data_4PA2 # _entry.id 4PA2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4PA2 WWPDB D_1000201010 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2016-11-09 _pdbx_database_PDB_obs_spr.pdb_id 5GT4 _pdbx_database_PDB_obs_spr.replace_pdb_id 4PA2 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4PA2 _pdbx_database_status.recvd_initial_deposition_date 2014-04-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Takimoto-Kamimura, M.' _audit_author.pdbx_ordinal 1 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher . _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country ? _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full . _citation.journal_issue . _citation.journal_volume . _citation.language . _citation.page_first . _citation.page_last . _citation.title ;Crystal structure of the human vitamin D receptor ligand binding domain complexed with Crystal structure of the human vitamin D receptor ligand binding domain complexed ; _citation.year . _citation.database_id_CSD . _citation.pdbx_database_id_DOI . _citation.pdbx_database_id_PubMed . _citation.unpublished_flag . # _citation_author.citation_id primary _citation_author.name 'Takimoto-Kamimura, M.' _citation_author.ordinal 1 # _cell.entry_id 4PA2 _cell.length_a 44.657 _cell.length_b 51.833 _cell.length_c 131.513 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4PA2 _symmetry.cell_setting . _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall . _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M . # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor' 29805.342 1 ? ? 'UNP Residues 118-427' ? 2 non-polymer syn '4-{[(1R,2S,3R,5Z,7E,14beta,17alpha)-1,3,25-trihydroxy-9,10-secocholesta-5,7,10-trien-2-yl]oxy}butanenitrile' 499.725 1 ? ? ? ? 3 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'VDR,1,25-dihydroxyvitamin D3 receptor,Nuclear receptor subfamily 1 group I member 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSVTLELSQLSMLPHLADLVSYSIQKVIGF AKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLN LHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCL SFQPECSMKLTPLVLEVFGNEIS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSVTLELSQLSMLPHLADLVSYSIQKVIGF AKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLN LHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCL SFQPECSMKLTPLVLEVFGNEIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASP n 1 6 SER n 1 7 LEU n 1 8 ARG n 1 9 PRO n 1 10 LYS n 1 11 LEU n 1 12 SER n 1 13 GLU n 1 14 GLU n 1 15 GLN n 1 16 GLN n 1 17 ARG n 1 18 ILE n 1 19 ILE n 1 20 ALA n 1 21 ILE n 1 22 LEU n 1 23 LEU n 1 24 ASP n 1 25 ALA n 1 26 HIS n 1 27 HIS n 1 28 LYS n 1 29 THR n 1 30 TYR n 1 31 ASP n 1 32 PRO n 1 33 THR n 1 34 TYR n 1 35 SER n 1 36 ASP n 1 37 PHE n 1 38 CYS n 1 39 GLN n 1 40 PHE n 1 41 ARG n 1 42 PRO n 1 43 PRO n 1 44 VAL n 1 45 ARG n 1 46 VAL n 1 47 ASN n 1 48 ASP n 1 49 GLY n 1 50 GLY n 1 51 GLY n 1 52 SER n 1 53 VAL n 1 54 THR n 1 55 LEU n 1 56 GLU n 1 57 LEU n 1 58 SER n 1 59 GLN n 1 60 LEU n 1 61 SER n 1 62 MET n 1 63 LEU n 1 64 PRO n 1 65 HIS n 1 66 LEU n 1 67 ALA n 1 68 ASP n 1 69 LEU n 1 70 VAL n 1 71 SER n 1 72 TYR n 1 73 SER n 1 74 ILE n 1 75 GLN n 1 76 LYS n 1 77 VAL n 1 78 ILE n 1 79 GLY n 1 80 PHE n 1 81 ALA n 1 82 LYS n 1 83 MET n 1 84 ILE n 1 85 PRO n 1 86 GLY n 1 87 PHE n 1 88 ARG n 1 89 ASP n 1 90 LEU n 1 91 THR n 1 92 SER n 1 93 GLU n 1 94 ASP n 1 95 GLN n 1 96 ILE n 1 97 VAL n 1 98 LEU n 1 99 LEU n 1 100 LYS n 1 101 SER n 1 102 SER n 1 103 ALA n 1 104 ILE n 1 105 GLU n 1 106 VAL n 1 107 ILE n 1 108 MET n 1 109 LEU n 1 110 ARG n 1 111 SER n 1 112 ASN n 1 113 GLU n 1 114 SER n 1 115 PHE n 1 116 THR n 1 117 MET n 1 118 ASP n 1 119 ASP n 1 120 MET n 1 121 SER n 1 122 TRP n 1 123 THR n 1 124 CYS n 1 125 GLY n 1 126 ASN n 1 127 GLN n 1 128 ASP n 1 129 TYR n 1 130 LYS n 1 131 TYR n 1 132 ARG n 1 133 VAL n 1 134 SER n 1 135 ASP n 1 136 VAL n 1 137 THR n 1 138 LYS n 1 139 ALA n 1 140 GLY n 1 141 HIS n 1 142 SER n 1 143 LEU n 1 144 GLU n 1 145 LEU n 1 146 ILE n 1 147 GLU n 1 148 PRO n 1 149 LEU n 1 150 ILE n 1 151 LYS n 1 152 PHE n 1 153 GLN n 1 154 VAL n 1 155 GLY n 1 156 LEU n 1 157 LYS n 1 158 LYS n 1 159 LEU n 1 160 ASN n 1 161 LEU n 1 162 HIS n 1 163 GLU n 1 164 GLU n 1 165 GLU n 1 166 HIS n 1 167 VAL n 1 168 LEU n 1 169 LEU n 1 170 MET n 1 171 ALA n 1 172 ILE n 1 173 CYS n 1 174 ILE n 1 175 VAL n 1 176 SER n 1 177 PRO n 1 178 ASP n 1 179 ARG n 1 180 PRO n 1 181 GLY n 1 182 VAL n 1 183 GLN n 1 184 ASP n 1 185 ALA n 1 186 ALA n 1 187 LEU n 1 188 ILE n 1 189 GLU n 1 190 ALA n 1 191 ILE n 1 192 GLN n 1 193 ASP n 1 194 ARG n 1 195 LEU n 1 196 SER n 1 197 ASN n 1 198 THR n 1 199 LEU n 1 200 GLN n 1 201 THR n 1 202 TYR n 1 203 ILE n 1 204 ARG n 1 205 CYS n 1 206 ARG n 1 207 HIS n 1 208 PRO n 1 209 PRO n 1 210 PRO n 1 211 GLY n 1 212 SER n 1 213 HIS n 1 214 LEU n 1 215 LEU n 1 216 TYR n 1 217 ALA n 1 218 LYS n 1 219 MET n 1 220 ILE n 1 221 GLN n 1 222 LYS n 1 223 LEU n 1 224 ALA n 1 225 ASP n 1 226 LEU n 1 227 ARG n 1 228 SER n 1 229 LEU n 1 230 ASN n 1 231 GLU n 1 232 GLU n 1 233 HIS n 1 234 SER n 1 235 LYS n 1 236 GLN n 1 237 TYR n 1 238 ARG n 1 239 CYS n 1 240 LEU n 1 241 SER n 1 242 PHE n 1 243 GLN n 1 244 PRO n 1 245 GLU n 1 246 CYS n 1 247 SER n 1 248 MET n 1 249 LYS n 1 250 LEU n 1 251 THR n 1 252 PRO n 1 253 LEU n 1 254 VAL n 1 255 LEU n 1 256 GLU n 1 257 VAL n 1 258 PHE n 1 259 GLY n 1 260 ASN n 1 261 GLU n 1 262 ILE n 1 263 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'VDR, NR1I1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VDR_HUMAN _struct_ref.pdbx_db_accession P11473 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMM DSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNE SFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQD RLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS ; _struct_ref.pdbx_align_begin 118 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4PA2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11473 _struct_ref_seq.db_align_beg 118 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 427 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 118 _struct_ref_seq.pdbx_auth_seq_align_end 427 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4PA2 GLY A 1 ? UNP P11473 ? ? 'expression tag' 114 1 1 4PA2 SER A 2 ? UNP P11473 ? ? 'expression tag' 115 2 1 4PA2 HIS A 3 ? UNP P11473 ? ? 'expression tag' 116 3 1 4PA2 MET A 4 ? UNP P11473 ? ? 'expression tag' 117 4 1 4PA2 ? A ? ? UNP P11473 SER 165 deletion ? 5 1 4PA2 ? A ? ? UNP P11473 HIS 166 deletion ? 6 1 4PA2 ? A ? ? UNP P11473 PRO 167 deletion ? 7 1 4PA2 ? A ? ? UNP P11473 SER 168 deletion ? 8 1 4PA2 ? A ? ? UNP P11473 ARG 169 deletion ? 9 1 4PA2 ? A ? ? UNP P11473 PRO 170 deletion ? 10 1 4PA2 ? A ? ? UNP P11473 ASN 171 deletion ? 11 1 4PA2 ? A ? ? UNP P11473 SER 172 deletion ? 12 1 4PA2 ? A ? ? UNP P11473 ARG 173 deletion ? 13 1 4PA2 ? A ? ? UNP P11473 HIS 174 deletion ? 14 1 4PA2 ? A ? ? UNP P11473 THR 175 deletion ? 15 1 4PA2 ? A ? ? UNP P11473 PRO 176 deletion ? 16 1 4PA2 ? A ? ? UNP P11473 SER 177 deletion ? 17 1 4PA2 ? A ? ? UNP P11473 PHE 178 deletion ? 18 1 4PA2 ? A ? ? UNP P11473 SER 179 deletion ? 19 1 4PA2 ? A ? ? UNP P11473 GLY 180 deletion ? 20 1 4PA2 ? A ? ? UNP P11473 ASP 181 deletion ? 21 1 4PA2 ? A ? ? UNP P11473 SER 182 deletion ? 22 1 4PA2 ? A ? ? UNP P11473 SER 183 deletion ? 23 1 4PA2 ? A ? ? UNP P11473 SER 184 deletion ? 24 1 4PA2 ? A ? ? UNP P11473 SER 185 deletion ? 25 1 4PA2 ? A ? ? UNP P11473 CYS 186 deletion ? 26 1 4PA2 ? A ? ? UNP P11473 SER 187 deletion ? 27 1 4PA2 ? A ? ? UNP P11473 ASP 188 deletion ? 28 1 4PA2 ? A ? ? UNP P11473 HIS 189 deletion ? 29 1 4PA2 ? A ? ? UNP P11473 CYS 190 deletion ? 30 1 4PA2 ? A ? ? UNP P11473 ILE 191 deletion ? 31 1 4PA2 ? A ? ? UNP P11473 THR 192 deletion ? 32 1 4PA2 ? A ? ? UNP P11473 SER 193 deletion ? 33 1 4PA2 ? A ? ? UNP P11473 SER 194 deletion ? 34 1 4PA2 ? A ? ? UNP P11473 ASP 195 deletion ? 35 1 4PA2 ? A ? ? UNP P11473 MET 196 deletion ? 36 1 4PA2 ? A ? ? UNP P11473 MET 197 deletion ? 37 1 4PA2 ? A ? ? UNP P11473 ASP 198 deletion ? 38 1 4PA2 ? A ? ? UNP P11473 SER 199 deletion ? 39 1 4PA2 ? A ? ? UNP P11473 SER 200 deletion ? 40 1 4PA2 ? A ? ? UNP P11473 SER 201 deletion ? 41 1 4PA2 ? A ? ? UNP P11473 PHE 202 deletion ? 42 1 4PA2 ? A ? ? UNP P11473 SER 203 deletion ? 43 1 4PA2 ? A ? ? UNP P11473 ASN 204 deletion ? 44 1 4PA2 ? A ? ? UNP P11473 LEU 205 deletion ? 45 1 4PA2 ? A ? ? UNP P11473 ASP 206 deletion ? 46 1 4PA2 ? A ? ? UNP P11473 LEU 207 deletion ? 47 1 4PA2 ? A ? ? UNP P11473 SER 208 deletion ? 48 1 4PA2 ? A ? ? UNP P11473 GLU 209 deletion ? 49 1 4PA2 ? A ? ? UNP P11473 GLU 210 deletion ? 50 1 4PA2 ? A ? ? UNP P11473 ASP 211 deletion ? 51 1 4PA2 ? A ? ? UNP P11473 SER 212 deletion ? 52 1 4PA2 ? A ? ? UNP P11473 ASP 213 deletion ? 53 1 4PA2 ? A ? ? UNP P11473 ASP 214 deletion ? 54 1 4PA2 ? A ? ? UNP P11473 PRO 215 deletion ? 55 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2KB non-polymer . '4-{[(1R,2S,3R,5Z,7E,14beta,17alpha)-1,3,25-trihydroxy-9,10-secocholesta-5,7,10-trien-2-yl]oxy}butanenitrile' ? 'C31 H49 N O4' 499.725 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4PA2 _exptl.crystals_number 1 _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 51.83 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details '50mM Mes, 1.4M ammonium sulphate' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2014-03-14 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95370 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 0.95370 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate . _reflns.entry_id 4PA2 _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 1.995 _reflns.d_resolution_low 50.0 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all ? _reflns.number_obs 21528 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F . _reflns.observed_criterion_sigma_I . _reflns.percent_possible_obs 99.9 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs 0.113 _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value . _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 14.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.995 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all . _reflns_shell.meanI_over_sigI_obs 4.9 _reflns_shell.number_measured_all . _reflns_shell.number_measured_obs . _reflns_shell.number_possible . _reflns_shell.number_unique_all . _reflns_shell.number_unique_obs . _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs . _reflns_shell.Rmerge_F_all . _reflns_shell.Rmerge_F_obs . _reflns_shell.Rmerge_I_all . _reflns_shell.Rmerge_I_obs . _reflns_shell.meanI_over_sigI_gt . _reflns_shell.meanI_over_uI_all . _reflns_shell.meanI_over_uI_gt . _reflns_shell.number_measured_gt . _reflns_shell.number_unique_gt . _reflns_shell.percent_possible_gt . _reflns_shell.Rmerge_F_gt . _reflns_shell.Rmerge_I_gt . _reflns_shell.pdbx_redundancy 7.0 _reflns_shell.pdbx_Rsym_value . _reflns_shell.pdbx_chi_squared . _reflns_shell.pdbx_netI_over_sigmaI_all . _reflns_shell.pdbx_netI_over_sigmaI_obs . _reflns_shell.pdbx_Rrim_I_all . _reflns_shell.pdbx_Rpim_I_all . _reflns_shell.pdbx_rejects . _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.aniso_B[1][1] -0.71 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 0.13 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.58 _refine.B_iso_max . _refine.B_iso_mean 30.714 _refine.B_iso_min . _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max . _refine.diff_density_max_esd . _refine.diff_density_min . _refine.diff_density_min_esd . _refine.diff_density_rms . _refine.diff_density_rms_esd . _refine.entry_id 4PA2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details . _refine.ls_abs_structure_Flack . _refine.ls_abs_structure_Flack_esd . _refine.ls_abs_structure_Rogers . _refine.ls_abs_structure_Rogers_esd . _refine.ls_d_res_high 1.995 _refine.ls_d_res_low 42.32 _refine.ls_extinction_coef . _refine.ls_extinction_coef_esd . _refine.ls_extinction_expression . _refine.ls_extinction_method . _refine.ls_goodness_of_fit_all . _refine.ls_goodness_of_fit_all_esd . _refine.ls_goodness_of_fit_obs . _refine.ls_goodness_of_fit_obs_esd . _refine.ls_hydrogen_treatment . _refine.ls_matrix_type . _refine.ls_number_constraints . _refine.ls_number_parameters . _refine.ls_number_reflns_all . _refine.ls_number_reflns_obs 19791 _refine.ls_number_reflns_R_free 1065 _refine.ls_number_reflns_R_work . _refine.ls_number_restraints . _refine.ls_percent_reflns_obs 96.92 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all . _refine.ls_R_factor_obs 0.19705 _refine.ls_R_factor_R_free 0.23936 _refine.ls_R_factor_R_free_error . _refine.ls_R_factor_R_free_error_details . _refine.ls_R_factor_R_work 0.19485 _refine.ls_R_Fsqd_factor_obs . _refine.ls_R_I_factor_obs . _refine.ls_redundancy_reflns_all . _refine.ls_redundancy_reflns_obs . _refine.ls_restrained_S_all . _refine.ls_restrained_S_obs . _refine.ls_shift_over_esd_max . _refine.ls_shift_over_esd_mean . _refine.ls_structure_factor_coef . _refine.ls_weighting_details . _refine.ls_weighting_scheme . _refine.ls_wR_factor_all . _refine.ls_wR_factor_obs . _refine.ls_wR_factor_R_free . _refine.ls_wR_factor_R_work . _refine.occupancy_max . _refine.occupancy_min . _refine.overall_SU_B 3.686 _refine.overall_SU_ML 0.105 _refine.overall_SU_R_Cruickshank_DPI . _refine.overall_SU_R_free . _refine.overall_FOM_free_R_set . _refine.overall_FOM_work_R_set . _refine.solvent_model_details MASK _refine.solvent_model_param_bsol . _refine.solvent_model_param_ksol . _refine.ls_R_factor_gt . _refine.ls_goodness_of_fit_gt . _refine.ls_goodness_of_fit_ref . _refine.ls_shift_over_su_max . _refine.ls_shift_over_su_max_lt . _refine.ls_shift_over_su_mean . _refine.ls_shift_over_su_mean_lt . _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F . _refine.pdbx_ls_sigma_Fsqd . _refine.pdbx_data_cutoff_high_absF . _refine.pdbx_data_cutoff_high_rms_absF . _refine.pdbx_data_cutoff_low_absF . _refine.pdbx_isotropic_thermal_model . _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model . _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case . _refine.pdbx_overall_ESU_R 0.174 _refine.pdbx_overall_ESU_R_Free 0.161 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R . _refine.pdbx_density_correlation . _refine.pdbx_pd_number_of_powder_patterns . _refine.pdbx_pd_number_of_points . _refine.pdbx_pd_meas_number_of_points . _refine.pdbx_pd_proc_ls_prof_R_factor . _refine.pdbx_pd_proc_ls_prof_wR_factor . _refine.pdbx_pd_Marquardt_correlation_coeff . _refine.pdbx_pd_Fsqrd_R_factor . _refine.pdbx_pd_ls_matrix_band_width . _refine.pdbx_overall_phase_error . _refine.pdbx_overall_SU_R_free_Cruickshank_DPI . _refine.pdbx_overall_SU_R_free_Blow_DPI . _refine.pdbx_overall_SU_R_Blow_DPI . _refine.pdbx_TLS_residual_ADP_flag . _refine.pdbx_diffrn_id 1 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2026 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 2118 _refine_hist.d_res_high 1.995 _refine_hist.d_res_low 42.32 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' . 0.019 0.019 2126 . r_bond_refined_d . . 'X-RAY DIFFRACTION' . 0.001 0.020 2080 . r_bond_other_d . . 'X-RAY DIFFRACTION' . 2.141 2.003 2881 . r_angle_refined_deg . . 'X-RAY DIFFRACTION' . 1.026 3.000 4810 . r_angle_other_deg . . 'X-RAY DIFFRACTION' . 7.795 5.000 257 . r_dihedral_angle_1_deg . . 'X-RAY DIFFRACTION' . 35.658 24.239 92 . r_dihedral_angle_2_deg . . 'X-RAY DIFFRACTION' . 16.147 15.000 388 . r_dihedral_angle_3_deg . . 'X-RAY DIFFRACTION' . 15.400 15.000 13 . r_dihedral_angle_4_deg . . 'X-RAY DIFFRACTION' . 0.146 0.200 330 . r_chiral_restr . . 'X-RAY DIFFRACTION' . 0.010 0.021 2337 . r_gen_planes_refined . . 'X-RAY DIFFRACTION' . 0.005 0.020 460 . r_gen_planes_other . . 'X-RAY DIFFRACTION' . . . . . r_nbd_refined . . 'X-RAY DIFFRACTION' . . . . . r_nbd_other . . 'X-RAY DIFFRACTION' . . . . . r_nbtor_refined . . 'X-RAY DIFFRACTION' . . . . . r_nbtor_other . . 'X-RAY DIFFRACTION' . . . . . r_xyhbond_nbd_refined . . 'X-RAY DIFFRACTION' . . . . . r_xyhbond_nbd_other . . 'X-RAY DIFFRACTION' . . . . . r_metal_ion_refined . . 'X-RAY DIFFRACTION' . . . . . r_metal_ion_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_vdw_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_vdw_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_hbond_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_hbond_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_metal_ion_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_metal_ion_other . . 'X-RAY DIFFRACTION' . . . . . r_mcbond_it . . 'X-RAY DIFFRACTION' . . . . . r_mcbond_other . . 'X-RAY DIFFRACTION' . . . . . r_mcangle_it . . 'X-RAY DIFFRACTION' . . . . . r_mcangle_other . . 'X-RAY DIFFRACTION' . . . . . r_scbond_it . . 'X-RAY DIFFRACTION' . . . . . r_scbond_other . . 'X-RAY DIFFRACTION' . . . . . r_scangle_it . . 'X-RAY DIFFRACTION' . . . . . r_scangle_other . . 'X-RAY DIFFRACTION' . . . . . r_long_range_B_refined . . 'X-RAY DIFFRACTION' . . . . . r_long_range_B_other . . 'X-RAY DIFFRACTION' . . . . . r_rigid_bond_restr . . 'X-RAY DIFFRACTION' . . . . . r_sphericity_free . . 'X-RAY DIFFRACTION' . . . . . r_sphericity_bonded . . # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.995 _refine_ls_shell.d_res_low 2.047 _refine_ls_shell.number_reflns_all . _refine_ls_shell.number_reflns_obs . _refine_ls_shell.number_reflns_R_free 72 _refine_ls_shell.number_reflns_R_work 1153 _refine_ls_shell.percent_reflns_obs 79.29 _refine_ls_shell.percent_reflns_R_free . _refine_ls_shell.R_factor_all . _refine_ls_shell.R_factor_obs . _refine_ls_shell.R_factor_R_free 0.280 _refine_ls_shell.R_factor_R_free_error . _refine_ls_shell.R_factor_R_work 0.201 _refine_ls_shell.redundancy_reflns_all . _refine_ls_shell.redundancy_reflns_obs . _refine_ls_shell.wR_factor_all . _refine_ls_shell.wR_factor_obs . _refine_ls_shell.wR_factor_R_free . _refine_ls_shell.wR_factor_R_work . _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error . # _struct.entry_id 4PA2 _struct.title ;Crystal structure of the human vitamin D receptor ligand binding domain complexed with (1R,2S,3R,5Z,7E,14beta,17alpha)-2-cyanopropoxy-9,10-secocholesta-5,7,10-triene-1,3,25-triol ; _struct.pdbx_descriptor 'human vitamin D receptor ligand binding domain' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4PA2 _struct_keywords.text 'VDR_LBD, potent seco-steroidal ligand, VDR_LBD TEI-L01318 C, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 12 ? TYR A 30 ? SER A 125 TYR A 143 1 ? 19 HELX_P HELX_P2 AA2 ASP A 36 ? PHE A 40 ? ASP A 149 PHE A 153 5 ? 5 HELX_P HELX_P3 AA3 SER A 52 ? LEU A 60 ? SER A 216 LEU A 224 1 ? 9 HELX_P HELX_P4 AA4 MET A 62 ? MET A 83 ? MET A 226 MET A 247 1 ? 22 HELX_P HELX_P5 AA5 GLY A 86 ? LEU A 90 ? GLY A 250 LEU A 254 5 ? 5 HELX_P HELX_P6 AA6 THR A 91 ? SER A 111 ? THR A 255 SER A 275 1 ? 21 HELX_P HELX_P7 AA7 ASN A 126 ? ASP A 128 ? ASN A 290 ASP A 292 5 ? 3 HELX_P HELX_P8 AA8 ARG A 132 ? LYS A 138 ? ARG A 296 LYS A 302 1 ? 7 HELX_P HELX_P9 AA9 SER A 142 ? LEU A 159 ? SER A 306 LEU A 323 1 ? 18 HELX_P HELX_P10 AB1 HIS A 162 ? VAL A 175 ? HIS A 326 VAL A 339 1 ? 14 HELX_P HELX_P11 AB2 ASP A 184 ? HIS A 207 ? ASP A 348 HIS A 371 1 ? 24 HELX_P HELX_P12 AB3 LEU A 214 ? SER A 241 ? LEU A 378 SER A 405 1 ? 28 HELX_P HELX_P13 AB4 GLU A 245 ? LEU A 250 ? GLU A 409 LEU A 414 1 ? 6 HELX_P HELX_P14 AB5 THR A 251 ? GLY A 259 ? THR A 415 GLY A 423 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 208 A . ? PRO 372 A PRO 209 A ? PRO 373 A 1 -24.13 2 PRO 209 A . ? PRO 373 A PRO 210 A ? PRO 374 A 1 2.79 3 SER 212 A . ? SER 376 A HIS 213 A ? HIS 377 A 1 -13.44 4 SER 212 A . ? SER 376 A HIS 213 A ? HIS 377 A 1 -20.23 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 115 ? THR A 116 ? PHE A 279 THR A 280 AA1 2 SER A 121 ? THR A 123 ? SER A 285 THR A 287 AA1 3 LYS A 130 ? TYR A 131 ? LYS A 294 TYR A 295 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 116 ? N THR A 280 O SER A 121 ? O SER A 285 AA1 2 3 N TRP A 122 ? N TRP A 286 O TYR A 131 ? O TYR A 295 # _atom_sites.entry_id 4PA2 _atom_sites.fract_transf_matrix[1][1] 0.022393 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019293 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007604 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 114 ? ? ? A . n A 1 2 SER 2 115 ? ? ? A . n A 1 3 HIS 3 116 ? ? ? A . n A 1 4 MET 4 117 ? ? ? A . n A 1 5 ASP 5 118 118 ASP ASP A . n A 1 6 SER 6 119 119 SER SER A . n A 1 7 LEU 7 120 120 LEU LEU A . n A 1 8 ARG 8 121 121 ARG ARG A . n A 1 9 PRO 9 122 122 PRO PRO A . n A 1 10 LYS 10 123 123 LYS LYS A . n A 1 11 LEU 11 124 124 LEU LEU A . n A 1 12 SER 12 125 125 SER SER A . n A 1 13 GLU 13 126 126 GLU GLU A . n A 1 14 GLU 14 127 127 GLU GLU A . n A 1 15 GLN 15 128 128 GLN GLN A . n A 1 16 GLN 16 129 129 GLN GLN A . n A 1 17 ARG 17 130 130 ARG ARG A . n A 1 18 ILE 18 131 131 ILE ILE A . n A 1 19 ILE 19 132 132 ILE ILE A . n A 1 20 ALA 20 133 133 ALA ALA A . n A 1 21 ILE 21 134 134 ILE ILE A . n A 1 22 LEU 22 135 135 LEU LEU A . n A 1 23 LEU 23 136 136 LEU LEU A . n A 1 24 ASP 24 137 137 ASP ASP A . n A 1 25 ALA 25 138 138 ALA ALA A . n A 1 26 HIS 26 139 139 HIS HIS A . n A 1 27 HIS 27 140 140 HIS HIS A . n A 1 28 LYS 28 141 141 LYS LYS A . n A 1 29 THR 29 142 142 THR THR A . n A 1 30 TYR 30 143 143 TYR TYR A . n A 1 31 ASP 31 144 144 ASP ASP A . n A 1 32 PRO 32 145 145 PRO PRO A . n A 1 33 THR 33 146 146 THR THR A . n A 1 34 TYR 34 147 147 TYR TYR A . n A 1 35 SER 35 148 148 SER SER A . n A 1 36 ASP 36 149 149 ASP ASP A . n A 1 37 PHE 37 150 150 PHE PHE A . n A 1 38 CYS 38 151 151 CYS CYS A . n A 1 39 GLN 39 152 152 GLN GLN A . n A 1 40 PHE 40 153 153 PHE PHE A . n A 1 41 ARG 41 154 154 ARG ARG A . n A 1 42 PRO 42 155 155 PRO PRO A . n A 1 43 PRO 43 156 156 PRO PRO A . n A 1 44 VAL 44 157 157 VAL VAL A . n A 1 45 ARG 45 158 158 ARG ARG A . n A 1 46 VAL 46 159 159 VAL VAL A . n A 1 47 ASN 47 160 160 ASN ASN A . n A 1 48 ASP 48 161 161 ASP ASP A . n A 1 49 GLY 49 162 162 GLY GLY A . n A 1 50 GLY 50 163 163 GLY GLY A . n A 1 51 GLY 51 164 164 GLY GLY A . n A 1 52 SER 52 216 216 SER SER A . n A 1 53 VAL 53 217 217 VAL VAL A . n A 1 54 THR 54 218 218 THR THR A . n A 1 55 LEU 55 219 219 LEU LEU A . n A 1 56 GLU 56 220 220 GLU GLU A . n A 1 57 LEU 57 221 221 LEU LEU A . n A 1 58 SER 58 222 222 SER SER A . n A 1 59 GLN 59 223 223 GLN GLN A . n A 1 60 LEU 60 224 224 LEU LEU A . n A 1 61 SER 61 225 225 SER SER A . n A 1 62 MET 62 226 226 MET MET A . n A 1 63 LEU 63 227 227 LEU LEU A . n A 1 64 PRO 64 228 228 PRO PRO A . n A 1 65 HIS 65 229 229 HIS HIS A . n A 1 66 LEU 66 230 230 LEU LEU A . n A 1 67 ALA 67 231 231 ALA ALA A . n A 1 68 ASP 68 232 232 ASP ASP A . n A 1 69 LEU 69 233 233 LEU LEU A . n A 1 70 VAL 70 234 234 VAL VAL A . n A 1 71 SER 71 235 235 SER SER A . n A 1 72 TYR 72 236 236 TYR TYR A . n A 1 73 SER 73 237 237 SER SER A . n A 1 74 ILE 74 238 238 ILE ILE A . n A 1 75 GLN 75 239 239 GLN GLN A . n A 1 76 LYS 76 240 240 LYS LYS A . n A 1 77 VAL 77 241 241 VAL VAL A . n A 1 78 ILE 78 242 242 ILE ILE A . n A 1 79 GLY 79 243 243 GLY GLY A . n A 1 80 PHE 80 244 244 PHE PHE A . n A 1 81 ALA 81 245 245 ALA ALA A . n A 1 82 LYS 82 246 246 LYS LYS A . n A 1 83 MET 83 247 247 MET MET A . n A 1 84 ILE 84 248 248 ILE ILE A . n A 1 85 PRO 85 249 249 PRO PRO A . n A 1 86 GLY 86 250 250 GLY GLY A . n A 1 87 PHE 87 251 251 PHE PHE A . n A 1 88 ARG 88 252 252 ARG ARG A . n A 1 89 ASP 89 253 253 ASP ASP A . n A 1 90 LEU 90 254 254 LEU LEU A . n A 1 91 THR 91 255 255 THR THR A . n A 1 92 SER 92 256 256 SER SER A . n A 1 93 GLU 93 257 257 GLU GLU A . n A 1 94 ASP 94 258 258 ASP ASP A . n A 1 95 GLN 95 259 259 GLN GLN A . n A 1 96 ILE 96 260 260 ILE ILE A . n A 1 97 VAL 97 261 261 VAL VAL A . n A 1 98 LEU 98 262 262 LEU LEU A . n A 1 99 LEU 99 263 263 LEU LEU A . n A 1 100 LYS 100 264 264 LYS LYS A . n A 1 101 SER 101 265 265 SER SER A . n A 1 102 SER 102 266 266 SER SER A . n A 1 103 ALA 103 267 267 ALA ALA A . n A 1 104 ILE 104 268 268 ILE ILE A . n A 1 105 GLU 105 269 269 GLU GLU A . n A 1 106 VAL 106 270 270 VAL VAL A . n A 1 107 ILE 107 271 271 ILE ILE A . n A 1 108 MET 108 272 272 MET MET A . n A 1 109 LEU 109 273 273 LEU LEU A . n A 1 110 ARG 110 274 274 ARG ARG A . n A 1 111 SER 111 275 275 SER SER A . n A 1 112 ASN 112 276 276 ASN ASN A . n A 1 113 GLU 113 277 277 GLU GLU A . n A 1 114 SER 114 278 278 SER SER A . n A 1 115 PHE 115 279 279 PHE PHE A . n A 1 116 THR 116 280 280 THR THR A . n A 1 117 MET 117 281 281 MET MET A . n A 1 118 ASP 118 282 282 ASP ASP A . n A 1 119 ASP 119 283 283 ASP ASP A . n A 1 120 MET 120 284 284 MET MET A . n A 1 121 SER 121 285 285 SER SER A . n A 1 122 TRP 122 286 286 TRP TRP A . n A 1 123 THR 123 287 287 THR THR A . n A 1 124 CYS 124 288 288 CYS CYS A . n A 1 125 GLY 125 289 289 GLY GLY A . n A 1 126 ASN 126 290 290 ASN ASN A . n A 1 127 GLN 127 291 291 GLN GLN A . n A 1 128 ASP 128 292 292 ASP ASP A . n A 1 129 TYR 129 293 293 TYR TYR A . n A 1 130 LYS 130 294 294 LYS LYS A . n A 1 131 TYR 131 295 295 TYR TYR A . n A 1 132 ARG 132 296 296 ARG ARG A . n A 1 133 VAL 133 297 297 VAL VAL A . n A 1 134 SER 134 298 298 SER SER A . n A 1 135 ASP 135 299 299 ASP ASP A . n A 1 136 VAL 136 300 300 VAL VAL A . n A 1 137 THR 137 301 301 THR THR A . n A 1 138 LYS 138 302 302 LYS LYS A . n A 1 139 ALA 139 303 303 ALA ALA A . n A 1 140 GLY 140 304 304 GLY GLY A . n A 1 141 HIS 141 305 305 HIS HIS A . n A 1 142 SER 142 306 306 SER SER A . n A 1 143 LEU 143 307 307 LEU LEU A . n A 1 144 GLU 144 308 308 GLU GLU A . n A 1 145 LEU 145 309 309 LEU LEU A . n A 1 146 ILE 146 310 310 ILE ILE A . n A 1 147 GLU 147 311 311 GLU GLU A . n A 1 148 PRO 148 312 312 PRO PRO A . n A 1 149 LEU 149 313 313 LEU LEU A . n A 1 150 ILE 150 314 314 ILE ILE A . n A 1 151 LYS 151 315 315 LYS LYS A . n A 1 152 PHE 152 316 316 PHE PHE A . n A 1 153 GLN 153 317 317 GLN GLN A . n A 1 154 VAL 154 318 318 VAL VAL A . n A 1 155 GLY 155 319 319 GLY GLY A . n A 1 156 LEU 156 320 320 LEU LEU A . n A 1 157 LYS 157 321 321 LYS LYS A . n A 1 158 LYS 158 322 322 LYS LYS A . n A 1 159 LEU 159 323 323 LEU LEU A . n A 1 160 ASN 160 324 324 ASN ASN A . n A 1 161 LEU 161 325 325 LEU LEU A . n A 1 162 HIS 162 326 326 HIS HIS A . n A 1 163 GLU 163 327 327 GLU GLU A . n A 1 164 GLU 164 328 328 GLU GLU A . n A 1 165 GLU 165 329 329 GLU GLU A . n A 1 166 HIS 166 330 330 HIS HIS A . n A 1 167 VAL 167 331 331 VAL VAL A . n A 1 168 LEU 168 332 332 LEU LEU A . n A 1 169 LEU 169 333 333 LEU LEU A . n A 1 170 MET 170 334 334 MET MET A . n A 1 171 ALA 171 335 335 ALA ALA A . n A 1 172 ILE 172 336 336 ILE ILE A . n A 1 173 CYS 173 337 337 CYS CYS A . n A 1 174 ILE 174 338 338 ILE ILE A . n A 1 175 VAL 175 339 339 VAL VAL A . n A 1 176 SER 176 340 340 SER SER A . n A 1 177 PRO 177 341 341 PRO PRO A . n A 1 178 ASP 178 342 342 ASP ASP A . n A 1 179 ARG 179 343 343 ARG ARG A . n A 1 180 PRO 180 344 344 PRO PRO A . n A 1 181 GLY 181 345 345 GLY GLY A . n A 1 182 VAL 182 346 346 VAL VAL A . n A 1 183 GLN 183 347 347 GLN GLN A . n A 1 184 ASP 184 348 348 ASP ASP A . n A 1 185 ALA 185 349 349 ALA ALA A . n A 1 186 ALA 186 350 350 ALA ALA A . n A 1 187 LEU 187 351 351 LEU LEU A . n A 1 188 ILE 188 352 352 ILE ILE A . n A 1 189 GLU 189 353 353 GLU GLU A . n A 1 190 ALA 190 354 354 ALA ALA A . n A 1 191 ILE 191 355 355 ILE ILE A . n A 1 192 GLN 192 356 356 GLN GLN A . n A 1 193 ASP 193 357 357 ASP ASP A . n A 1 194 ARG 194 358 358 ARG ARG A . n A 1 195 LEU 195 359 359 LEU LEU A . n A 1 196 SER 196 360 360 SER SER A . n A 1 197 ASN 197 361 361 ASN ASN A . n A 1 198 THR 198 362 362 THR THR A . n A 1 199 LEU 199 363 363 LEU LEU A . n A 1 200 GLN 200 364 364 GLN GLN A . n A 1 201 THR 201 365 365 THR THR A . n A 1 202 TYR 202 366 366 TYR TYR A . n A 1 203 ILE 203 367 367 ILE ILE A . n A 1 204 ARG 204 368 368 ARG ARG A . n A 1 205 CYS 205 369 369 CYS CYS A . n A 1 206 ARG 206 370 370 ARG ARG A . n A 1 207 HIS 207 371 371 HIS HIS A . n A 1 208 PRO 208 372 372 PRO PRO A . n A 1 209 PRO 209 373 373 PRO PRO A . n A 1 210 PRO 210 374 374 PRO PRO A . n A 1 211 GLY 211 375 375 GLY GLY A . n A 1 212 SER 212 376 376 SER SER A . n A 1 213 HIS 213 377 377 HIS HIS A . n A 1 214 LEU 214 378 378 LEU LEU A . n A 1 215 LEU 215 379 379 LEU LEU A . n A 1 216 TYR 216 380 380 TYR TYR A . n A 1 217 ALA 217 381 381 ALA ALA A . n A 1 218 LYS 218 382 382 LYS LYS A . n A 1 219 MET 219 383 383 MET MET A . n A 1 220 ILE 220 384 384 ILE ILE A . n A 1 221 GLN 221 385 385 GLN GLN A . n A 1 222 LYS 222 386 386 LYS LYS A . n A 1 223 LEU 223 387 387 LEU LEU A . n A 1 224 ALA 224 388 388 ALA ALA A . n A 1 225 ASP 225 389 389 ASP ASP A . n A 1 226 LEU 226 390 390 LEU LEU A . n A 1 227 ARG 227 391 391 ARG ARG A . n A 1 228 SER 228 392 392 SER SER A . n A 1 229 LEU 229 393 393 LEU LEU A . n A 1 230 ASN 230 394 394 ASN ASN A . n A 1 231 GLU 231 395 395 GLU GLU A . n A 1 232 GLU 232 396 396 GLU GLU A . n A 1 233 HIS 233 397 397 HIS HIS A . n A 1 234 SER 234 398 398 SER SER A . n A 1 235 LYS 235 399 399 LYS LYS A . n A 1 236 GLN 236 400 400 GLN GLN A . n A 1 237 TYR 237 401 401 TYR TYR A . n A 1 238 ARG 238 402 402 ARG ARG A . n A 1 239 CYS 239 403 403 CYS CYS A . n A 1 240 LEU 240 404 404 LEU LEU A . n A 1 241 SER 241 405 405 SER SER A . n A 1 242 PHE 242 406 406 PHE PHE A . n A 1 243 GLN 243 407 407 GLN GLN A . n A 1 244 PRO 244 408 408 PRO PRO A . n A 1 245 GLU 245 409 409 GLU GLU A . n A 1 246 CYS 246 410 410 CYS CYS A . n A 1 247 SER 247 411 411 SER SER A . n A 1 248 MET 248 412 412 MET MET A . n A 1 249 LYS 249 413 413 LYS LYS A . n A 1 250 LEU 250 414 414 LEU LEU A . n A 1 251 THR 251 415 415 THR THR A . n A 1 252 PRO 252 416 416 PRO PRO A . n A 1 253 LEU 253 417 417 LEU LEU A . n A 1 254 VAL 254 418 418 VAL VAL A . n A 1 255 LEU 255 419 419 LEU LEU A . n A 1 256 GLU 256 420 420 GLU GLU A . n A 1 257 VAL 257 421 421 VAL VAL A . n A 1 258 PHE 258 422 422 PHE PHE A . n A 1 259 GLY 259 423 423 GLY GLY A . n A 1 260 ASN 260 424 ? ? ? A . n A 1 261 GLU 261 425 ? ? ? A . n A 1 262 ILE 262 426 ? ? ? A . n A 1 263 SER 263 427 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 2KB 1 501 1 2KB LIG A . C 3 HOH 1 601 20 HOH HOH A . C 3 HOH 2 602 36 HOH HOH A . C 3 HOH 3 603 8 HOH HOH A . C 3 HOH 4 604 37 HOH HOH A . C 3 HOH 5 605 30 HOH HOH A . C 3 HOH 6 606 51 HOH HOH A . C 3 HOH 7 607 50 HOH HOH A . C 3 HOH 8 608 5 HOH HOH A . C 3 HOH 9 609 13 HOH HOH A . C 3 HOH 10 610 32 HOH HOH A . C 3 HOH 11 611 17 HOH HOH A . C 3 HOH 12 612 28 HOH HOH A . C 3 HOH 13 613 53 HOH HOH A . C 3 HOH 14 614 44 HOH HOH A . C 3 HOH 15 615 52 HOH HOH A . C 3 HOH 16 616 49 HOH HOH A . C 3 HOH 17 617 48 HOH HOH A . C 3 HOH 18 618 1 HOH HOH A . C 3 HOH 19 619 2 HOH HOH A . C 3 HOH 20 620 3 HOH HOH A . C 3 HOH 21 621 4 HOH HOH A . C 3 HOH 22 622 6 HOH HOH A . C 3 HOH 23 623 7 HOH HOH A . C 3 HOH 24 624 9 HOH HOH A . C 3 HOH 25 625 10 HOH HOH A . C 3 HOH 26 626 11 HOH HOH A . C 3 HOH 27 627 12 HOH HOH A . C 3 HOH 28 628 14 HOH HOH A . C 3 HOH 29 629 15 HOH HOH A . C 3 HOH 30 630 16 HOH HOH A . C 3 HOH 31 631 18 HOH HOH A . C 3 HOH 32 632 19 HOH HOH A . C 3 HOH 33 633 21 HOH HOH A . C 3 HOH 34 634 22 HOH HOH A . C 3 HOH 35 635 23 HOH HOH A . C 3 HOH 36 636 24 HOH HOH A . C 3 HOH 37 637 25 HOH HOH A . C 3 HOH 38 638 26 HOH HOH A . C 3 HOH 39 639 27 HOH HOH A . C 3 HOH 40 640 29 HOH HOH A . C 3 HOH 41 641 31 HOH HOH A . C 3 HOH 42 642 33 HOH HOH A . C 3 HOH 43 643 34 HOH HOH A . C 3 HOH 44 644 35 HOH HOH A . C 3 HOH 45 645 38 HOH HOH A . C 3 HOH 46 646 39 HOH HOH A . C 3 HOH 47 647 40 HOH HOH A . C 3 HOH 48 648 41 HOH HOH A . C 3 HOH 49 649 42 HOH HOH A . C 3 HOH 50 650 43 HOH HOH A . C 3 HOH 51 651 45 HOH HOH A . C 3 HOH 52 652 47 HOH HOH A . C 3 HOH 53 653 54 HOH HOH A . C 3 HOH 54 654 55 HOH HOH A . C 3 HOH 55 655 56 HOH HOH A . C 3 HOH 56 656 57 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12020 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-08 2 'Structure model' 1 1 2016-11-09 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group Other # _software.citation_id ? _software.classification refinement _software.compiler_name . _software.compiler_version . _software.contact_author . _software.contact_author_email . _software.date . _software.description . _software.dependencies . _software.hardware . _software.language . _software.location . _software.mods . _software.name REFMAC _software.os . _software.os_version . _software.type . _software.version 5.7.0029 _software.pdbx_ordinal 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLY 164 ? ? N A SER 216 ? ? 1.78 2 1 N35 A 2KB 501 ? ? O A HOH 652 ? ? 1.99 3 1 OH A TYR 147 ? ? O A HOH 639 ? ? 2.14 4 1 O A ASP 161 ? ? N A GLY 163 ? ? 2.15 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 277 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 277 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.616 _pdbx_validate_rmsd_bond.bond_target_value 1.515 _pdbx_validate_rmsd_bond.bond_deviation 0.101 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A LEU 390 ? ? CG A LEU 390 ? ? CD1 A LEU 390 ? ? 121.97 111.00 10.97 1.70 N 2 1 CB A MET 412 ? ? CG A MET 412 ? ? SD A MET 412 ? ? 132.41 112.40 20.01 3.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 119 ? ? -9.22 97.70 2 1 ASP A 283 ? ? -142.89 16.89 3 1 CYS A 288 ? ? -103.26 54.21 4 1 ASN A 290 ? ? 170.10 148.63 5 1 PRO A 373 ? ? -25.48 -60.81 6 1 HIS A 377 ? A 52.92 149.01 7 1 HIS A 377 ? B 54.92 150.05 8 1 LEU A 378 ? ? 54.77 -6.44 9 1 LEU A 378 ? ? 55.80 -6.44 10 1 LEU A 414 ? ? -92.90 -154.59 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY A 163 ? ? GLY A 164 ? ? -49.46 2 1 PRO A 374 ? ? GLY A 375 ? ? 144.18 3 1 HIS A 377 ? A LEU A 378 ? ? -140.64 4 1 HIS A 377 ? B LEU A 378 ? ? -136.50 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 GLY _pdbx_validate_polymer_linkage.auth_seq_id_1 164 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 SER _pdbx_validate_polymer_linkage.auth_seq_id_2 216 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 2.07 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 114 ? A GLY 1 2 1 Y 1 A SER 115 ? A SER 2 3 1 Y 1 A HIS 116 ? A HIS 3 4 1 Y 1 A MET 117 ? A MET 4 5 1 Y 1 A ASN 424 ? A ASN 260 6 1 Y 1 A GLU 425 ? A GLU 261 7 1 Y 1 A ILE 426 ? A ILE 262 8 1 Y 1 A SER 427 ? A SER 263 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-{[(1R,2S,3R,5Z,7E,14beta,17alpha)-1,3,25-trihydroxy-9,10-secocholesta-5,7,10-trien-2-yl]oxy}butanenitrile' 2KB 3 water HOH #