP HA H N N 92 ASP HB2 H N N 93 ASP HB3 H N N 94 ASP HD2 H N N 95 ASP HXT H N N 96 CL CL CL N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 NH2 N N N N 260 NH2 HN1 H N N 261 NH2 HN2 H N N 262 PHE N N N N 263 PHE CA C N S 264 PHE C C N N 265 PHE O O N N 266 PHE CB C N N 267 PHE CG C Y N 268 PHE CD1 C Y N 269 PHE CD2 C Y N 270 PHE CE1 C Y N 271 PHE CE2 C Y N 272 PHE CZ C Y N 273 PHE OXT O N N 274 PHE H H N N 275 PHE H2 H N N 276 PHE HA H N N 277 PHE HB2 H N N 278 PHE HB3 H N N 279 PHE HD1 H N N 280 PHE HD2 H N N 281 PHE HE1 H N N 282 PHE HE2 H N N 283 PHE HZ H N N 284 PHE HXT H N N 285 PHQ C1 C N N 286 PHQ O1 O N N 287 PHQ O2 O N N 288 PHQ C2 C N N 289 PHQ C3 C Y N 290 PHQ C4 C Y N 291 PHQ C5 C Y N 292 PHQ C6 C Y N 293 PHQ C7 C Y N 294 PHQ C8 C Y N 295 PHQ CL1 CL N N 296 PHQ H21 H N N 297 PHQ H22 H N N 298 PHQ H41 H N N 299 PHQ H51 H N N 300 PHQ H61 H N N 301 PHQ H71 H N N 302 PHQ H81 H N N 303 PRO N N N N 304 PRO CA C N S 305 PRO C C N N 306 PRO O O N N 307 PRO CB C N N 308 PRO CG C N N 309 PRO CD C N N 310 PRO OXT O N N 311 PRO H H N N 312 PRO HA H N N 313 PRO HB2 H N N 314 PRO HB3 H N N 315 PRO HG2 H N N 316 PRO HG3 H N N 317 PRO HD2 H N N 318 PRO HD3 H N N 319 PRO HXT H N N 320 PTR N N N N 321 PTR CA C N S 322 PTR C C N N 323 PTR O O N N 324 PTR OXT O N N 325 PTR CB C N N 326 PTR CG C Y N 327 PTR CD1 C Y N 328 PTR CD2 C Y N 329 PTR CE1 C Y N 330 PTR CE2 C Y N 331 PTR CZ C Y N 332 PTR OH O N N 333 PTR P P N N 334 PTR O1P O N N 335 PTR O2P O N N 336 PTR O3P O N N 337 PTR H H N N 338 PTR H2 H N N 339 PTR HA H N N 340 PTR HXT H N N 341 PTR HB2 H N N 342 PTR HB3 H N N 343 PTR HD1 H N N 344 PTR HD2 H N N 345 PTR HE1 H N N 346 PTR HE2 H N N 347 PTR HO2P H N N 348 PTR HO3P H N N 349 SER N N N N 350 SER CA C N S 351 SER C C N N 352 SER O O N N 353 SER CB C N N 354 SER OG O N N 355 SER OXT O N N 356 SER H H N N 357 SER H2 H N N 358 SER HA H N N 359 SER HB2 H N N 360 SER HB3 H N N 361 SER HG H N N 362 SER HXT H N N 363 THR N N N N 364 THR CA C N S 365 THR C C N N 366 THR O O N N 367 THR CB C N R 368 THR OG1 O N N 369 THR CG2 C N N 370 THR OXT O N N 371 THR H H N N 372 THR H2 H N N 373 THR HA H N N 374 THR HB H N N 375 THR HG1 H N N 376 THR HG21 H N N 377 THR HG22 H N N 378 THR HG23 H N N 379 THR HXT H N N 380 TRP N N N N 381 TRP CA C N S 382 TRP C C N N 383 TRP O O N N 384 TRP CB C N N 385 TRP CG C Y N 386 TRP CD1 C Y N 387 TRP CD2 C Y N 388 TRP NE1 N Y N 389 TRP CE2 C Y N 390 TRP CE3 C Y N 391 TRP CZ2 C Y N 392 TRP CZ3 C Y N 393 TRP CH2 C Y N 394 TRP OXT O N N 395 TRP H H N N 396 TRP H2 H N N 397 TRP HA H N N 398 TRP HB2 H N N 399 TRP HB3 H N N 400 TRP HD1 H N N 401 TRP HE1 H N N 402 TRP HE3 H N N 403 TRP HZ2 H N N 404 TRP HZ3 H N N 405 TRP HH2 H N N 406 TRP HXT H N N 407 TYR N N N N 408 TYR CA C N S 409 TYR C C N N 410 TYR O O N N 411 TYR CB C N N 412 TYR CG C Y N 413 TYR CD1 C Y N 414 TYR CD2 C Y N 415 TYR CE1 C Y N 416 TYR CE2 C Y N 417 TYR CZ C Y N 418 TYR OH O N N 419 TYR OXT O N N 420 TYR H H N N 421 TYR H2 H N N 422 TYR HA H N N 423 TYR HB2 H N N 424 TYR HB3 H N N 425 TYR HD1 H N N 426 TYR HD2 H N N 427 TYR HE1 H N N 428 TYR HE2 H N N 429 TYR HH H N N 430 TYR HXT H N N 431 VAL N N N N 432 VAL CA C N S 433 VAL C C N N 434 VAL O O N N 435 VAL CB C N N 436 VAL CG1 C N N 437 VAL CG2 C N N 438 VAL OXT O N N 439 VAL H H N N 440 VAL H2 H N N 441 VAL HA H N N 442 VAL HB H N N 443 VAL HG11 H N N 444 VAL HG12 H N N 445 VAL HG13 H N N 446 VAL HG21 H N N 447 VAL HG22 H N N 448 VAL HG23 H N N 449 VAL HXT H N N 450 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 02K C O doub N N 1 02K CE CD sing N N 2 02K CD CG sing N N 3 02K CD HAP sing N N 4 02K CD HAPA sing N N 5 02K CG CB sing N N 6 02K CG HAQ sing N N 7 02K CG HAQA sing N N 8 02K CE CH sing N N 9 02K CE HAR sing N N 10 02K CE HARA sing N N 11 02K CA CB sing N N 12 02K CB HB1 sing N N 13 02K CB HB2 sing N N 14 02K CH CA sing N N 15 02K CH HAT sing N N 16 02K CH HATA sing N N 17 02K N CA sing N N 18 02K N H sing N N 19 02K CA C sing N N 20 02K C OXT sing N N 21 02K OXT HXT sing N N 22 02K N H2 sing N N 23 ALA N CA sing N N 24 ALA N H sing N N 25 ALA N H2 sing N N 26 ALA CA C sing N N 27 ALA CA CB sing N N 28 ALA CA HA sing N N 29 ALA C O doub N N 30 ALA C OXT sing N N 31 ALA CB HB1 sing N N 32 ALA CB HB2 sing N N 33 ALA CB HB3 sing N N 34 ALA OXT HXT sing N N 35 ARG N CA sing N N 36 ARG N H sing N N 37 ARG N H2 sing N N 38 ARG CA C sing N N 39 ARG CA CB sing N N 40 ARG CA HA sing N N 41 ARG C O doub N N 42 ARG C OXT sing N N 43 ARG CB CG sing N N 44 ARG CB HB2 sing N N 45 ARG CB HB3 sing N N 46 ARG CG CD sing N N 47 ARG CG HG2 sing N N 48 ARG CG HG3 sing N N 49 ARG CD NE sing N N 50 ARG CD HD2 sing N N 51 ARG CD HD3 sing N N 52 ARG NE CZ sing N N 53 ARG NE HE sing N N 54 ARG CZ NH1 sing N N 55 ARG CZ NH2 doub N N 56 ARG NH1 HH11 sing N N 57 ARG NH1 HH12 sing N N 58 ARG NH2 HH21 sing N N 59 ARG NH2 HH22 sing N N 60 ARG OXT HXT sing N N 61 ASN N CA sing N N 62 ASN N H sing N N 63 ASN N H2 sing N N 64 ASN CA C sing N N 65 ASN CA CB sing N N 66 ASN CA HA sing N N 67 ASN C O doub N N 68 ASN C OXT sing N N 69 ASN CB CG sing N N 70 ASN CB HB2 sing N N 71 ASN CB HB3 sing N N 72 ASN CG OD1 doub N N 73 ASN CG ND2 sing N N 74 ASN ND2 HD21 sing N N 75 ASN ND2 HD22 sing N N 76 ASN OXT HXT sing N N 77 ASP N CA sing N N 78 ASP N H sing N N 79 ASP N H2 sing N N 80 ASP CA C sing N N 81 ASP CA CB sing N N 82 ASP CA HA sing N N 83 ASP C O doub N N 84 ASP C OXT sing N N 85 ASP CB CG sing N N 86 ASP CB HB2 sing N N 87 ASP CB HB3 sing N N 88 ASP CG OD1 doub N N 89 ASP CG OD2 sing N N 90 ASP OD2 HD2 sing N N 91 ASP OXT HXT sing N N 92 GLN N CA sing N N 93 GLN N H sing N N 94 GLN N H2 sing N N 95 GLN CA C sing N N 96 GLN CA CB sing N N 97 GLN CA HA sing N N 98 GLN C O doub N N 99 GLN C OXT sing N N 100 GLN CB CG sing N N 101 GLN CB HB2 sing N N 102 GLN CB HB3 sing N N 103 GLN CG CD sing N N 104 GLN CG HG2 sing N N 105 GLN CG HG3 sing N N 106 GLN CD OE1 doub N N 107 GLN CD NE2 sing N N 108 GLN NE2 HE21 sing N N 109 GLN NE2 HE22 sing N N 110 GLN OXT HXT sing N N 111 GLU N CA sing N N 112 GLU N H sing N N 113 GLU N H2 sing N N 114 GLU CA C sing N N 115 GLU CA CB sing N N 116 GLU CA HA sing N N 117 GLU C O doub N N 118 GLU C OXT sing N N 119 GLU CB CG sing N N 120 GLU CB HB2 sing N N 121 GLU CB HB3 sing N N 122 GLU CG CD sing N N 123 GLU CG HG2 sing N N 124 GLU CG HG3 sing N N 125 GLU CD OE1 doub N N 126 GLU CD OE2 sing N N 127 GLU OE2 HE2 sing N N 128 GLU OXT HXT sing N N 129 GLY N CA sing N N 130 GLY N H sing N N 131 GLY N H2 sing N N 132 GLY CA C sing N N 133 GLY CA HA2 sing N N 134 GLY CA HA3 sing N N 135 GLY C O doub N N 136 GLY C OXT sing N N 137 GLY OXT HXT sing N N 138 HIS N CA sing N N 139 HIS N H sing N N 140 HIS N H2 sing N N 141 HIS CA C sing N N 142 HIS CA CB sing N N 143 HIS CA HA sing N N 144 HIS C O doub N N 145 HIS C OXT sing N N 146 HIS CB CG sing N N 147 HIS CB HB2 sing N N 148 HIS CB HB3 sing N N 149 HIS CG ND1 sing Y N 150 HIS CG CD2 doub Y N 151 HIS ND1 CE1 doub Y N 152 HIS ND1 HD1 sing N N 153 HIS CD2 NE2 sing Y N 154 HIS CD2 HD2 sing N N 155 HIS CE1 NE2 sing Y N 156 HIS CE1 HE1 sing N N 157 HIS NE2 HE2 sing N N 158 HIS OXT HXT sing N N 159 HOH O H1 sing N N 160 HOH O H2 sing N N 161 ILE N CA sing N N 162 ILE N H sing N N 163 ILE N H2 sing N N 164 ILE CA C sing N N 165 ILE CA CB sing N N 166 ILE CA HA sing N N 167 ILE C O doub N N 168 ILE C OXT sing N N 169 ILE CB CG1 sing N N 170 ILE CB CG2 sing N N 171 ILE CB HB sing N N 172 ILE CG1 CD1 sing N N 173 ILE CG1 HG12 sing N N 174 ILE CG1 HG13 sing N N 175 ILE CG2 HG21 sing N N 176 ILE CG2 HG22 sing N N 177 ILE CG2 HG23 sing N N 178 ILE CD1 HD11 sing N N 179 ILE CD1 HD12 sing N N 180 ILE CD1 HD13 sing N N 181 ILE OXT HXT sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 NH2 N HN1 sing N N 247 NH2 N HN2 sing N N 248 PHE N CA sing N N 249 PHE N H sing N N 250 PHE N H2 sing N N 251 PHE CA C sing N N 252 PHE CA CB sing N N 253 PHE CA HA sing N N 254 PHE C O doub N N 255 PHE C OXT sing N N 256 PHE CB CG sing N N 257 PHE CB HB2 sing N N 258 PHE CB HB3 sing N N 259 PHE CG CD1 doub Y N 260 PHE CG CD2 sing Y N 261 PHE CD1 CE1 sing Y N 262 PHE CD1 HD1 sing N N 263 PHE CD2 CE2 doub Y N 264 PHE CD2 HD2 sing N N 265 PHE CE1 CZ doub Y N 266 PHE CE1 HE1 sing N N 267 PHE CE2 CZ sing Y N 268 PHE CE2 HE2 sing N N 269 PHE CZ HZ sing N N 270 PHE OXT HXT sing N N 271 PHQ C1 O1 doub N N 272 PHQ C1 O2 sing N N 273 PHQ C1 CL1 sing N N 274 PHQ O2 C2 sing N N 275 PHQ C2 C3 sing N N 276 PHQ C2 H21 sing N N 277 PHQ C2 H22 sing N N 278 PHQ C3 C4 doub Y N 279 PHQ C3 C8 sing Y N 280 PHQ C4 C5 sing Y N 281 PHQ C4 H41 sing N N 282 PHQ C5 C6 doub Y N 283 PHQ C5 H51 sing N N 284 PHQ C6 C7 sing Y N 285 PHQ C6 H61 sing N N 286 PHQ C7 C8 doub Y N 287 PHQ C7 H71 sing N N 288 PHQ C8 H81 sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 PTR N CA sing N N 307 PTR N H sing N N 308 PTR N H2 sing N N 309 PTR CA C sing N N 310 PTR CA CB sing N N 311 PTR CA HA sing N N 312 PTR C O doub N N 313 PTR C OXT sing N N 314 PTR OXT HXT sing N N 315 PTR CB CG sing N N 316 PTR CB HB2 sing N N 317 PTR CB HB3 sing N N 318 PTR CG CD1 doub Y N 319 PTR CG CD2 sing Y N 320 PTR CD1 CE1 sing Y N 321 PTR CD1 HD1 sing N N 322 PTR CD2 CE2 doub Y N 323 PTR CD2 HD2 sing N N 324 PTR CE1 CZ doub Y N 325 PTR CE1 HE1 sing N N 326 PTR CE2 CZ sing Y N 327 PTR CE2 HE2 sing N N 328 PTR CZ OH sing N N 329 PTR OH P sing N N 330 PTR P O1P doub N N 331 PTR P O2P sing N N 332 PTR P O3P sing N N 333 PTR O2P HO2P sing N N 334 PTR O3P HO3P sing N N 335 SER N CA sing N N 336 SER N H sing N N 337 SER N H2 sing N N 338 SER CA C sing N N 339 SER CA CB sing N N 340 SER CA HA sing N N 341 SER C O doub N N 342 SER C OXT sing N N 343 SER CB OG sing N N 344 SER CB HB2 sing N N 345 SER CB HB3 sing N N 346 SER OG HG sing N N 347 SER OXT HXT sing N N 348 THR N CA sing N N 349 THR N H sing N N 350 THR N H2 sing N N 351 THR CA C sing N N 352 THR CA CB sing N N 353 THR CA HA sing N N 354 THR C O doub N N 355 THR C OXT sing N N 356 THR CB OG1 sing N N 357 THR CB CG2 sing N N 358 THR CB HB sing N N 359 THR OG1 HG1 sing N N 360 THR CG2 HG21 sing N N 361 THR CG2 HG22 sing N N 362 THR CG2 HG23 sing N N 363 THR OXT HXT sing N N 364 TRP N CA sing N N 365 TRP N H sing N N 366 TRP N H2 sing N N 367 TRP CA C sing N N 368 TRP CA CB sing N N 369 TRP CA HA sing N N 370 TRP C O doub N N 371 TRP C OXT sing N N 372 TRP CB CG sing N N 373 TRP CB HB2 sing N N 374 TRP CB HB3 sing N N 375 TRP CG CD1 doub Y N 376 TRP CG CD2 sing Y N 377 TRP CD1 NE1 sing Y N 378 TRP CD1 HD1 sing N N 379 TRP CD2 CE2 doub Y N 380 TRP CD2 CE3 sing Y N 381 TRP NE1 CE2 sing Y N 382 TRP NE1 HE1 sing N N 383 TRP CE2 CZ2 sing Y N 384 TRP CE3 CZ3 doub Y N 385 TRP CE3 HE3 sing N N 386 TRP CZ2 CH2 doub Y N 387 TRP CZ2 HZ2 sing N N 388 TRP CZ3 CH2 sing Y N 389 TRP CZ3 HZ3 sing N N 390 TRP CH2 HH2 sing N N 391 TRP OXT HXT sing N N 392 TYR N CA sing N N 393 TYR N H sing N N 394 TYR N H2 sing N N 395 TYR CA C sing N N 396 TYR CA CB sing N N 397 TYR CA HA sing N N 398 TYR C O doub N N 399 TYR C OXT sing N N 400 TYR CB CG sing N N 401 TYR CB HB2 sing N N 402 TYR CB HB3 sing N N 403 TYR CG CD1 doub Y N 404 TYR CG CD2 sing Y N 405 TYR CD1 CE1 sing Y N 406 TYR CD1 HD1 sing N N 407 TYR CD2 CE2 doub Y N 408 TYR CD2 HD2 sing N N 409 TYR CE1 CZ doub Y N 410 TYR CE1 HE1 sing N N 411 TYR CE2 CZ sing Y N 412 TYR CE2 HE2 sing N N 413 TYR CZ OH sing N N 414 TYR OH HH sing N N 415 TYR OXT HXT sing N N 416 VAL N CA sing N N 417 VAL N H sing N N 418 VAL N H2 sing N N 419 VAL CA C sing N N 420 VAL CA CB sing N N 421 VAL CA HA sing N N 422 VAL C O doub N N 423 VAL C OXT sing N N 424 VAL CB CG1 sing N N 425 VAL CB CG2 sing N N 426 VAL CB HB sing N N 427 VAL CG1 HG11 sing N N 428 VAL CG1 HG12 sing N N 429 VAL CG1 HG13 sing N N 430 VAL CG2 HG21 sing N N 431 VAL CG2 HG22 sing N N 432 VAL CG2 HG23 sing N N 433 VAL OXT HXT sing N N 434 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'GM 84965' 1 'National Science Foundation (NSF, United States)' 'United States' 'CHE 0750329' 2 'Robert A. Welch Foundation' 'United States' F-652 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3S8O _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4P9V _atom_sites.fract_transf_matrix[1][1] 0.023846 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023846 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009198 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O P S # loop_