data_4Q2J # _entry.id 4Q2J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Q2J RCSB RCSB085522 WWPDB D_1000085522 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4Q2J _pdbx_database_status.recvd_initial_deposition_date 2014-04-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, Z.' 1 'Long, J.' 2 'Yang, X.' 3 'Shen, Y.' 4 # _citation.id primary _citation.title ;Crystal structure of the ubiquitin-like domain-CUT repeat-like tandem of special AT-rich sequence binding protein 1 (SATB1) reveals a coordinating DNA-binding mechanism. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 289 _citation.page_first 27376 _citation.page_last 27385 _citation.year 2014 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25124042 _citation.pdbx_database_id_DOI 10.1074/jbc.M114.562314 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wang, Z.' 1 primary 'Yang, X.' 2 primary 'Guo, S.' 3 primary 'Yang, Y.' 4 primary 'Su, X.C.' 5 primary 'Shen, Y.' 6 primary 'Long, J.' 7 # _cell.entry_id 4Q2J _cell.length_a 128.978 _cell.length_b 91.971 _cell.length_c 100.239 _cell.angle_alpha 90.00 _cell.angle_beta 128.97 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4Q2J _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA-binding protein SATB1' 20233.143 4 ? ? 'N-terminal domain, UNP RESIDUES' ? 2 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Special AT-rich sequence-binding protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVT DAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYA NVSAAKCQEFGRWYKHFKKT ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVT DAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYA NVSAAKCQEFGRWYKHFKKT ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 GLY n 1 6 THR n 1 7 MET n 1 8 LEU n 1 9 PRO n 1 10 VAL n 1 11 PHE n 1 12 CYS n 1 13 VAL n 1 14 VAL n 1 15 GLU n 1 16 HIS n 1 17 TYR n 1 18 GLU n 1 19 ASN n 1 20 ALA n 1 21 ILE n 1 22 GLU n 1 23 TYR n 1 24 ASP n 1 25 CYS n 1 26 LYS n 1 27 GLU n 1 28 GLU n 1 29 HIS n 1 30 ALA n 1 31 GLU n 1 32 PHE n 1 33 VAL n 1 34 LEU n 1 35 VAL n 1 36 ARG n 1 37 LYS n 1 38 ASP n 1 39 MET n 1 40 LEU n 1 41 PHE n 1 42 ASN n 1 43 GLN n 1 44 LEU n 1 45 ILE n 1 46 GLU n 1 47 MET n 1 48 ALA n 1 49 LEU n 1 50 LEU n 1 51 SER n 1 52 LEU n 1 53 GLY n 1 54 TYR n 1 55 SER n 1 56 HIS n 1 57 SER n 1 58 SER n 1 59 ALA n 1 60 ALA n 1 61 GLN n 1 62 ALA n 1 63 LYS n 1 64 GLY n 1 65 LEU n 1 66 ILE n 1 67 GLN n 1 68 VAL n 1 69 GLY n 1 70 LYS n 1 71 TRP n 1 72 ASN n 1 73 PRO n 1 74 VAL n 1 75 PRO n 1 76 LEU n 1 77 SER n 1 78 TYR n 1 79 VAL n 1 80 THR n 1 81 ASP n 1 82 ALA n 1 83 PRO n 1 84 ASP n 1 85 ALA n 1 86 THR n 1 87 VAL n 1 88 ALA n 1 89 ASP n 1 90 MET n 1 91 LEU n 1 92 GLN n 1 93 ASP n 1 94 VAL n 1 95 TYR n 1 96 HIS n 1 97 VAL n 1 98 VAL n 1 99 THR n 1 100 LEU n 1 101 LYS n 1 102 ILE n 1 103 GLN n 1 104 LEU n 1 105 HIS n 1 106 SER n 1 107 CYS n 1 108 PRO n 1 109 LYS n 1 110 LEU n 1 111 GLU n 1 112 ASP n 1 113 LEU n 1 114 PRO n 1 115 PRO n 1 116 GLU n 1 117 GLN n 1 118 TRP n 1 119 SER n 1 120 HIS n 1 121 THR n 1 122 THR n 1 123 VAL n 1 124 ARG n 1 125 ASN n 1 126 ALA n 1 127 LEU n 1 128 LYS n 1 129 ASP n 1 130 LEU n 1 131 LEU n 1 132 LYS n 1 133 ASP n 1 134 MET n 1 135 ASN n 1 136 GLN n 1 137 SER n 1 138 SER n 1 139 LEU n 1 140 ALA n 1 141 LYS n 1 142 GLU n 1 143 CYS n 1 144 PRO n 1 145 LEU n 1 146 SER n 1 147 GLN n 1 148 SER n 1 149 MET n 1 150 ILE n 1 151 SER n 1 152 SER n 1 153 ILE n 1 154 VAL n 1 155 ASN n 1 156 SER n 1 157 THR n 1 158 TYR n 1 159 TYR n 1 160 ALA n 1 161 ASN n 1 162 VAL n 1 163 SER n 1 164 ALA n 1 165 ALA n 1 166 LYS n 1 167 CYS n 1 168 GLN n 1 169 GLU n 1 170 PHE n 1 171 GLY n 1 172 ARG n 1 173 TRP n 1 174 TYR n 1 175 LYS n 1 176 HIS n 1 177 PHE n 1 178 LYS n 1 179 LYS n 1 180 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Satb1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SATB1_MOUSE _struct_ref.pdbx_db_accession Q60611 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPD ATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSA AKCQEFGRWYKHFKKT ; _struct_ref.pdbx_align_begin 71 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4Q2J A 5 ? 180 ? Q60611 71 ? 246 ? 71 246 2 1 4Q2J B 5 ? 180 ? Q60611 71 ? 246 ? 71 246 3 1 4Q2J C 5 ? 180 ? Q60611 71 ? 246 ? 71 246 4 1 4Q2J D 5 ? 180 ? Q60611 71 ? 246 ? 71 246 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Q2J GLY A 1 ? UNP Q60611 ? ? 'EXPRESSION TAG' 67 1 1 4Q2J PRO A 2 ? UNP Q60611 ? ? 'EXPRESSION TAG' 68 2 1 4Q2J GLY A 3 ? UNP Q60611 ? ? 'EXPRESSION TAG' 69 3 1 4Q2J SER A 4 ? UNP Q60611 ? ? 'EXPRESSION TAG' 70 4 2 4Q2J GLY B 1 ? UNP Q60611 ? ? 'EXPRESSION TAG' 67 5 2 4Q2J PRO B 2 ? UNP Q60611 ? ? 'EXPRESSION TAG' 68 6 2 4Q2J GLY B 3 ? UNP Q60611 ? ? 'EXPRESSION TAG' 69 7 2 4Q2J SER B 4 ? UNP Q60611 ? ? 'EXPRESSION TAG' 70 8 3 4Q2J GLY C 1 ? UNP Q60611 ? ? 'EXPRESSION TAG' 67 9 3 4Q2J PRO C 2 ? UNP Q60611 ? ? 'EXPRESSION TAG' 68 10 3 4Q2J GLY C 3 ? UNP Q60611 ? ? 'EXPRESSION TAG' 69 11 3 4Q2J SER C 4 ? UNP Q60611 ? ? 'EXPRESSION TAG' 70 12 4 4Q2J GLY D 1 ? UNP Q60611 ? ? 'EXPRESSION TAG' 67 13 4 4Q2J PRO D 2 ? UNP Q60611 ? ? 'EXPRESSION TAG' 68 14 4 4Q2J GLY D 3 ? UNP Q60611 ? ? 'EXPRESSION TAG' 69 15 4 4Q2J SER D 4 ? UNP Q60611 ? ? 'EXPRESSION TAG' 70 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4Q2J _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.86 _exptl_crystal.density_percent_sol 56.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '10% polyethylene glycol 3350, 0.1M sodium malonate pH 7.0, 0.2M glycine, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2011-03-19 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.pdbx_synchrotron_site SSRF _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9791 # _reflns.entry_id 4Q2J _reflns.observed_criterion_sigma_I 5.0 _reflns.observed_criterion_sigma_F 5.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.6 _reflns.number_obs 25454 _reflns.number_all ? _reflns.percent_possible_obs 72.14 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rsym_value 0.077 _reflns.pdbx_netI_over_sigmaI 16.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 94.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4Q2J _refine.ls_number_reflns_obs 19988 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 42.472 _refine.ls_d_res_high 2.603 _refine.ls_percent_reflns_obs 90.81 _refine.ls_R_factor_obs 0.2301 _refine.ls_R_factor_all 0.2299 _refine.ls_R_factor_R_work 0.2278 _refine.ls_R_factor_R_free 0.2707 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.97 _refine.ls_number_reflns_R_free 1266 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -17.2191 _refine.aniso_B[2][2] 35.9066 _refine.aniso_B[3][3] -18.6875 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -1.7662 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.309 _refine.solvent_model_param_bsol 40.611 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.33 _refine.pdbx_overall_phase_error 33.82 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 4021 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 4034 _refine_hist.d_res_high 2.603 _refine_hist.d_res_low 42.472 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.009 ? ? 4108 ? 'X-RAY DIFFRACTION' f_angle_d 1.309 ? ? 5581 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 19.358 ? ? 1474 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.085 ? ? 657 ? 'X-RAY DIFFRACTION' f_plane_restr 0.005 ? ? 702 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs 'X-RAY DIFFRACTION' 9 2.6032 2.7075 2100 0.3202 72.00 0.4215 . . 124 . . . . 'X-RAY DIFFRACTION' 9 2.7075 2.8307 2377 0.3017 80.00 0.4002 . . 138 . . . . 'X-RAY DIFFRACTION' 9 2.8307 2.9799 2471 0.2778 84.00 0.3651 . . 119 . . . . 'X-RAY DIFFRACTION' 9 2.9799 3.1665 2695 0.2609 91.00 0.3707 . . 136 . . . . 'X-RAY DIFFRACTION' 9 3.1665 3.4109 2834 0.2463 96.00 0.2710 . . 130 . . . . 'X-RAY DIFFRACTION' 9 3.4109 3.7540 2876 0.2328 97.00 0.2716 . . 148 . . . . 'X-RAY DIFFRACTION' 9 3.7540 4.2967 2909 0.1990 98.00 0.2728 . . 142 . . . . 'X-RAY DIFFRACTION' 9 4.2967 5.4116 2935 0.1988 99.00 0.2062 . . 171 . . . . 'X-RAY DIFFRACTION' 9 5.4116 42.4778 2991 0.2165 99.00 0.2467 . . 158 . . . . # _struct.entry_id 4Q2J _struct.title 'A novel structure-based mechanism for DNA-binding of SATB1' _struct.pdbx_descriptor 'DNA-binding protein SATB1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4Q2J _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA binding protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 40 ? ASN A 42 ? LEU A 106 ASN A 108 5 ? 3 HELX_P HELX_P2 2 GLN A 43 ? LEU A 52 ? GLN A 109 LEU A 118 1 ? 10 HELX_P HELX_P3 3 HIS A 56 ? GLN A 61 ? HIS A 122 GLN A 127 5 ? 6 HELX_P HELX_P4 4 LEU A 76 ? THR A 80 ? LEU A 142 THR A 146 1 ? 5 HELX_P HELX_P5 5 THR A 86 ? GLN A 92 ? THR A 152 GLN A 158 1 ? 7 HELX_P HELX_P6 6 PRO A 114 ? TRP A 118 ? PRO A 180 TRP A 184 5 ? 5 HELX_P HELX_P7 7 SER A 119 ? LYS A 132 ? SER A 185 LYS A 198 1 ? 14 HELX_P HELX_P8 8 ASN A 135 ? CYS A 143 ? ASN A 201 CYS A 209 1 ? 9 HELX_P HELX_P9 9 SER A 146 ? ASN A 155 ? SER A 212 ASN A 221 1 ? 10 HELX_P HELX_P10 10 SER A 163 ? PHE A 177 ? SER A 229 PHE A 243 1 ? 15 HELX_P HELX_P11 11 LEU B 40 ? ASN B 42 ? LEU B 106 ASN B 108 5 ? 3 HELX_P HELX_P12 12 GLN B 43 ? TYR B 54 ? GLN B 109 TYR B 120 1 ? 12 HELX_P HELX_P13 13 SER B 55 ? GLN B 61 ? SER B 121 GLN B 127 1 ? 7 HELX_P HELX_P14 14 LEU B 76 ? THR B 80 ? LEU B 142 THR B 146 1 ? 5 HELX_P HELX_P15 15 THR B 86 ? GLN B 92 ? THR B 152 GLN B 158 1 ? 7 HELX_P HELX_P16 16 VAL B 94 ? HIS B 96 ? VAL B 160 HIS B 162 5 ? 3 HELX_P HELX_P17 17 LEU C 40 ? ASN C 42 ? LEU C 106 ASN C 108 5 ? 3 HELX_P HELX_P18 18 GLN C 43 ? SER C 51 ? GLN C 109 SER C 117 1 ? 9 HELX_P HELX_P19 19 THR C 86 ? GLN C 92 ? THR C 152 GLN C 158 1 ? 7 HELX_P HELX_P20 20 LEU D 40 ? ASN D 42 ? LEU D 106 ASN D 108 5 ? 3 HELX_P HELX_P21 21 GLN D 43 ? SER D 51 ? GLN D 109 SER D 117 1 ? 9 HELX_P HELX_P22 22 SER D 55 ? ALA D 59 ? SER D 121 ALA D 125 5 ? 5 HELX_P HELX_P23 23 THR D 86 ? GLN D 92 ? THR D 152 GLN D 158 1 ? 7 HELX_P HELX_P24 24 LYS D 109 ? LEU D 113 ? LYS D 175 LEU D 179 5 ? 5 HELX_P HELX_P25 25 PRO D 114 ? TRP D 118 ? PRO D 180 TRP D 184 5 ? 5 HELX_P HELX_P26 26 SER D 119 ? ASP D 133 ? SER D 185 ASP D 199 1 ? 15 HELX_P HELX_P27 27 ASN D 135 ? CYS D 143 ? ASN D 201 CYS D 209 1 ? 9 HELX_P HELX_P28 28 SER D 146 ? SER D 156 ? SER D 212 SER D 222 1 ? 11 HELX_P HELX_P29 29 SER D 163 ? LYS D 179 ? SER D 229 LYS D 245 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 106 A . ? SER 172 A CYS 107 A ? CYS 173 A 1 -2.10 2 PHE 177 A . ? PHE 243 A LYS 178 A ? LYS 244 A 1 4.99 3 ALA 59 C . ? ALA 125 C ALA 60 C ? ALA 126 C 1 9.15 4 GLY 3 D . ? GLY 69 D SER 4 D ? SER 70 D 1 9.80 5 THR 157 D . ? THR 223 D TYR 158 D ? TYR 224 D 1 3.10 6 TYR 158 D . ? TYR 224 D TYR 159 D ? TYR 225 D 1 6.30 7 TYR 159 D . ? TYR 225 D ALA 160 D ? ALA 226 D 1 -3.40 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? C ? 5 ? D ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? parallel D 3 4 ? anti-parallel D 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 29 ? ARG A 36 ? HIS A 95 ARG A 102 A 2 MET A 7 ? GLU A 15 ? MET A 73 GLU A 81 A 3 VAL A 98 ? GLN A 103 ? VAL A 164 GLN A 169 A 4 LYS A 63 ? VAL A 68 ? LYS A 129 VAL A 134 A 5 VAL A 74 ? PRO A 75 ? VAL A 140 PRO A 141 B 1 HIS B 29 ? ARG B 36 ? HIS B 95 ARG B 102 B 2 MET B 7 ? GLU B 15 ? MET B 73 GLU B 81 B 3 VAL B 98 ? LEU B 104 ? VAL B 164 LEU B 170 B 4 ALA B 62 ? VAL B 68 ? ALA B 128 VAL B 134 B 5 VAL B 74 ? PRO B 75 ? VAL B 140 PRO B 141 C 1 ALA C 30 ? ARG C 36 ? ALA C 96 ARG C 102 C 2 MET C 7 ? GLU C 15 ? MET C 73 GLU C 81 C 3 VAL C 98 ? LEU C 104 ? VAL C 164 LEU C 170 C 4 ALA C 62 ? VAL C 68 ? ALA C 128 VAL C 134 C 5 VAL C 74 ? PRO C 75 ? VAL C 140 PRO C 141 D 1 ALA D 30 ? ARG D 36 ? ALA D 96 ARG D 102 D 2 MET D 7 ? GLU D 15 ? MET D 73 GLU D 81 D 3 VAL D 98 ? LEU D 104 ? VAL D 164 LEU D 170 D 4 ALA D 62 ? VAL D 68 ? ALA D 128 VAL D 134 D 5 VAL D 74 ? PRO D 75 ? VAL D 140 PRO D 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 35 ? O VAL A 101 N LEU A 8 ? N LEU A 74 A 2 3 N VAL A 13 ? N VAL A 79 O ILE A 102 ? O ILE A 168 A 3 4 O GLN A 103 ? O GLN A 169 N LYS A 63 ? N LYS A 129 A 4 5 N ILE A 66 ? N ILE A 132 O VAL A 74 ? O VAL A 140 B 1 2 O VAL B 35 ? O VAL B 101 N LEU B 8 ? N LEU B 74 B 2 3 N GLU B 15 ? N GLU B 81 O ILE B 102 ? O ILE B 168 B 3 4 O GLN B 103 ? O GLN B 169 N LYS B 63 ? N LYS B 129 B 4 5 N ILE B 66 ? N ILE B 132 O VAL B 74 ? O VAL B 140 C 1 2 O VAL C 33 ? O VAL C 99 N VAL C 10 ? N VAL C 76 C 2 3 N PHE C 11 ? N PHE C 77 O LEU C 100 ? O LEU C 166 C 3 4 O GLN C 103 ? O GLN C 169 N LYS C 63 ? N LYS C 129 C 4 5 N ILE C 66 ? N ILE C 132 O VAL C 74 ? O VAL C 140 D 1 2 O VAL D 33 ? O VAL D 99 N VAL D 10 ? N VAL D 76 D 2 3 N GLU D 15 ? N GLU D 81 O LEU D 104 ? O LEU D 170 D 3 4 O GLN D 103 ? O GLN D 169 N LYS D 63 ? N LYS D 129 D 4 5 N ILE D 66 ? N ILE D 132 O VAL D 74 ? O VAL D 140 # _database_PDB_matrix.entry_id 4Q2J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4Q2J _atom_sites.fract_transf_matrix[1][1] 0.007753 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006272 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010873 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012832 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 67 67 GLY GLY A . n A 1 2 PRO 2 68 68 PRO PRO A . n A 1 3 GLY 3 69 69 GLY GLY A . n A 1 4 SER 4 70 70 SER SER A . n A 1 5 GLY 5 71 71 GLY GLY A . n A 1 6 THR 6 72 72 THR THR A . n A 1 7 MET 7 73 73 MET MET A . n A 1 8 LEU 8 74 74 LEU LEU A . n A 1 9 PRO 9 75 75 PRO PRO A . n A 1 10 VAL 10 76 76 VAL VAL A . n A 1 11 PHE 11 77 77 PHE PHE A . n A 1 12 CYS 12 78 78 CYS CYS A . n A 1 13 VAL 13 79 79 VAL VAL A . n A 1 14 VAL 14 80 80 VAL VAL A . n A 1 15 GLU 15 81 81 GLU GLU A . n A 1 16 HIS 16 82 82 HIS HIS A . n A 1 17 TYR 17 83 ? ? ? A . n A 1 18 GLU 18 84 ? ? ? A . n A 1 19 ASN 19 85 ? ? ? A . n A 1 20 ALA 20 86 ? ? ? A . n A 1 21 ILE 21 87 ? ? ? A . n A 1 22 GLU 22 88 ? ? ? A . n A 1 23 TYR 23 89 ? ? ? A . n A 1 24 ASP 24 90 ? ? ? A . n A 1 25 CYS 25 91 ? ? ? A . n A 1 26 LYS 26 92 92 LYS LYS A . n A 1 27 GLU 27 93 93 GLU GLU A . n A 1 28 GLU 28 94 94 GLU GLU A . n A 1 29 HIS 29 95 95 HIS HIS A . n A 1 30 ALA 30 96 96 ALA ALA A . n A 1 31 GLU 31 97 97 GLU GLU A . n A 1 32 PHE 32 98 98 PHE PHE A . n A 1 33 VAL 33 99 99 VAL VAL A . n A 1 34 LEU 34 100 100 LEU LEU A . n A 1 35 VAL 35 101 101 VAL VAL A . n A 1 36 ARG 36 102 102 ARG ARG A . n A 1 37 LYS 37 103 103 LYS LYS A . n A 1 38 ASP 38 104 104 ASP ASP A . n A 1 39 MET 39 105 105 MET MET A . n A 1 40 LEU 40 106 106 LEU LEU A . n A 1 41 PHE 41 107 107 PHE PHE A . n A 1 42 ASN 42 108 108 ASN ASN A . n A 1 43 GLN 43 109 109 GLN GLN A . n A 1 44 LEU 44 110 110 LEU LEU A . n A 1 45 ILE 45 111 111 ILE ILE A . n A 1 46 GLU 46 112 112 GLU GLU A . n A 1 47 MET 47 113 113 MET MET A . n A 1 48 ALA 48 114 114 ALA ALA A . n A 1 49 LEU 49 115 115 LEU LEU A . n A 1 50 LEU 50 116 116 LEU LEU A . n A 1 51 SER 51 117 117 SER SER A . n A 1 52 LEU 52 118 118 LEU LEU A . n A 1 53 GLY 53 119 119 GLY GLY A . n A 1 54 TYR 54 120 120 TYR TYR A . n A 1 55 SER 55 121 121 SER SER A . n A 1 56 HIS 56 122 122 HIS HIS A . n A 1 57 SER 57 123 123 SER SER A . n A 1 58 SER 58 124 124 SER SER A . n A 1 59 ALA 59 125 125 ALA ALA A . n A 1 60 ALA 60 126 126 ALA ALA A . n A 1 61 GLN 61 127 127 GLN GLN A . n A 1 62 ALA 62 128 128 ALA ALA A . n A 1 63 LYS 63 129 129 LYS LYS A . n A 1 64 GLY 64 130 130 GLY GLY A . n A 1 65 LEU 65 131 131 LEU LEU A . n A 1 66 ILE 66 132 132 ILE ILE A . n A 1 67 GLN 67 133 133 GLN GLN A . n A 1 68 VAL 68 134 134 VAL VAL A . n A 1 69 GLY 69 135 135 GLY GLY A . n A 1 70 LYS 70 136 136 LYS LYS A . n A 1 71 TRP 71 137 137 TRP TRP A . n A 1 72 ASN 72 138 138 ASN ASN A . n A 1 73 PRO 73 139 139 PRO PRO A . n A 1 74 VAL 74 140 140 VAL VAL A . n A 1 75 PRO 75 141 141 PRO PRO A . n A 1 76 LEU 76 142 142 LEU LEU A . n A 1 77 SER 77 143 143 SER SER A . n A 1 78 TYR 78 144 144 TYR TYR A . n A 1 79 VAL 79 145 145 VAL VAL A . n A 1 80 THR 80 146 146 THR THR A . n A 1 81 ASP 81 147 147 ASP ASP A . n A 1 82 ALA 82 148 148 ALA ALA A . n A 1 83 PRO 83 149 149 PRO PRO A . n A 1 84 ASP 84 150 150 ASP ASP A . n A 1 85 ALA 85 151 151 ALA ALA A . n A 1 86 THR 86 152 152 THR THR A . n A 1 87 VAL 87 153 153 VAL VAL A . n A 1 88 ALA 88 154 154 ALA ALA A . n A 1 89 ASP 89 155 155 ASP ASP A . n A 1 90 MET 90 156 156 MET MET A . n A 1 91 LEU 91 157 157 LEU LEU A . n A 1 92 GLN 92 158 158 GLN GLN A . n A 1 93 ASP 93 159 159 ASP ASP A . n A 1 94 VAL 94 160 160 VAL VAL A . n A 1 95 TYR 95 161 161 TYR TYR A . n A 1 96 HIS 96 162 162 HIS HIS A . n A 1 97 VAL 97 163 163 VAL VAL A . n A 1 98 VAL 98 164 164 VAL VAL A . n A 1 99 THR 99 165 165 THR THR A . n A 1 100 LEU 100 166 166 LEU LEU A . n A 1 101 LYS 101 167 167 LYS LYS A . n A 1 102 ILE 102 168 168 ILE ILE A . n A 1 103 GLN 103 169 169 GLN GLN A . n A 1 104 LEU 104 170 170 LEU LEU A . n A 1 105 HIS 105 171 171 HIS HIS A . n A 1 106 SER 106 172 172 SER SER A . n A 1 107 CYS 107 173 173 CYS CYS A . n A 1 108 PRO 108 174 174 PRO PRO A . n A 1 109 LYS 109 175 175 LYS LYS A . n A 1 110 LEU 110 176 176 LEU LEU A . n A 1 111 GLU 111 177 177 GLU GLU A . n A 1 112 ASP 112 178 178 ASP ASP A . n A 1 113 LEU 113 179 179 LEU LEU A . n A 1 114 PRO 114 180 180 PRO PRO A . n A 1 115 PRO 115 181 181 PRO PRO A . n A 1 116 GLU 116 182 182 GLU GLU A . n A 1 117 GLN 117 183 183 GLN GLN A . n A 1 118 TRP 118 184 184 TRP TRP A . n A 1 119 SER 119 185 185 SER SER A . n A 1 120 HIS 120 186 186 HIS HIS A . n A 1 121 THR 121 187 187 THR THR A . n A 1 122 THR 122 188 188 THR THR A . n A 1 123 VAL 123 189 189 VAL VAL A . n A 1 124 ARG 124 190 190 ARG ARG A . n A 1 125 ASN 125 191 191 ASN ASN A . n A 1 126 ALA 126 192 192 ALA ALA A . n A 1 127 LEU 127 193 193 LEU LEU A . n A 1 128 LYS 128 194 194 LYS LYS A . n A 1 129 ASP 129 195 195 ASP ASP A . n A 1 130 LEU 130 196 196 LEU LEU A . n A 1 131 LEU 131 197 197 LEU LEU A . n A 1 132 LYS 132 198 198 LYS LYS A . n A 1 133 ASP 133 199 199 ASP ASP A . n A 1 134 MET 134 200 200 MET MET A . n A 1 135 ASN 135 201 201 ASN ASN A . n A 1 136 GLN 136 202 202 GLN GLN A . n A 1 137 SER 137 203 203 SER SER A . n A 1 138 SER 138 204 204 SER SER A . n A 1 139 LEU 139 205 205 LEU LEU A . n A 1 140 ALA 140 206 206 ALA ALA A . n A 1 141 LYS 141 207 207 LYS LYS A . n A 1 142 GLU 142 208 208 GLU GLU A . n A 1 143 CYS 143 209 209 CYS CYS A . n A 1 144 PRO 144 210 210 PRO PRO A . n A 1 145 LEU 145 211 211 LEU LEU A . n A 1 146 SER 146 212 212 SER SER A . n A 1 147 GLN 147 213 213 GLN GLN A . n A 1 148 SER 148 214 214 SER SER A . n A 1 149 MET 149 215 215 MET MET A . n A 1 150 ILE 150 216 216 ILE ILE A . n A 1 151 SER 151 217 217 SER SER A . n A 1 152 SER 152 218 218 SER SER A . n A 1 153 ILE 153 219 219 ILE ILE A . n A 1 154 VAL 154 220 220 VAL VAL A . n A 1 155 ASN 155 221 221 ASN ASN A . n A 1 156 SER 156 222 222 SER SER A . n A 1 157 THR 157 223 223 THR THR A . n A 1 158 TYR 158 224 224 TYR TYR A . n A 1 159 TYR 159 225 225 TYR TYR A . n A 1 160 ALA 160 226 226 ALA ALA A . n A 1 161 ASN 161 227 227 ASN ASN A . n A 1 162 VAL 162 228 228 VAL VAL A . n A 1 163 SER 163 229 229 SER SER A . n A 1 164 ALA 164 230 230 ALA ALA A . n A 1 165 ALA 165 231 231 ALA ALA A . n A 1 166 LYS 166 232 232 LYS LYS A . n A 1 167 CYS 167 233 233 CYS CYS A . n A 1 168 GLN 168 234 234 GLN GLN A . n A 1 169 GLU 169 235 235 GLU GLU A . n A 1 170 PHE 170 236 236 PHE PHE A . n A 1 171 GLY 171 237 237 GLY GLY A . n A 1 172 ARG 172 238 238 ARG ARG A . n A 1 173 TRP 173 239 239 TRP TRP A . n A 1 174 TYR 174 240 240 TYR TYR A . n A 1 175 LYS 175 241 241 LYS LYS A . n A 1 176 HIS 176 242 242 HIS HIS A . n A 1 177 PHE 177 243 243 PHE PHE A . n A 1 178 LYS 178 244 244 LYS LYS A . n A 1 179 LYS 179 245 ? ? ? A . n A 1 180 THR 180 246 ? ? ? A . n B 1 1 GLY 1 67 ? ? ? B . n B 1 2 PRO 2 68 68 PRO PRO B . n B 1 3 GLY 3 69 69 GLY GLY B . n B 1 4 SER 4 70 70 SER SER B . n B 1 5 GLY 5 71 71 GLY GLY B . n B 1 6 THR 6 72 72 THR THR B . n B 1 7 MET 7 73 73 MET MET B . n B 1 8 LEU 8 74 74 LEU LEU B . n B 1 9 PRO 9 75 75 PRO PRO B . n B 1 10 VAL 10 76 76 VAL VAL B . n B 1 11 PHE 11 77 77 PHE PHE B . n B 1 12 CYS 12 78 78 CYS CYS B . n B 1 13 VAL 13 79 79 VAL VAL B . n B 1 14 VAL 14 80 80 VAL VAL B . n B 1 15 GLU 15 81 81 GLU GLU B . n B 1 16 HIS 16 82 82 HIS HIS B . n B 1 17 TYR 17 83 ? ? ? B . n B 1 18 GLU 18 84 ? ? ? B . n B 1 19 ASN 19 85 ? ? ? B . n B 1 20 ALA 20 86 ? ? ? B . n B 1 21 ILE 21 87 ? ? ? B . n B 1 22 GLU 22 88 ? ? ? B . n B 1 23 TYR 23 89 ? ? ? B . n B 1 24 ASP 24 90 ? ? ? B . n B 1 25 CYS 25 91 ? ? ? B . n B 1 26 LYS 26 92 ? ? ? B . n B 1 27 GLU 27 93 93 GLU GLU B . n B 1 28 GLU 28 94 94 GLU GLU B . n B 1 29 HIS 29 95 95 HIS HIS B . n B 1 30 ALA 30 96 96 ALA ALA B . n B 1 31 GLU 31 97 97 GLU GLU B . n B 1 32 PHE 32 98 98 PHE PHE B . n B 1 33 VAL 33 99 99 VAL VAL B . n B 1 34 LEU 34 100 100 LEU LEU B . n B 1 35 VAL 35 101 101 VAL VAL B . n B 1 36 ARG 36 102 102 ARG ARG B . n B 1 37 LYS 37 103 103 LYS LYS B . n B 1 38 ASP 38 104 104 ASP ASP B . n B 1 39 MET 39 105 105 MET MET B . n B 1 40 LEU 40 106 106 LEU LEU B . n B 1 41 PHE 41 107 107 PHE PHE B . n B 1 42 ASN 42 108 108 ASN ASN B . n B 1 43 GLN 43 109 109 GLN GLN B . n B 1 44 LEU 44 110 110 LEU LEU B . n B 1 45 ILE 45 111 111 ILE ILE B . n B 1 46 GLU 46 112 112 GLU GLU B . n B 1 47 MET 47 113 113 MET MET B . n B 1 48 ALA 48 114 114 ALA ALA B . n B 1 49 LEU 49 115 115 LEU LEU B . n B 1 50 LEU 50 116 116 LEU LEU B . n B 1 51 SER 51 117 117 SER SER B . n B 1 52 LEU 52 118 118 LEU LEU B . n B 1 53 GLY 53 119 119 GLY GLY B . n B 1 54 TYR 54 120 120 TYR TYR B . n B 1 55 SER 55 121 121 SER SER B . n B 1 56 HIS 56 122 122 HIS HIS B . n B 1 57 SER 57 123 123 SER SER B . n B 1 58 SER 58 124 124 SER SER B . n B 1 59 ALA 59 125 125 ALA ALA B . n B 1 60 ALA 60 126 126 ALA ALA B . n B 1 61 GLN 61 127 127 GLN GLN B . n B 1 62 ALA 62 128 128 ALA ALA B . n B 1 63 LYS 63 129 129 LYS LYS B . n B 1 64 GLY 64 130 130 GLY GLY B . n B 1 65 LEU 65 131 131 LEU LEU B . n B 1 66 ILE 66 132 132 ILE ILE B . n B 1 67 GLN 67 133 133 GLN GLN B . n B 1 68 VAL 68 134 134 VAL VAL B . n B 1 69 GLY 69 135 135 GLY GLY B . n B 1 70 LYS 70 136 136 LYS LYS B . n B 1 71 TRP 71 137 137 TRP TRP B . n B 1 72 ASN 72 138 138 ASN ASN B . n B 1 73 PRO 73 139 139 PRO PRO B . n B 1 74 VAL 74 140 140 VAL VAL B . n B 1 75 PRO 75 141 141 PRO PRO B . n B 1 76 LEU 76 142 142 LEU LEU B . n B 1 77 SER 77 143 143 SER SER B . n B 1 78 TYR 78 144 144 TYR TYR B . n B 1 79 VAL 79 145 145 VAL VAL B . n B 1 80 THR 80 146 146 THR THR B . n B 1 81 ASP 81 147 147 ASP ASP B . n B 1 82 ALA 82 148 148 ALA ALA B . n B 1 83 PRO 83 149 149 PRO PRO B . n B 1 84 ASP 84 150 150 ASP ASP B . n B 1 85 ALA 85 151 151 ALA ALA B . n B 1 86 THR 86 152 152 THR THR B . n B 1 87 VAL 87 153 153 VAL VAL B . n B 1 88 ALA 88 154 154 ALA ALA B . n B 1 89 ASP 89 155 155 ASP ASP B . n B 1 90 MET 90 156 156 MET MET B . n B 1 91 LEU 91 157 157 LEU LEU B . n B 1 92 GLN 92 158 158 GLN GLN B . n B 1 93 ASP 93 159 159 ASP ASP B . n B 1 94 VAL 94 160 160 VAL VAL B . n B 1 95 TYR 95 161 161 TYR TYR B . n B 1 96 HIS 96 162 162 HIS HIS B . n B 1 97 VAL 97 163 163 VAL VAL B . n B 1 98 VAL 98 164 164 VAL VAL B . n B 1 99 THR 99 165 165 THR THR B . n B 1 100 LEU 100 166 166 LEU LEU B . n B 1 101 LYS 101 167 167 LYS LYS B . n B 1 102 ILE 102 168 168 ILE ILE B . n B 1 103 GLN 103 169 169 GLN GLN B . n B 1 104 LEU 104 170 170 LEU LEU B . n B 1 105 HIS 105 171 171 HIS HIS B . n B 1 106 SER 106 172 ? ? ? B . n B 1 107 CYS 107 173 ? ? ? B . n B 1 108 PRO 108 174 ? ? ? B . n B 1 109 LYS 109 175 ? ? ? B . n B 1 110 LEU 110 176 ? ? ? B . n B 1 111 GLU 111 177 ? ? ? B . n B 1 112 ASP 112 178 ? ? ? B . n B 1 113 LEU 113 179 ? ? ? B . n B 1 114 PRO 114 180 ? ? ? B . n B 1 115 PRO 115 181 ? ? ? B . n B 1 116 GLU 116 182 ? ? ? B . n B 1 117 GLN 117 183 ? ? ? B . n B 1 118 TRP 118 184 ? ? ? B . n B 1 119 SER 119 185 ? ? ? B . n B 1 120 HIS 120 186 ? ? ? B . n B 1 121 THR 121 187 ? ? ? B . n B 1 122 THR 122 188 ? ? ? B . n B 1 123 VAL 123 189 ? ? ? B . n B 1 124 ARG 124 190 ? ? ? B . n B 1 125 ASN 125 191 ? ? ? B . n B 1 126 ALA 126 192 ? ? ? B . n B 1 127 LEU 127 193 ? ? ? B . n B 1 128 LYS 128 194 ? ? ? B . n B 1 129 ASP 129 195 ? ? ? B . n B 1 130 LEU 130 196 ? ? ? B . n B 1 131 LEU 131 197 ? ? ? B . n B 1 132 LYS 132 198 ? ? ? B . n B 1 133 ASP 133 199 ? ? ? B . n B 1 134 MET 134 200 ? ? ? B . n B 1 135 ASN 135 201 ? ? ? B . n B 1 136 GLN 136 202 ? ? ? B . n B 1 137 SER 137 203 ? ? ? B . n B 1 138 SER 138 204 ? ? ? B . n B 1 139 LEU 139 205 ? ? ? B . n B 1 140 ALA 140 206 ? ? ? B . n B 1 141 LYS 141 207 ? ? ? B . n B 1 142 GLU 142 208 ? ? ? B . n B 1 143 CYS 143 209 ? ? ? B . n B 1 144 PRO 144 210 ? ? ? B . n B 1 145 LEU 145 211 ? ? ? B . n B 1 146 SER 146 212 ? ? ? B . n B 1 147 GLN 147 213 ? ? ? B . n B 1 148 SER 148 214 ? ? ? B . n B 1 149 MET 149 215 ? ? ? B . n B 1 150 ILE 150 216 ? ? ? B . n B 1 151 SER 151 217 ? ? ? B . n B 1 152 SER 152 218 ? ? ? B . n B 1 153 ILE 153 219 ? ? ? B . n B 1 154 VAL 154 220 ? ? ? B . n B 1 155 ASN 155 221 ? ? ? B . n B 1 156 SER 156 222 ? ? ? B . n B 1 157 THR 157 223 ? ? ? B . n B 1 158 TYR 158 224 ? ? ? B . n B 1 159 TYR 159 225 ? ? ? B . n B 1 160 ALA 160 226 ? ? ? B . n B 1 161 ASN 161 227 ? ? ? B . n B 1 162 VAL 162 228 ? ? ? B . n B 1 163 SER 163 229 ? ? ? B . n B 1 164 ALA 164 230 ? ? ? B . n B 1 165 ALA 165 231 ? ? ? B . n B 1 166 LYS 166 232 ? ? ? B . n B 1 167 CYS 167 233 ? ? ? B . n B 1 168 GLN 168 234 ? ? ? B . n B 1 169 GLU 169 235 ? ? ? B . n B 1 170 PHE 170 236 ? ? ? B . n B 1 171 GLY 171 237 ? ? ? B . n B 1 172 ARG 172 238 ? ? ? B . n B 1 173 TRP 173 239 ? ? ? B . n B 1 174 TYR 174 240 ? ? ? B . n B 1 175 LYS 175 241 ? ? ? B . n B 1 176 HIS 176 242 ? ? ? B . n B 1 177 PHE 177 243 ? ? ? B . n B 1 178 LYS 178 244 ? ? ? B . n B 1 179 LYS 179 245 ? ? ? B . n B 1 180 THR 180 246 ? ? ? B . n C 1 1 GLY 1 67 ? ? ? C . n C 1 2 PRO 2 68 ? ? ? C . n C 1 3 GLY 3 69 69 GLY GLY C . n C 1 4 SER 4 70 70 SER SER C . n C 1 5 GLY 5 71 71 GLY GLY C . n C 1 6 THR 6 72 72 THR THR C . n C 1 7 MET 7 73 73 MET MET C . n C 1 8 LEU 8 74 74 LEU LEU C . n C 1 9 PRO 9 75 75 PRO PRO C . n C 1 10 VAL 10 76 76 VAL VAL C . n C 1 11 PHE 11 77 77 PHE PHE C . n C 1 12 CYS 12 78 78 CYS CYS C . n C 1 13 VAL 13 79 79 VAL VAL C . n C 1 14 VAL 14 80 80 VAL VAL C . n C 1 15 GLU 15 81 81 GLU GLU C . n C 1 16 HIS 16 82 82 HIS HIS C . n C 1 17 TYR 17 83 ? ? ? C . n C 1 18 GLU 18 84 ? ? ? C . n C 1 19 ASN 19 85 ? ? ? C . n C 1 20 ALA 20 86 ? ? ? C . n C 1 21 ILE 21 87 ? ? ? C . n C 1 22 GLU 22 88 ? ? ? C . n C 1 23 TYR 23 89 ? ? ? C . n C 1 24 ASP 24 90 ? ? ? C . n C 1 25 CYS 25 91 ? ? ? C . n C 1 26 LYS 26 92 ? ? ? C . n C 1 27 GLU 27 93 ? ? ? C . n C 1 28 GLU 28 94 94 GLU GLU C . n C 1 29 HIS 29 95 95 HIS HIS C . n C 1 30 ALA 30 96 96 ALA ALA C . n C 1 31 GLU 31 97 97 GLU GLU C . n C 1 32 PHE 32 98 98 PHE PHE C . n C 1 33 VAL 33 99 99 VAL VAL C . n C 1 34 LEU 34 100 100 LEU LEU C . n C 1 35 VAL 35 101 101 VAL VAL C . n C 1 36 ARG 36 102 102 ARG ARG C . n C 1 37 LYS 37 103 103 LYS LYS C . n C 1 38 ASP 38 104 104 ASP ASP C . n C 1 39 MET 39 105 105 MET MET C . n C 1 40 LEU 40 106 106 LEU LEU C . n C 1 41 PHE 41 107 107 PHE PHE C . n C 1 42 ASN 42 108 108 ASN ASN C . n C 1 43 GLN 43 109 109 GLN GLN C . n C 1 44 LEU 44 110 110 LEU LEU C . n C 1 45 ILE 45 111 111 ILE ILE C . n C 1 46 GLU 46 112 112 GLU GLU C . n C 1 47 MET 47 113 113 MET MET C . n C 1 48 ALA 48 114 114 ALA ALA C . n C 1 49 LEU 49 115 115 LEU LEU C . n C 1 50 LEU 50 116 116 LEU LEU C . n C 1 51 SER 51 117 117 SER SER C . n C 1 52 LEU 52 118 118 LEU LEU C . n C 1 53 GLY 53 119 119 GLY GLY C . n C 1 54 TYR 54 120 120 TYR TYR C . n C 1 55 SER 55 121 121 SER SER C . n C 1 56 HIS 56 122 122 HIS HIS C . n C 1 57 SER 57 123 123 SER SER C . n C 1 58 SER 58 124 124 SER SER C . n C 1 59 ALA 59 125 125 ALA ALA C . n C 1 60 ALA 60 126 126 ALA ALA C . n C 1 61 GLN 61 127 127 GLN GLN C . n C 1 62 ALA 62 128 128 ALA ALA C . n C 1 63 LYS 63 129 129 LYS LYS C . n C 1 64 GLY 64 130 130 GLY GLY C . n C 1 65 LEU 65 131 131 LEU LEU C . n C 1 66 ILE 66 132 132 ILE ILE C . n C 1 67 GLN 67 133 133 GLN GLN C . n C 1 68 VAL 68 134 134 VAL VAL C . n C 1 69 GLY 69 135 135 GLY GLY C . n C 1 70 LYS 70 136 136 LYS LYS C . n C 1 71 TRP 71 137 137 TRP TRP C . n C 1 72 ASN 72 138 138 ASN ASN C . n C 1 73 PRO 73 139 139 PRO PRO C . n C 1 74 VAL 74 140 140 VAL VAL C . n C 1 75 PRO 75 141 141 PRO PRO C . n C 1 76 LEU 76 142 142 LEU LEU C . n C 1 77 SER 77 143 143 SER SER C . n C 1 78 TYR 78 144 144 TYR TYR C . n C 1 79 VAL 79 145 145 VAL VAL C . n C 1 80 THR 80 146 146 THR THR C . n C 1 81 ASP 81 147 147 ASP ASP C . n C 1 82 ALA 82 148 148 ALA ALA C . n C 1 83 PRO 83 149 149 PRO PRO C . n C 1 84 ASP 84 150 150 ASP ASP C . n C 1 85 ALA 85 151 151 ALA ALA C . n C 1 86 THR 86 152 152 THR THR C . n C 1 87 VAL 87 153 153 VAL VAL C . n C 1 88 ALA 88 154 154 ALA ALA C . n C 1 89 ASP 89 155 155 ASP ASP C . n C 1 90 MET 90 156 156 MET MET C . n C 1 91 LEU 91 157 157 LEU LEU C . n C 1 92 GLN 92 158 158 GLN GLN C . n C 1 93 ASP 93 159 159 ASP ASP C . n C 1 94 VAL 94 160 160 VAL VAL C . n C 1 95 TYR 95 161 161 TYR TYR C . n C 1 96 HIS 96 162 162 HIS HIS C . n C 1 97 VAL 97 163 163 VAL VAL C . n C 1 98 VAL 98 164 164 VAL VAL C . n C 1 99 THR 99 165 165 THR THR C . n C 1 100 LEU 100 166 166 LEU LEU C . n C 1 101 LYS 101 167 167 LYS LYS C . n C 1 102 ILE 102 168 168 ILE ILE C . n C 1 103 GLN 103 169 169 GLN GLN C . n C 1 104 LEU 104 170 170 LEU LEU C . n C 1 105 HIS 105 171 171 HIS HIS C . n C 1 106 SER 106 172 ? ? ? C . n C 1 107 CYS 107 173 ? ? ? C . n C 1 108 PRO 108 174 ? ? ? C . n C 1 109 LYS 109 175 ? ? ? C . n C 1 110 LEU 110 176 ? ? ? C . n C 1 111 GLU 111 177 ? ? ? C . n C 1 112 ASP 112 178 ? ? ? C . n C 1 113 LEU 113 179 ? ? ? C . n C 1 114 PRO 114 180 ? ? ? C . n C 1 115 PRO 115 181 ? ? ? C . n C 1 116 GLU 116 182 ? ? ? C . n C 1 117 GLN 117 183 ? ? ? C . n C 1 118 TRP 118 184 ? ? ? C . n C 1 119 SER 119 185 ? ? ? C . n C 1 120 HIS 120 186 ? ? ? C . n C 1 121 THR 121 187 ? ? ? C . n C 1 122 THR 122 188 ? ? ? C . n C 1 123 VAL 123 189 ? ? ? C . n C 1 124 ARG 124 190 ? ? ? C . n C 1 125 ASN 125 191 ? ? ? C . n C 1 126 ALA 126 192 ? ? ? C . n C 1 127 LEU 127 193 ? ? ? C . n C 1 128 LYS 128 194 ? ? ? C . n C 1 129 ASP 129 195 ? ? ? C . n C 1 130 LEU 130 196 ? ? ? C . n C 1 131 LEU 131 197 ? ? ? C . n C 1 132 LYS 132 198 ? ? ? C . n C 1 133 ASP 133 199 ? ? ? C . n C 1 134 MET 134 200 ? ? ? C . n C 1 135 ASN 135 201 ? ? ? C . n C 1 136 GLN 136 202 ? ? ? C . n C 1 137 SER 137 203 ? ? ? C . n C 1 138 SER 138 204 ? ? ? C . n C 1 139 LEU 139 205 ? ? ? C . n C 1 140 ALA 140 206 ? ? ? C . n C 1 141 LYS 141 207 ? ? ? C . n C 1 142 GLU 142 208 ? ? ? C . n C 1 143 CYS 143 209 ? ? ? C . n C 1 144 PRO 144 210 ? ? ? C . n C 1 145 LEU 145 211 ? ? ? C . n C 1 146 SER 146 212 ? ? ? C . n C 1 147 GLN 147 213 ? ? ? C . n C 1 148 SER 148 214 ? ? ? C . n C 1 149 MET 149 215 ? ? ? C . n C 1 150 ILE 150 216 ? ? ? C . n C 1 151 SER 151 217 ? ? ? C . n C 1 152 SER 152 218 ? ? ? C . n C 1 153 ILE 153 219 ? ? ? C . n C 1 154 VAL 154 220 ? ? ? C . n C 1 155 ASN 155 221 ? ? ? C . n C 1 156 SER 156 222 ? ? ? C . n C 1 157 THR 157 223 ? ? ? C . n C 1 158 TYR 158 224 ? ? ? C . n C 1 159 TYR 159 225 ? ? ? C . n C 1 160 ALA 160 226 ? ? ? C . n C 1 161 ASN 161 227 ? ? ? C . n C 1 162 VAL 162 228 ? ? ? C . n C 1 163 SER 163 229 ? ? ? C . n C 1 164 ALA 164 230 ? ? ? C . n C 1 165 ALA 165 231 ? ? ? C . n C 1 166 LYS 166 232 ? ? ? C . n C 1 167 CYS 167 233 ? ? ? C . n C 1 168 GLN 168 234 ? ? ? C . n C 1 169 GLU 169 235 ? ? ? C . n C 1 170 PHE 170 236 ? ? ? C . n C 1 171 GLY 171 237 ? ? ? C . n C 1 172 ARG 172 238 ? ? ? C . n C 1 173 TRP 173 239 ? ? ? C . n C 1 174 TYR 174 240 ? ? ? C . n C 1 175 LYS 175 241 ? ? ? C . n C 1 176 HIS 176 242 ? ? ? C . n C 1 177 PHE 177 243 ? ? ? C . n C 1 178 LYS 178 244 ? ? ? C . n C 1 179 LYS 179 245 ? ? ? C . n C 1 180 THR 180 246 ? ? ? C . n D 1 1 GLY 1 67 ? ? ? D . n D 1 2 PRO 2 68 68 PRO PRO D . n D 1 3 GLY 3 69 69 GLY GLY D . n D 1 4 SER 4 70 70 SER SER D . n D 1 5 GLY 5 71 71 GLY GLY D . n D 1 6 THR 6 72 72 THR THR D . n D 1 7 MET 7 73 73 MET MET D . n D 1 8 LEU 8 74 74 LEU LEU D . n D 1 9 PRO 9 75 75 PRO PRO D . n D 1 10 VAL 10 76 76 VAL VAL D . n D 1 11 PHE 11 77 77 PHE PHE D . n D 1 12 CYS 12 78 78 CYS CYS D . n D 1 13 VAL 13 79 79 VAL VAL D . n D 1 14 VAL 14 80 80 VAL VAL D . n D 1 15 GLU 15 81 81 GLU GLU D . n D 1 16 HIS 16 82 82 HIS HIS D . n D 1 17 TYR 17 83 83 TYR TYR D . n D 1 18 GLU 18 84 84 GLU GLU D . n D 1 19 ASN 19 85 ? ? ? D . n D 1 20 ALA 20 86 ? ? ? D . n D 1 21 ILE 21 87 ? ? ? D . n D 1 22 GLU 22 88 ? ? ? D . n D 1 23 TYR 23 89 ? ? ? D . n D 1 24 ASP 24 90 ? ? ? D . n D 1 25 CYS 25 91 ? ? ? D . n D 1 26 LYS 26 92 ? ? ? D . n D 1 27 GLU 27 93 ? ? ? D . n D 1 28 GLU 28 94 94 GLU GLU D . n D 1 29 HIS 29 95 95 HIS HIS D . n D 1 30 ALA 30 96 96 ALA ALA D . n D 1 31 GLU 31 97 97 GLU GLU D . n D 1 32 PHE 32 98 98 PHE PHE D . n D 1 33 VAL 33 99 99 VAL VAL D . n D 1 34 LEU 34 100 100 LEU LEU D . n D 1 35 VAL 35 101 101 VAL VAL D . n D 1 36 ARG 36 102 102 ARG ARG D . n D 1 37 LYS 37 103 103 LYS LYS D . n D 1 38 ASP 38 104 104 ASP ASP D . n D 1 39 MET 39 105 105 MET MET D . n D 1 40 LEU 40 106 106 LEU LEU D . n D 1 41 PHE 41 107 107 PHE PHE D . n D 1 42 ASN 42 108 108 ASN ASN D . n D 1 43 GLN 43 109 109 GLN GLN D . n D 1 44 LEU 44 110 110 LEU LEU D . n D 1 45 ILE 45 111 111 ILE ILE D . n D 1 46 GLU 46 112 112 GLU GLU D . n D 1 47 MET 47 113 113 MET MET D . n D 1 48 ALA 48 114 114 ALA ALA D . n D 1 49 LEU 49 115 115 LEU LEU D . n D 1 50 LEU 50 116 116 LEU LEU D . n D 1 51 SER 51 117 117 SER SER D . n D 1 52 LEU 52 118 118 LEU LEU D . n D 1 53 GLY 53 119 119 GLY GLY D . n D 1 54 TYR 54 120 120 TYR TYR D . n D 1 55 SER 55 121 121 SER SER D . n D 1 56 HIS 56 122 122 HIS HIS D . n D 1 57 SER 57 123 123 SER SER D . n D 1 58 SER 58 124 124 SER SER D . n D 1 59 ALA 59 125 125 ALA ALA D . n D 1 60 ALA 60 126 126 ALA ALA D . n D 1 61 GLN 61 127 127 GLN GLN D . n D 1 62 ALA 62 128 128 ALA ALA D . n D 1 63 LYS 63 129 129 LYS LYS D . n D 1 64 GLY 64 130 130 GLY GLY D . n D 1 65 LEU 65 131 131 LEU LEU D . n D 1 66 ILE 66 132 132 ILE ILE D . n D 1 67 GLN 67 133 133 GLN GLN D . n D 1 68 VAL 68 134 134 VAL VAL D . n D 1 69 GLY 69 135 135 GLY GLY D . n D 1 70 LYS 70 136 136 LYS LYS D . n D 1 71 TRP 71 137 137 TRP TRP D . n D 1 72 ASN 72 138 138 ASN ASN D . n D 1 73 PRO 73 139 139 PRO PRO D . n D 1 74 VAL 74 140 140 VAL VAL D . n D 1 75 PRO 75 141 141 PRO PRO D . n D 1 76 LEU 76 142 142 LEU LEU D . n D 1 77 SER 77 143 143 SER SER D . n D 1 78 TYR 78 144 144 TYR TYR D . n D 1 79 VAL 79 145 145 VAL VAL D . n D 1 80 THR 80 146 146 THR THR D . n D 1 81 ASP 81 147 147 ASP ASP D . n D 1 82 ALA 82 148 148 ALA ALA D . n D 1 83 PRO 83 149 149 PRO PRO D . n D 1 84 ASP 84 150 150 ASP ASP D . n D 1 85 ALA 85 151 151 ALA ALA D . n D 1 86 THR 86 152 152 THR THR D . n D 1 87 VAL 87 153 153 VAL VAL D . n D 1 88 ALA 88 154 154 ALA ALA D . n D 1 89 ASP 89 155 155 ASP ASP D . n D 1 90 MET 90 156 156 MET MET D . n D 1 91 LEU 91 157 157 LEU LEU D . n D 1 92 GLN 92 158 158 GLN GLN D . n D 1 93 ASP 93 159 159 ASP ASP D . n D 1 94 VAL 94 160 160 VAL VAL D . n D 1 95 TYR 95 161 161 TYR TYR D . n D 1 96 HIS 96 162 162 HIS HIS D . n D 1 97 VAL 97 163 163 VAL VAL D . n D 1 98 VAL 98 164 164 VAL VAL D . n D 1 99 THR 99 165 165 THR THR D . n D 1 100 LEU 100 166 166 LEU LEU D . n D 1 101 LYS 101 167 167 LYS LYS D . n D 1 102 ILE 102 168 168 ILE ILE D . n D 1 103 GLN 103 169 169 GLN GLN D . n D 1 104 LEU 104 170 170 LEU LEU D . n D 1 105 HIS 105 171 171 HIS HIS D . n D 1 106 SER 106 172 ? ? ? D . n D 1 107 CYS 107 173 173 CYS CYS D . n D 1 108 PRO 108 174 174 PRO PRO D . n D 1 109 LYS 109 175 175 LYS LYS D . n D 1 110 LEU 110 176 176 LEU LEU D . n D 1 111 GLU 111 177 177 GLU GLU D . n D 1 112 ASP 112 178 178 ASP ASP D . n D 1 113 LEU 113 179 179 LEU LEU D . n D 1 114 PRO 114 180 180 PRO PRO D . n D 1 115 PRO 115 181 181 PRO PRO D . n D 1 116 GLU 116 182 182 GLU GLU D . n D 1 117 GLN 117 183 183 GLN GLN D . n D 1 118 TRP 118 184 184 TRP TRP D . n D 1 119 SER 119 185 185 SER SER D . n D 1 120 HIS 120 186 186 HIS HIS D . n D 1 121 THR 121 187 187 THR THR D . n D 1 122 THR 122 188 188 THR THR D . n D 1 123 VAL 123 189 189 VAL VAL D . n D 1 124 ARG 124 190 190 ARG ARG D . n D 1 125 ASN 125 191 191 ASN ASN D . n D 1 126 ALA 126 192 192 ALA ALA D . n D 1 127 LEU 127 193 193 LEU LEU D . n D 1 128 LYS 128 194 194 LYS LYS D . n D 1 129 ASP 129 195 195 ASP ASP D . n D 1 130 LEU 130 196 196 LEU LEU D . n D 1 131 LEU 131 197 197 LEU LEU D . n D 1 132 LYS 132 198 198 LYS LYS D . n D 1 133 ASP 133 199 199 ASP ASP D . n D 1 134 MET 134 200 200 MET MET D . n D 1 135 ASN 135 201 201 ASN ASN D . n D 1 136 GLN 136 202 202 GLN GLN D . n D 1 137 SER 137 203 203 SER SER D . n D 1 138 SER 138 204 204 SER SER D . n D 1 139 LEU 139 205 205 LEU LEU D . n D 1 140 ALA 140 206 206 ALA ALA D . n D 1 141 LYS 141 207 207 LYS LYS D . n D 1 142 GLU 142 208 208 GLU GLU D . n D 1 143 CYS 143 209 209 CYS CYS D . n D 1 144 PRO 144 210 210 PRO PRO D . n D 1 145 LEU 145 211 211 LEU LEU D . n D 1 146 SER 146 212 212 SER SER D . n D 1 147 GLN 147 213 213 GLN GLN D . n D 1 148 SER 148 214 214 SER SER D . n D 1 149 MET 149 215 215 MET MET D . n D 1 150 ILE 150 216 216 ILE ILE D . n D 1 151 SER 151 217 217 SER SER D . n D 1 152 SER 152 218 218 SER SER D . n D 1 153 ILE 153 219 219 ILE ILE D . n D 1 154 VAL 154 220 220 VAL VAL D . n D 1 155 ASN 155 221 221 ASN ASN D . n D 1 156 SER 156 222 222 SER SER D . n D 1 157 THR 157 223 223 THR THR D . n D 1 158 TYR 158 224 224 TYR TYR D . n D 1 159 TYR 159 225 225 TYR TYR D . n D 1 160 ALA 160 226 226 ALA ALA D . n D 1 161 ASN 161 227 227 ASN ASN D . n D 1 162 VAL 162 228 228 VAL VAL D . n D 1 163 SER 163 229 229 SER SER D . n D 1 164 ALA 164 230 230 ALA ALA D . n D 1 165 ALA 165 231 231 ALA ALA D . n D 1 166 LYS 166 232 232 LYS LYS D . n D 1 167 CYS 167 233 233 CYS CYS D . n D 1 168 GLN 168 234 234 GLN GLN D . n D 1 169 GLU 169 235 235 GLU GLU D . n D 1 170 PHE 170 236 236 PHE PHE D . n D 1 171 GLY 171 237 237 GLY GLY D . n D 1 172 ARG 172 238 238 ARG ARG D . n D 1 173 TRP 173 239 239 TRP TRP D . n D 1 174 TYR 174 240 240 TYR TYR D . n D 1 175 LYS 175 241 241 LYS LYS D . n D 1 176 HIS 176 242 242 HIS HIS D . n D 1 177 PHE 177 243 243 PHE PHE D . n D 1 178 LYS 178 244 244 LYS LYS D . n D 1 179 LYS 179 245 245 LYS LYS D . n D 1 180 THR 180 246 246 THR THR D . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4780 ? 1 MORE -26 ? 1 'SSA (A^2)' 26160 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-03-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MAR345dtb 'data collection' . ? 1 PHASER phasing 2.4 ? 2 PHENIX refinement '(phenix.refine: 1.6.4_486)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A GLY 67 ? ? N A PRO 68 ? ? CA A PRO 68 ? ? 129.13 119.30 9.83 1.50 Y 2 1 N B PRO 68 ? ? CA B PRO 68 ? ? CB B PRO 68 ? ? 110.75 103.30 7.45 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 70 ? ? 175.71 -155.48 2 1 GLU A 93 ? ? -104.34 75.00 3 1 GLU A 97 ? ? -178.06 137.89 4 1 SER A 172 ? ? -132.80 -139.00 5 1 LEU A 176 ? ? -31.91 -30.87 6 1 LEU A 197 ? ? -57.05 -6.95 7 1 ASP A 199 ? ? -159.24 19.09 8 1 ASN A 227 ? ? -73.56 38.37 9 1 HIS A 242 ? ? -54.15 -80.81 10 1 SER B 117 ? ? -48.77 -18.85 11 1 LEU B 142 ? ? -51.44 1.32 12 1 HIS C 95 ? ? 99.88 76.79 13 1 MET C 105 ? ? -52.39 170.45 14 1 TYR C 120 ? ? -46.13 152.76 15 1 ALA C 148 ? ? -46.16 100.55 16 1 LEU C 157 ? ? -141.05 -9.15 17 1 SER D 70 ? ? -40.54 160.87 18 1 HIS D 82 ? ? -162.81 119.30 19 1 ALA D 96 ? ? -173.01 108.65 20 1 SER D 121 ? ? -33.38 141.15 21 1 ALA D 125 ? ? -84.44 45.78 22 1 ALA D 126 ? ? -137.72 -54.01 23 1 GLN D 127 ? ? -74.82 36.91 24 1 LEU D 142 ? ? -53.76 -4.88 25 1 PRO D 210 ? ? -68.51 3.53 26 1 SER D 222 ? ? 90.41 9.91 27 1 TYR D 224 ? ? -168.72 44.24 28 1 ALA D 226 ? ? 87.86 73.86 29 1 LYS D 245 ? ? -112.61 51.23 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 172 ? OG ? A SER 106 OG 2 1 Y 1 A TYR 224 ? CG ? A TYR 158 CG 3 1 Y 1 A TYR 224 ? CD1 ? A TYR 158 CD1 4 1 Y 1 A TYR 224 ? CD2 ? A TYR 158 CD2 5 1 Y 1 A TYR 224 ? CE1 ? A TYR 158 CE1 6 1 Y 1 A TYR 224 ? CE2 ? A TYR 158 CE2 7 1 Y 1 A TYR 224 ? CZ ? A TYR 158 CZ 8 1 Y 1 A TYR 224 ? OH ? A TYR 158 OH 9 1 Y 1 B PRO 68 ? CG ? B PRO 2 CG 10 1 Y 1 B PRO 68 ? CD ? B PRO 2 CD 11 1 Y 1 B HIS 171 ? CG ? B HIS 105 CG 12 1 Y 1 B HIS 171 ? ND1 ? B HIS 105 ND1 13 1 Y 1 B HIS 171 ? CD2 ? B HIS 105 CD2 14 1 Y 1 B HIS 171 ? CE1 ? B HIS 105 CE1 15 1 Y 1 B HIS 171 ? NE2 ? B HIS 105 NE2 16 1 Y 1 C GLU 94 ? CG ? C GLU 28 CG 17 1 Y 1 C GLU 94 ? CD ? C GLU 28 CD 18 1 Y 1 C GLU 94 ? OE1 ? C GLU 28 OE1 19 1 Y 1 C GLU 94 ? OE2 ? C GLU 28 OE2 20 1 Y 1 C HIS 171 ? CG ? C HIS 105 CG 21 1 Y 1 C HIS 171 ? ND1 ? C HIS 105 ND1 22 1 Y 1 C HIS 171 ? CD2 ? C HIS 105 CD2 23 1 Y 1 C HIS 171 ? CE1 ? C HIS 105 CE1 24 1 Y 1 C HIS 171 ? NE2 ? C HIS 105 NE2 25 1 Y 1 D HIS 82 ? CG ? D HIS 16 CG 26 1 Y 1 D HIS 82 ? ND1 ? D HIS 16 ND1 27 1 Y 1 D HIS 82 ? CD2 ? D HIS 16 CD2 28 1 Y 1 D HIS 82 ? CE1 ? D HIS 16 CE1 29 1 Y 1 D HIS 82 ? NE2 ? D HIS 16 NE2 30 1 Y 1 D TYR 83 ? CG ? D TYR 17 CG 31 1 Y 1 D TYR 83 ? CD1 ? D TYR 17 CD1 32 1 Y 1 D TYR 83 ? CD2 ? D TYR 17 CD2 33 1 Y 1 D TYR 83 ? CE1 ? D TYR 17 CE1 34 1 Y 1 D TYR 83 ? CE2 ? D TYR 17 CE2 35 1 Y 1 D TYR 83 ? CZ ? D TYR 17 CZ 36 1 Y 1 D TYR 83 ? OH ? D TYR 17 OH 37 1 Y 1 D GLU 84 ? CG ? D GLU 18 CG 38 1 Y 1 D GLU 84 ? CD ? D GLU 18 CD 39 1 Y 1 D GLU 84 ? OE1 ? D GLU 18 OE1 40 1 Y 1 D GLU 84 ? OE2 ? D GLU 18 OE2 41 1 Y 1 D GLU 94 ? CG ? D GLU 28 CG 42 1 Y 1 D GLU 94 ? CD ? D GLU 28 CD 43 1 Y 1 D GLU 94 ? OE1 ? D GLU 28 OE1 44 1 Y 1 D GLU 94 ? OE2 ? D GLU 28 OE2 45 1 Y 1 D HIS 95 ? CG ? D HIS 29 CG 46 1 Y 1 D HIS 95 ? ND1 ? D HIS 29 ND1 47 1 Y 1 D HIS 95 ? CD2 ? D HIS 29 CD2 48 1 Y 1 D HIS 95 ? CE1 ? D HIS 29 CE1 49 1 Y 1 D HIS 95 ? NE2 ? D HIS 29 NE2 50 1 Y 1 D HIS 171 ? CG ? D HIS 105 CG 51 1 Y 1 D HIS 171 ? ND1 ? D HIS 105 ND1 52 1 Y 1 D HIS 171 ? CD2 ? D HIS 105 CD2 53 1 Y 1 D HIS 171 ? CE1 ? D HIS 105 CE1 54 1 Y 1 D HIS 171 ? NE2 ? D HIS 105 NE2 55 1 Y 1 D THR 223 ? OG1 ? D THR 157 OG1 56 1 Y 1 D THR 223 ? CG2 ? D THR 157 CG2 57 1 Y 1 D TYR 224 ? CG ? D TYR 158 CG 58 1 Y 1 D TYR 224 ? CD1 ? D TYR 158 CD1 59 1 Y 1 D TYR 224 ? CD2 ? D TYR 158 CD2 60 1 Y 1 D TYR 224 ? CE1 ? D TYR 158 CE1 61 1 Y 1 D TYR 224 ? CE2 ? D TYR 158 CE2 62 1 Y 1 D TYR 224 ? CZ ? D TYR 158 CZ 63 1 Y 1 D TYR 224 ? OH ? D TYR 158 OH 64 1 Y 1 D TYR 225 ? CG ? D TYR 159 CG 65 1 Y 1 D TYR 225 ? CD1 ? D TYR 159 CD1 66 1 Y 1 D TYR 225 ? CD2 ? D TYR 159 CD2 67 1 Y 1 D TYR 225 ? CE1 ? D TYR 159 CE1 68 1 Y 1 D TYR 225 ? CE2 ? D TYR 159 CE2 69 1 Y 1 D TYR 225 ? CZ ? D TYR 159 CZ 70 1 Y 1 D TYR 225 ? OH ? D TYR 159 OH 71 1 Y 1 D LYS 241 ? CG ? D LYS 175 CG 72 1 Y 1 D LYS 241 ? CD ? D LYS 175 CD 73 1 Y 1 D LYS 241 ? CE ? D LYS 175 CE 74 1 Y 1 D LYS 241 ? NZ ? D LYS 175 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 83 ? A TYR 17 2 1 Y 1 A GLU 84 ? A GLU 18 3 1 Y 1 A ASN 85 ? A ASN 19 4 1 Y 1 A ALA 86 ? A ALA 20 5 1 Y 1 A ILE 87 ? A ILE 21 6 1 Y 1 A GLU 88 ? A GLU 22 7 1 Y 1 A TYR 89 ? A TYR 23 8 1 Y 1 A ASP 90 ? A ASP 24 9 1 Y 1 A CYS 91 ? A CYS 25 10 1 Y 1 A LYS 245 ? A LYS 179 11 1 Y 1 A THR 246 ? A THR 180 12 1 Y 1 B GLY 67 ? B GLY 1 13 1 Y 1 B TYR 83 ? B TYR 17 14 1 Y 1 B GLU 84 ? B GLU 18 15 1 Y 1 B ASN 85 ? B ASN 19 16 1 Y 1 B ALA 86 ? B ALA 20 17 1 Y 1 B ILE 87 ? B ILE 21 18 1 Y 1 B GLU 88 ? B GLU 22 19 1 Y 1 B TYR 89 ? B TYR 23 20 1 Y 1 B ASP 90 ? B ASP 24 21 1 Y 1 B CYS 91 ? B CYS 25 22 1 Y 1 B LYS 92 ? B LYS 26 23 1 Y 1 B SER 172 ? B SER 106 24 1 Y 1 B CYS 173 ? B CYS 107 25 1 Y 1 B PRO 174 ? B PRO 108 26 1 Y 1 B LYS 175 ? B LYS 109 27 1 Y 1 B LEU 176 ? B LEU 110 28 1 Y 1 B GLU 177 ? B GLU 111 29 1 Y 1 B ASP 178 ? B ASP 112 30 1 Y 1 B LEU 179 ? B LEU 113 31 1 Y 1 B PRO 180 ? B PRO 114 32 1 Y 1 B PRO 181 ? B PRO 115 33 1 Y 1 B GLU 182 ? B GLU 116 34 1 Y 1 B GLN 183 ? B GLN 117 35 1 Y 1 B TRP 184 ? B TRP 118 36 1 Y 1 B SER 185 ? B SER 119 37 1 Y 1 B HIS 186 ? B HIS 120 38 1 Y 1 B THR 187 ? B THR 121 39 1 Y 1 B THR 188 ? B THR 122 40 1 Y 1 B VAL 189 ? B VAL 123 41 1 Y 1 B ARG 190 ? B ARG 124 42 1 Y 1 B ASN 191 ? B ASN 125 43 1 Y 1 B ALA 192 ? B ALA 126 44 1 Y 1 B LEU 193 ? B LEU 127 45 1 Y 1 B LYS 194 ? B LYS 128 46 1 Y 1 B ASP 195 ? B ASP 129 47 1 Y 1 B LEU 196 ? B LEU 130 48 1 Y 1 B LEU 197 ? B LEU 131 49 1 Y 1 B LYS 198 ? B LYS 132 50 1 Y 1 B ASP 199 ? B ASP 133 51 1 Y 1 B MET 200 ? B MET 134 52 1 Y 1 B ASN 201 ? B ASN 135 53 1 Y 1 B GLN 202 ? B GLN 136 54 1 Y 1 B SER 203 ? B SER 137 55 1 Y 1 B SER 204 ? B SER 138 56 1 Y 1 B LEU 205 ? B LEU 139 57 1 Y 1 B ALA 206 ? B ALA 140 58 1 Y 1 B LYS 207 ? B LYS 141 59 1 Y 1 B GLU 208 ? B GLU 142 60 1 Y 1 B CYS 209 ? B CYS 143 61 1 Y 1 B PRO 210 ? B PRO 144 62 1 Y 1 B LEU 211 ? B LEU 145 63 1 Y 1 B SER 212 ? B SER 146 64 1 Y 1 B GLN 213 ? B GLN 147 65 1 Y 1 B SER 214 ? B SER 148 66 1 Y 1 B MET 215 ? B MET 149 67 1 Y 1 B ILE 216 ? B ILE 150 68 1 Y 1 B SER 217 ? B SER 151 69 1 Y 1 B SER 218 ? B SER 152 70 1 Y 1 B ILE 219 ? B ILE 153 71 1 Y 1 B VAL 220 ? B VAL 154 72 1 Y 1 B ASN 221 ? B ASN 155 73 1 Y 1 B SER 222 ? B SER 156 74 1 Y 1 B THR 223 ? B THR 157 75 1 Y 1 B TYR 224 ? B TYR 158 76 1 Y 1 B TYR 225 ? B TYR 159 77 1 Y 1 B ALA 226 ? B ALA 160 78 1 Y 1 B ASN 227 ? B ASN 161 79 1 Y 1 B VAL 228 ? B VAL 162 80 1 Y 1 B SER 229 ? B SER 163 81 1 Y 1 B ALA 230 ? B ALA 164 82 1 Y 1 B ALA 231 ? B ALA 165 83 1 Y 1 B LYS 232 ? B LYS 166 84 1 Y 1 B CYS 233 ? B CYS 167 85 1 Y 1 B GLN 234 ? B GLN 168 86 1 Y 1 B GLU 235 ? B GLU 169 87 1 Y 1 B PHE 236 ? B PHE 170 88 1 Y 1 B GLY 237 ? B GLY 171 89 1 Y 1 B ARG 238 ? B ARG 172 90 1 Y 1 B TRP 239 ? B TRP 173 91 1 Y 1 B TYR 240 ? B TYR 174 92 1 Y 1 B LYS 241 ? B LYS 175 93 1 Y 1 B HIS 242 ? B HIS 176 94 1 Y 1 B PHE 243 ? B PHE 177 95 1 Y 1 B LYS 244 ? B LYS 178 96 1 Y 1 B LYS 245 ? B LYS 179 97 1 Y 1 B THR 246 ? B THR 180 98 1 Y 1 C GLY 67 ? C GLY 1 99 1 Y 1 C PRO 68 ? C PRO 2 100 1 Y 1 C TYR 83 ? C TYR 17 101 1 Y 1 C GLU 84 ? C GLU 18 102 1 Y 1 C ASN 85 ? C ASN 19 103 1 Y 1 C ALA 86 ? C ALA 20 104 1 Y 1 C ILE 87 ? C ILE 21 105 1 Y 1 C GLU 88 ? C GLU 22 106 1 Y 1 C TYR 89 ? C TYR 23 107 1 Y 1 C ASP 90 ? C ASP 24 108 1 Y 1 C CYS 91 ? C CYS 25 109 1 Y 1 C LYS 92 ? C LYS 26 110 1 Y 1 C GLU 93 ? C GLU 27 111 1 Y 1 C SER 172 ? C SER 106 112 1 Y 1 C CYS 173 ? C CYS 107 113 1 Y 1 C PRO 174 ? C PRO 108 114 1 Y 1 C LYS 175 ? C LYS 109 115 1 Y 1 C LEU 176 ? C LEU 110 116 1 Y 1 C GLU 177 ? C GLU 111 117 1 Y 1 C ASP 178 ? C ASP 112 118 1 Y 1 C LEU 179 ? C LEU 113 119 1 Y 1 C PRO 180 ? C PRO 114 120 1 Y 1 C PRO 181 ? C PRO 115 121 1 Y 1 C GLU 182 ? C GLU 116 122 1 Y 1 C GLN 183 ? C GLN 117 123 1 Y 1 C TRP 184 ? C TRP 118 124 1 Y 1 C SER 185 ? C SER 119 125 1 Y 1 C HIS 186 ? C HIS 120 126 1 Y 1 C THR 187 ? C THR 121 127 1 Y 1 C THR 188 ? C THR 122 128 1 Y 1 C VAL 189 ? C VAL 123 129 1 Y 1 C ARG 190 ? C ARG 124 130 1 Y 1 C ASN 191 ? C ASN 125 131 1 Y 1 C ALA 192 ? C ALA 126 132 1 Y 1 C LEU 193 ? C LEU 127 133 1 Y 1 C LYS 194 ? C LYS 128 134 1 Y 1 C ASP 195 ? C ASP 129 135 1 Y 1 C LEU 196 ? C LEU 130 136 1 Y 1 C LEU 197 ? C LEU 131 137 1 Y 1 C LYS 198 ? C LYS 132 138 1 Y 1 C ASP 199 ? C ASP 133 139 1 Y 1 C MET 200 ? C MET 134 140 1 Y 1 C ASN 201 ? C ASN 135 141 1 Y 1 C GLN 202 ? C GLN 136 142 1 Y 1 C SER 203 ? C SER 137 143 1 Y 1 C SER 204 ? C SER 138 144 1 Y 1 C LEU 205 ? C LEU 139 145 1 Y 1 C ALA 206 ? C ALA 140 146 1 Y 1 C LYS 207 ? C LYS 141 147 1 Y 1 C GLU 208 ? C GLU 142 148 1 Y 1 C CYS 209 ? C CYS 143 149 1 Y 1 C PRO 210 ? C PRO 144 150 1 Y 1 C LEU 211 ? C LEU 145 151 1 Y 1 C SER 212 ? C SER 146 152 1 Y 1 C GLN 213 ? C GLN 147 153 1 Y 1 C SER 214 ? C SER 148 154 1 Y 1 C MET 215 ? C MET 149 155 1 Y 1 C ILE 216 ? C ILE 150 156 1 Y 1 C SER 217 ? C SER 151 157 1 Y 1 C SER 218 ? C SER 152 158 1 Y 1 C ILE 219 ? C ILE 153 159 1 Y 1 C VAL 220 ? C VAL 154 160 1 Y 1 C ASN 221 ? C ASN 155 161 1 Y 1 C SER 222 ? C SER 156 162 1 Y 1 C THR 223 ? C THR 157 163 1 Y 1 C TYR 224 ? C TYR 158 164 1 Y 1 C TYR 225 ? C TYR 159 165 1 Y 1 C ALA 226 ? C ALA 160 166 1 Y 1 C ASN 227 ? C ASN 161 167 1 Y 1 C VAL 228 ? C VAL 162 168 1 Y 1 C SER 229 ? C SER 163 169 1 Y 1 C ALA 230 ? C ALA 164 170 1 Y 1 C ALA 231 ? C ALA 165 171 1 Y 1 C LYS 232 ? C LYS 166 172 1 Y 1 C CYS 233 ? C CYS 167 173 1 Y 1 C GLN 234 ? C GLN 168 174 1 Y 1 C GLU 235 ? C GLU 169 175 1 Y 1 C PHE 236 ? C PHE 170 176 1 Y 1 C GLY 237 ? C GLY 171 177 1 Y 1 C ARG 238 ? C ARG 172 178 1 Y 1 C TRP 239 ? C TRP 173 179 1 Y 1 C TYR 240 ? C TYR 174 180 1 Y 1 C LYS 241 ? C LYS 175 181 1 Y 1 C HIS 242 ? C HIS 176 182 1 Y 1 C PHE 243 ? C PHE 177 183 1 Y 1 C LYS 244 ? C LYS 178 184 1 Y 1 C LYS 245 ? C LYS 179 185 1 Y 1 C THR 246 ? C THR 180 186 1 Y 1 D GLY 67 ? D GLY 1 187 1 Y 1 D ASN 85 ? D ASN 19 188 1 Y 1 D ALA 86 ? D ALA 20 189 1 Y 1 D ILE 87 ? D ILE 21 190 1 Y 1 D GLU 88 ? D GLU 22 191 1 Y 1 D TYR 89 ? D TYR 23 192 1 Y 1 D ASP 90 ? D ASP 24 193 1 Y 1 D CYS 91 ? D CYS 25 194 1 Y 1 D LYS 92 ? D LYS 26 195 1 Y 1 D GLU 93 ? D GLU 27 196 1 Y 1 D SER 172 ? D SER 106 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 301 3 HOH HOH A . E 2 HOH 2 302 4 HOH HOH A . E 2 HOH 3 303 6 HOH HOH A . E 2 HOH 4 304 14 HOH HOH A . F 2 HOH 1 301 2 HOH HOH B . F 2 HOH 2 302 5 HOH HOH B . F 2 HOH 3 303 7 HOH HOH B . F 2 HOH 4 304 8 HOH HOH B . G 2 HOH 1 301 1 HOH HOH C . H 2 HOH 1 301 10 HOH HOH D . H 2 HOH 2 302 11 HOH HOH D . H 2 HOH 3 303 12 HOH HOH D . H 2 HOH 4 304 13 HOH HOH D . #