data_4PPI # _entry.id 4PPI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4PPI RCSB RCSB085060 WWPDB D_1000085060 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4PPI _pdbx_database_status.recvd_initial_deposition_date 2014-02-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sreekanth, R.' 1 'Yoon, H.S.' 2 # _citation.id primary _citation.title 'Structural transition in Bcl-xL and its potential association with mitochondrial calcium ion transport' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 5 _citation.page_first 10609 _citation.page_last 10609 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26023881 _citation.pdbx_database_id_DOI 10.1038/srep10609 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rajan, S.' 1 primary 'Choi, M.' 2 primary 'Nguyen, Q.T.' 3 primary 'Ye, H.' 4 primary 'Liu, W.' 5 primary 'Toh, H.T.' 6 primary 'Kang, C.' 7 primary 'Kamariah, N.' 8 primary 'Li, C.' 9 primary 'Huang, H.' 10 primary 'White, C.' 11 primary 'Baek, K.' 12 primary 'Gruber, G.' 13 primary 'Yoon, H.S.' 14 # _cell.entry_id 4PPI _cell.length_a 153.630 _cell.length_b 153.630 _cell.length_c 153.630 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 48 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4PPI _symmetry.space_group_name_H-M 'I 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 214 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2-like protein 1' 19313.217 1 ? ? 'Bcl-xl, UNP residues 1-209, with deletion of residues 45-84' ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl2-L-1, Apoptosis regulator Bcl-X' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA AESRKGQER ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA AESRKGQER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 SER n 1 5 ASN n 1 6 ARG n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 VAL n 1 11 ASP n 1 12 PHE n 1 13 LEU n 1 14 SER n 1 15 TYR n 1 16 LYS n 1 17 LEU n 1 18 SER n 1 19 GLN n 1 20 LYS n 1 21 GLY n 1 22 TYR n 1 23 SER n 1 24 TRP n 1 25 SER n 1 26 GLN n 1 27 PHE n 1 28 SER n 1 29 ASP n 1 30 VAL n 1 31 GLU n 1 32 GLU n 1 33 ASN n 1 34 ARG n 1 35 THR n 1 36 GLU n 1 37 ALA n 1 38 PRO n 1 39 GLU n 1 40 GLY n 1 41 THR n 1 42 GLU n 1 43 SER n 1 44 GLU n 1 45 ALA n 1 46 VAL n 1 47 LYS n 1 48 GLN n 1 49 ALA n 1 50 LEU n 1 51 ARG n 1 52 GLU n 1 53 ALA n 1 54 GLY n 1 55 ASP n 1 56 GLU n 1 57 PHE n 1 58 GLU n 1 59 LEU n 1 60 ARG n 1 61 TYR n 1 62 ARG n 1 63 ARG n 1 64 ALA n 1 65 PHE n 1 66 SER n 1 67 ASP n 1 68 LEU n 1 69 THR n 1 70 SER n 1 71 GLN n 1 72 LEU n 1 73 HIS n 1 74 ILE n 1 75 THR n 1 76 PRO n 1 77 GLY n 1 78 THR n 1 79 ALA n 1 80 TYR n 1 81 GLN n 1 82 SER n 1 83 PHE n 1 84 GLU n 1 85 GLN n 1 86 VAL n 1 87 VAL n 1 88 ASN n 1 89 GLU n 1 90 LEU n 1 91 PHE n 1 92 ARG n 1 93 ASP n 1 94 GLY n 1 95 VAL n 1 96 ASN n 1 97 TRP n 1 98 GLY n 1 99 ARG n 1 100 ILE n 1 101 VAL n 1 102 ALA n 1 103 PHE n 1 104 PHE n 1 105 SER n 1 106 PHE n 1 107 GLY n 1 108 GLY n 1 109 ALA n 1 110 LEU n 1 111 CYS n 1 112 VAL n 1 113 GLU n 1 114 SER n 1 115 VAL n 1 116 ASP n 1 117 LYS n 1 118 GLU n 1 119 MET n 1 120 GLN n 1 121 VAL n 1 122 LEU n 1 123 VAL n 1 124 SER n 1 125 ARG n 1 126 ILE n 1 127 ALA n 1 128 ALA n 1 129 TRP n 1 130 MET n 1 131 ALA n 1 132 THR n 1 133 TYR n 1 134 LEU n 1 135 ASN n 1 136 ASP n 1 137 HIS n 1 138 LEU n 1 139 GLU n 1 140 PRO n 1 141 TRP n 1 142 ILE n 1 143 GLN n 1 144 GLU n 1 145 ASN n 1 146 GLY n 1 147 GLY n 1 148 TRP n 1 149 ASP n 1 150 THR n 1 151 PHE n 1 152 VAL n 1 153 GLU n 1 154 LEU n 1 155 TYR n 1 156 GLY n 1 157 ASN n 1 158 ASN n 1 159 ALA n 1 160 ALA n 1 161 ALA n 1 162 GLU n 1 163 SER n 1 164 ARG n 1 165 LYS n 1 166 GLY n 1 167 GLN n 1 168 GLU n 1 169 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL2L1, BCL2L, BCLX' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETSUMO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2CL1_HUMAN _struct_ref.pdbx_db_accession Q07817 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4PPI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q07817 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 209 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 209 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4PPI ? A ? ? UNP Q07817 MET 45 DELETION ? 1 1 4PPI ? A ? ? UNP Q07817 GLU 46 DELETION ? 2 1 4PPI ? A ? ? UNP Q07817 THR 47 DELETION ? 3 1 4PPI ? A ? ? UNP Q07817 PRO 48 DELETION ? 4 1 4PPI ? A ? ? UNP Q07817 SER 49 DELETION ? 5 1 4PPI ? A ? ? UNP Q07817 ALA 50 DELETION ? 6 1 4PPI ? A ? ? UNP Q07817 ILE 51 DELETION ? 7 1 4PPI ? A ? ? UNP Q07817 ASN 52 DELETION ? 8 1 4PPI ? A ? ? UNP Q07817 GLY 53 DELETION ? 9 1 4PPI ? A ? ? UNP Q07817 ASN 54 DELETION ? 10 1 4PPI ? A ? ? UNP Q07817 PRO 55 DELETION ? 11 1 4PPI ? A ? ? UNP Q07817 SER 56 DELETION ? 12 1 4PPI ? A ? ? UNP Q07817 TRP 57 DELETION ? 13 1 4PPI ? A ? ? UNP Q07817 HIS 58 DELETION ? 14 1 4PPI ? A ? ? UNP Q07817 LEU 59 DELETION ? 15 1 4PPI ? A ? ? UNP Q07817 ALA 60 DELETION ? 16 1 4PPI ? A ? ? UNP Q07817 ASP 61 DELETION ? 17 1 4PPI ? A ? ? UNP Q07817 SER 62 DELETION ? 18 1 4PPI ? A ? ? UNP Q07817 PRO 63 DELETION ? 19 1 4PPI ? A ? ? UNP Q07817 ALA 64 DELETION ? 20 1 4PPI ? A ? ? UNP Q07817 VAL 65 DELETION ? 21 1 4PPI ? A ? ? UNP Q07817 ASN 66 DELETION ? 22 1 4PPI ? A ? ? UNP Q07817 GLY 67 DELETION ? 23 1 4PPI ? A ? ? UNP Q07817 ALA 68 DELETION ? 24 1 4PPI ? A ? ? UNP Q07817 THR 69 DELETION ? 25 1 4PPI ? A ? ? UNP Q07817 GLY 70 DELETION ? 26 1 4PPI ? A ? ? UNP Q07817 HIS 71 DELETION ? 27 1 4PPI ? A ? ? UNP Q07817 SER 72 DELETION ? 28 1 4PPI ? A ? ? UNP Q07817 SER 73 DELETION ? 29 1 4PPI ? A ? ? UNP Q07817 SER 74 DELETION ? 30 1 4PPI ? A ? ? UNP Q07817 LEU 75 DELETION ? 31 1 4PPI ? A ? ? UNP Q07817 ASP 76 DELETION ? 32 1 4PPI ? A ? ? UNP Q07817 ALA 77 DELETION ? 33 1 4PPI ? A ? ? UNP Q07817 ARG 78 DELETION ? 34 1 4PPI ? A ? ? UNP Q07817 GLU 79 DELETION ? 35 1 4PPI ? A ? ? UNP Q07817 VAL 80 DELETION ? 36 1 4PPI ? A ? ? UNP Q07817 ILE 81 DELETION ? 37 1 4PPI ? A ? ? UNP Q07817 PRO 82 DELETION ? 38 1 4PPI ? A ? ? UNP Q07817 MET 83 DELETION ? 39 1 4PPI ? A ? ? UNP Q07817 ALA 84 DELETION ? 40 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4PPI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.91 _exptl_crystal.density_percent_sol 68.55 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pdbx_details '1.0M sodium citrate, 0.1M CHES pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2013-12-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.pdbx_synchrotron_site NSRRC _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0000 # _reflns.entry_id 4PPI _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 44.35 _reflns.d_resolution_high 2.85 _reflns.number_obs 7536 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.086 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 28.3 _reflns.B_iso_Wilson_estimate 85.96 _reflns.pdbx_redundancy 38.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 3.01 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.702 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.3 _reflns_shell.pdbx_redundancy 41.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4PPI _refine.ls_number_reflns_obs 7211 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.45 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.158 _refine.ls_d_res_high 2.851 _refine.ls_percent_reflns_obs 95.58 _refine.ls_R_factor_obs 0.2396 _refine.ls_R_factor_all 0.2396 _refine.ls_R_factor_R_work 0.2364 _refine.ls_R_factor_R_free 0.2687 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.83 _refine.ls_number_reflns_R_free 700 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 2B48 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.40 _refine.pdbx_overall_phase_error 28.68 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1099 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1120 _refine_hist.d_res_high 2.851 _refine_hist.d_res_low 27.158 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.005 ? ? 1131 ? 'X-RAY DIFFRACTION' f_angle_d 0.982 ? ? 1529 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 17.796 ? ? 397 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.038 ? ? 159 ? 'X-RAY DIFFRACTION' f_plane_restr 0.004 ? ? 196 ? 'X-RAY DIFFRACTION' # _struct.entry_id 4PPI _struct.title 'Crystal structure of Bcl-xL hexamer' _struct.pdbx_descriptor 'Bcl-2-like protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4PPI _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text '3D DOMAIN SWAP, APOPTOSIS, ANTI-APOPTOTIC, BCL-2 FAMILY' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? LYS A 20 ? SER A 4 LYS A 20 1 ? 17 HELX_P HELX_P2 2 VAL A 46 ? ARG A 62 ? VAL A 86 ARG A 102 1 ? 17 HELX_P HELX_P3 3 ALA A 79 ? PHE A 91 ? ALA A 119 PHE A 131 1 ? 13 HELX_P HELX_P4 4 ASN A 96 ? LEU A 138 ? ASN A 136 LEU A 178 1 ? 43 HELX_P HELX_P5 5 LEU A 138 ? GLU A 144 ? LEU A 178 GLU A 184 1 ? 7 HELX_P HELX_P6 6 GLY A 146 ? TYR A 155 ? GLY A 186 TYR A 195 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE GOL A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 84 ? GLU A 124 . ? 38_555 ? 2 AC1 6 GLN A 85 ? GLN A 125 . ? 38_555 ? 3 AC1 6 ASN A 88 ? ASN A 128 . ? 38_555 ? 4 AC1 6 ASN A 135 ? ASN A 175 . ? 1_555 ? 5 AC1 6 ASP A 136 ? ASP A 176 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 414 . ? 1_555 ? # _database_PDB_matrix.entry_id 4PPI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4PPI _atom_sites.fract_transf_matrix[1][1] 0.006509 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006509 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006509 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 ? ? ? A . n A 1 27 PHE 27 27 ? ? ? A . n A 1 28 SER 28 28 ? ? ? A . n A 1 29 ASP 29 29 ? ? ? A . n A 1 30 VAL 30 30 ? ? ? A . n A 1 31 GLU 31 31 ? ? ? A . n A 1 32 GLU 32 32 ? ? ? A . n A 1 33 ASN 33 33 ? ? ? A . n A 1 34 ARG 34 34 ? ? ? A . n A 1 35 THR 35 35 ? ? ? A . n A 1 36 GLU 36 36 ? ? ? A . n A 1 37 ALA 37 37 ? ? ? A . n A 1 38 PRO 38 38 ? ? ? A . n A 1 39 GLU 39 39 ? ? ? A . n A 1 40 GLY 40 40 ? ? ? A . n A 1 41 THR 41 41 ? ? ? A . n A 1 42 GLU 42 42 ? ? ? A . n A 1 43 SER 43 43 ? ? ? A . n A 1 44 GLU 44 44 ? ? ? A . n A 1 45 ALA 45 85 85 ALA ALA A . n A 1 46 VAL 46 86 86 VAL VAL A . n A 1 47 LYS 47 87 87 LYS LYS A . n A 1 48 GLN 48 88 88 GLN GLN A . n A 1 49 ALA 49 89 89 ALA ALA A . n A 1 50 LEU 50 90 90 LEU LEU A . n A 1 51 ARG 51 91 91 ARG ARG A . n A 1 52 GLU 52 92 92 GLU GLU A . n A 1 53 ALA 53 93 93 ALA ALA A . n A 1 54 GLY 54 94 94 GLY GLY A . n A 1 55 ASP 55 95 95 ASP ASP A . n A 1 56 GLU 56 96 96 GLU GLU A . n A 1 57 PHE 57 97 97 PHE PHE A . n A 1 58 GLU 58 98 98 GLU GLU A . n A 1 59 LEU 59 99 99 LEU LEU A . n A 1 60 ARG 60 100 100 ARG ARG A . n A 1 61 TYR 61 101 101 TYR TYR A . n A 1 62 ARG 62 102 102 ARG ARG A . n A 1 63 ARG 63 103 103 ARG ARG A . n A 1 64 ALA 64 104 104 ALA ALA A . n A 1 65 PHE 65 105 105 PHE PHE A . n A 1 66 SER 66 106 106 SER SER A . n A 1 67 ASP 67 107 107 ASP ASP A . n A 1 68 LEU 68 108 108 LEU LEU A . n A 1 69 THR 69 109 109 THR THR A . n A 1 70 SER 70 110 110 SER SER A . n A 1 71 GLN 71 111 111 GLN GLN A . n A 1 72 LEU 72 112 112 LEU LEU A . n A 1 73 HIS 73 113 113 HIS HIS A . n A 1 74 ILE 74 114 114 ILE ILE A . n A 1 75 THR 75 115 115 THR THR A . n A 1 76 PRO 76 116 116 PRO PRO A . n A 1 77 GLY 77 117 117 GLY GLY A . n A 1 78 THR 78 118 118 THR THR A . n A 1 79 ALA 79 119 119 ALA ALA A . n A 1 80 TYR 80 120 120 TYR TYR A . n A 1 81 GLN 81 121 121 GLN GLN A . n A 1 82 SER 82 122 122 SER SER A . n A 1 83 PHE 83 123 123 PHE PHE A . n A 1 84 GLU 84 124 124 GLU GLU A . n A 1 85 GLN 85 125 125 GLN GLN A . n A 1 86 VAL 86 126 126 VAL VAL A . n A 1 87 VAL 87 127 127 VAL VAL A . n A 1 88 ASN 88 128 128 ASN ASN A . n A 1 89 GLU 89 129 129 GLU GLU A . n A 1 90 LEU 90 130 130 LEU LEU A . n A 1 91 PHE 91 131 131 PHE PHE A . n A 1 92 ARG 92 132 132 ARG ARG A . n A 1 93 ASP 93 133 133 ASP ASP A . n A 1 94 GLY 94 134 134 GLY GLY A . n A 1 95 VAL 95 135 135 VAL VAL A . n A 1 96 ASN 96 136 136 ASN ASN A . n A 1 97 TRP 97 137 137 TRP TRP A . n A 1 98 GLY 98 138 138 GLY GLY A . n A 1 99 ARG 99 139 139 ARG ARG A . n A 1 100 ILE 100 140 140 ILE ILE A . n A 1 101 VAL 101 141 141 VAL VAL A . n A 1 102 ALA 102 142 142 ALA ALA A . n A 1 103 PHE 103 143 143 PHE PHE A . n A 1 104 PHE 104 144 144 PHE PHE A . n A 1 105 SER 105 145 145 SER SER A . n A 1 106 PHE 106 146 146 PHE PHE A . n A 1 107 GLY 107 147 147 GLY GLY A . n A 1 108 GLY 108 148 148 GLY GLY A . n A 1 109 ALA 109 149 149 ALA ALA A . n A 1 110 LEU 110 150 150 LEU LEU A . n A 1 111 CYS 111 151 151 CYS CYS A . n A 1 112 VAL 112 152 152 VAL VAL A . n A 1 113 GLU 113 153 153 GLU GLU A . n A 1 114 SER 114 154 154 SER SER A . n A 1 115 VAL 115 155 155 VAL VAL A . n A 1 116 ASP 116 156 156 ASP ASP A . n A 1 117 LYS 117 157 157 LYS LYS A . n A 1 118 GLU 118 158 158 GLU GLU A . n A 1 119 MET 119 159 159 MET MET A . n A 1 120 GLN 120 160 160 GLN GLN A . n A 1 121 VAL 121 161 161 VAL VAL A . n A 1 122 LEU 122 162 162 LEU LEU A . n A 1 123 VAL 123 163 163 VAL VAL A . n A 1 124 SER 124 164 164 SER SER A . n A 1 125 ARG 125 165 165 ARG ARG A . n A 1 126 ILE 126 166 166 ILE ILE A . n A 1 127 ALA 127 167 167 ALA ALA A . n A 1 128 ALA 128 168 168 ALA ALA A . n A 1 129 TRP 129 169 169 TRP TRP A . n A 1 130 MET 130 170 170 MET MET A . n A 1 131 ALA 131 171 171 ALA ALA A . n A 1 132 THR 132 172 172 THR THR A . n A 1 133 TYR 133 173 173 TYR TYR A . n A 1 134 LEU 134 174 174 LEU LEU A . n A 1 135 ASN 135 175 175 ASN ASN A . n A 1 136 ASP 136 176 176 ASP ASP A . n A 1 137 HIS 137 177 177 HIS HIS A . n A 1 138 LEU 138 178 178 LEU LEU A . n A 1 139 GLU 139 179 179 GLU GLU A . n A 1 140 PRO 140 180 180 PRO PRO A . n A 1 141 TRP 141 181 181 TRP TRP A . n A 1 142 ILE 142 182 182 ILE ILE A . n A 1 143 GLN 143 183 183 GLN GLN A . n A 1 144 GLU 144 184 184 GLU GLU A . n A 1 145 ASN 145 185 185 ASN ASN A . n A 1 146 GLY 146 186 186 GLY GLY A . n A 1 147 GLY 147 187 187 GLY GLY A . n A 1 148 TRP 148 188 188 TRP TRP A . n A 1 149 ASP 149 189 189 ASP ASP A . n A 1 150 THR 150 190 190 THR THR A . n A 1 151 PHE 151 191 191 PHE PHE A . n A 1 152 VAL 152 192 192 VAL VAL A . n A 1 153 GLU 153 193 193 GLU GLU A . n A 1 154 LEU 154 194 194 LEU LEU A . n A 1 155 TYR 155 195 195 TYR TYR A . n A 1 156 GLY 156 196 196 GLY GLY A . n A 1 157 ASN 157 197 ? ? ? A . n A 1 158 ASN 158 198 ? ? ? A . n A 1 159 ALA 159 199 ? ? ? A . n A 1 160 ALA 160 200 ? ? ? A . n A 1 161 ALA 161 201 ? ? ? A . n A 1 162 GLU 162 202 ? ? ? A . n A 1 163 SER 163 203 ? ? ? A . n A 1 164 ARG 164 204 ? ? ? A . n A 1 165 LYS 165 205 ? ? ? A . n A 1 166 GLY 166 206 ? ? ? A . n A 1 167 GLN 167 207 ? ? ? A . n A 1 168 GLU 168 208 ? ? ? A . n A 1 169 ARG 169 209 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 26200 ? 1 MORE -211 ? 1 'SSA (A^2)' 38120 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 4 'crystal symmetry operation' 38_555 -y+1/4,-x+1/4,-z+1/4 0.0000000000 -1.0000000000 0.0000000000 38.4075000000 -1.0000000000 0.0000000000 0.0000000000 38.4075000000 0.0000000000 0.0000000000 -1.0000000000 38.4075000000 5 'crystal symmetry operation' 43_555 -x+1/4,-z+1/4,-y+1/4 -1.0000000000 0.0000000000 0.0000000000 38.4075000000 0.0000000000 0.0000000000 -1.0000000000 38.4075000000 0.0000000000 -1.0000000000 0.0000000000 38.4075000000 6 'crystal symmetry operation' 48_555 -z+1/4,-y+1/4,-x+1/4 0.0000000000 0.0000000000 -1.0000000000 38.4075000000 0.0000000000 -1.0000000000 0.0000000000 38.4075000000 -1.0000000000 0.0000000000 0.0000000000 38.4075000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-03-04 2 'Structure model' 1 1 2015-06-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHASER phasing . ? 2 PHENIX refinement '(phenix.refine: 1.8.4_1496)' ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 105 ? ? -150.41 76.61 2 1 SER A 106 ? ? -172.56 -2.06 3 1 LEU A 112 ? ? 58.65 -69.14 4 1 ASP A 133 ? ? -112.01 52.03 5 1 LEU A 194 ? ? -70.86 -71.68 6 1 TYR A 195 ? ? -88.60 49.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLN 26 ? A GLN 26 4 1 Y 1 A PHE 27 ? A PHE 27 5 1 Y 1 A SER 28 ? A SER 28 6 1 Y 1 A ASP 29 ? A ASP 29 7 1 Y 1 A VAL 30 ? A VAL 30 8 1 Y 1 A GLU 31 ? A GLU 31 9 1 Y 1 A GLU 32 ? A GLU 32 10 1 Y 1 A ASN 33 ? A ASN 33 11 1 Y 1 A ARG 34 ? A ARG 34 12 1 Y 1 A THR 35 ? A THR 35 13 1 Y 1 A GLU 36 ? A GLU 36 14 1 Y 1 A ALA 37 ? A ALA 37 15 1 Y 1 A PRO 38 ? A PRO 38 16 1 Y 1 A GLU 39 ? A GLU 39 17 1 Y 1 A GLY 40 ? A GLY 40 18 1 Y 1 A THR 41 ? A THR 41 19 1 Y 1 A GLU 42 ? A GLU 42 20 1 Y 1 A SER 43 ? A SER 43 21 1 Y 1 A GLU 44 ? A GLU 44 22 1 Y 1 A ASN 197 ? A ASN 157 23 1 Y 1 A ASN 198 ? A ASN 158 24 1 Y 1 A ALA 199 ? A ALA 159 25 1 Y 1 A ALA 200 ? A ALA 160 26 1 Y 1 A ALA 201 ? A ALA 161 27 1 Y 1 A GLU 202 ? A GLU 162 28 1 Y 1 A SER 203 ? A SER 163 29 1 Y 1 A ARG 204 ? A ARG 164 30 1 Y 1 A LYS 205 ? A LYS 165 31 1 Y 1 A GLY 206 ? A GLY 166 32 1 Y 1 A GLN 207 ? A GLN 167 33 1 Y 1 A GLU 208 ? A GLU 168 34 1 Y 1 A ARG 209 ? A ARG 169 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 301 1 GOL GOL A . C 3 HOH 1 401 4 HOH HOH A . C 3 HOH 2 402 5 HOH HOH A . C 3 HOH 3 403 7 HOH HOH A . C 3 HOH 4 404 10 HOH HOH A . C 3 HOH 5 405 11 HOH HOH A . C 3 HOH 6 406 14 HOH HOH A . C 3 HOH 7 407 16 HOH HOH A . C 3 HOH 8 408 17 HOH HOH A . C 3 HOH 9 409 19 HOH HOH A . C 3 HOH 10 410 26 HOH HOH A . C 3 HOH 11 411 28 HOH HOH A . C 3 HOH 12 412 29 HOH HOH A . C 3 HOH 13 413 30 HOH HOH A . C 3 HOH 14 414 31 HOH HOH A . C 3 HOH 15 415 32 HOH HOH A . #