data_4QKJ # _entry.id 4QKJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4QKJ pdb_00004qkj 10.2210/pdb4qkj/pdb RCSB RCSB086170 ? ? WWPDB D_1000086170 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-03-11 2 'Structure model' 1 1 2016-01-27 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2018-06-20 5 'Structure model' 1 4 2020-07-29 6 'Structure model' 1 5 2021-06-02 7 'Structure model' 1 6 2023-11-08 8 'Structure model' 1 7 2024-11-20 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Structure summary' 9 6 'Structure model' 'Source and taxonomy' 10 6 'Structure model' 'Structure summary' 11 7 'Structure model' 'Data collection' 12 7 'Structure model' 'Database references' 13 7 'Structure model' 'Refinement description' 14 8 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' citation_author 3 5 'Structure model' chem_comp 4 5 'Structure model' entity 5 5 'Structure model' pdbx_chem_comp_identifier 6 5 'Structure model' pdbx_entity_nonpoly 7 5 'Structure model' struct_conn 8 5 'Structure model' struct_ref_seq_dif 9 5 'Structure model' struct_site 10 5 'Structure model' struct_site_gen 11 6 'Structure model' chem_comp 12 6 'Structure model' entity_src_gen 13 7 'Structure model' chem_comp_atom 14 7 'Structure model' chem_comp_bond 15 7 'Structure model' database_2 16 7 'Structure model' pdbx_initial_refinement_model 17 8 'Structure model' pdbx_entry_details 18 8 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation_author.name' 2 5 'Structure model' '_chem_comp.name' 3 5 'Structure model' '_chem_comp.type' 4 5 'Structure model' '_entity.pdbx_description' 5 5 'Structure model' '_pdbx_entity_nonpoly.name' 6 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 5 'Structure model' '_struct_conn.pdbx_role' 8 5 'Structure model' '_struct_ref_seq_dif.details' 9 6 'Structure model' '_chem_comp.pdbx_synonyms' 10 6 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 11 6 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 12 7 'Structure model' '_database_2.pdbx_DOI' 13 7 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4QKJ _pdbx_database_status.recvd_initial_deposition_date 2014-06-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4QKG . unspecified PDB 4QKH . unspecified PDB 4QKI . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Skalova, T.' 1 ? 'Blaha, J.' 2 ? 'Duskova, J.' 3 ? 'Koval, T.' 4 ? 'Stransky, J.' 5 ? 'Hasek, J.' 6 ? 'Vanek, O.' 7 ? 'Dohnalek, J.' 8 ? # _citation.id primary _citation.title 'Four crystal structures of human LLT1, a ligand of human NKR-P1, in varied glycosylation and oligomerization states' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 71 _citation.page_first 578 _citation.page_last 591 _citation.year 2015 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25760607 _citation.pdbx_database_id_DOI 10.1107/S1399004714027928 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Skalova, T.' 1 ? primary 'Blaha, J.' 2 ? primary 'Harlos, K.' 3 ? primary 'Duskova, J.' 4 ? primary 'Koval, T.' 5 ? primary 'Stransky, J.' 6 ? primary 'Hasek, J.' 7 ? primary 'Vanek, O.' 8 ? primary 'Dohnalek, J.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C-type lectin domain family 2 member D' 15692.363 1 ? H176C 'extracellular part, UNP residues 72-191' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lectin-like NK cell receptor, Lectin-like transcript 1, LLT-1, Osteoclast inhibitory lectin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ITGQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWING TEWTRQFPILGAGECAYLNDKGASSARCYTERKWICSKSDIHVGTKHHHHHHHHG ; _entity_poly.pdbx_seq_one_letter_code_can ;ITGQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWING TEWTRQFPILGAGECAYLNDKGASSARCYTERKWICSKSDIHVGTKHHHHHHHHG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 THR n 1 3 GLY n 1 4 GLN n 1 5 ALA n 1 6 ALA n 1 7 CYS n 1 8 PRO n 1 9 GLU n 1 10 SER n 1 11 TRP n 1 12 ILE n 1 13 GLY n 1 14 PHE n 1 15 GLN n 1 16 ARG n 1 17 LYS n 1 18 CYS n 1 19 PHE n 1 20 TYR n 1 21 PHE n 1 22 SER n 1 23 ASP n 1 24 ASP n 1 25 THR n 1 26 LYS n 1 27 ASN n 1 28 TRP n 1 29 THR n 1 30 SER n 1 31 SER n 1 32 GLN n 1 33 ARG n 1 34 PHE n 1 35 CYS n 1 36 ASP n 1 37 SER n 1 38 GLN n 1 39 ASP n 1 40 ALA n 1 41 ASP n 1 42 LEU n 1 43 ALA n 1 44 GLN n 1 45 VAL n 1 46 GLU n 1 47 SER n 1 48 PHE n 1 49 GLN n 1 50 GLU n 1 51 LEU n 1 52 ASN n 1 53 PHE n 1 54 LEU n 1 55 LEU n 1 56 ARG n 1 57 TYR n 1 58 LYS n 1 59 GLY n 1 60 PRO n 1 61 SER n 1 62 ASP n 1 63 HIS n 1 64 TRP n 1 65 ILE n 1 66 GLY n 1 67 LEU n 1 68 SER n 1 69 ARG n 1 70 GLU n 1 71 GLN n 1 72 GLY n 1 73 GLN n 1 74 PRO n 1 75 TRP n 1 76 LYS n 1 77 TRP n 1 78 ILE n 1 79 ASN n 1 80 GLY n 1 81 THR n 1 82 GLU n 1 83 TRP n 1 84 THR n 1 85 ARG n 1 86 GLN n 1 87 PHE n 1 88 PRO n 1 89 ILE n 1 90 LEU n 1 91 GLY n 1 92 ALA n 1 93 GLY n 1 94 GLU n 1 95 CYS n 1 96 ALA n 1 97 TYR n 1 98 LEU n 1 99 ASN n 1 100 ASP n 1 101 LYS n 1 102 GLY n 1 103 ALA n 1 104 SER n 1 105 SER n 1 106 ALA n 1 107 ARG n 1 108 CYS n 1 109 TYR n 1 110 THR n 1 111 GLU n 1 112 ARG n 1 113 LYS n 1 114 TRP n 1 115 ILE n 1 116 CYS n 1 117 SER n 1 118 LYS n 1 119 SER n 1 120 ASP n 1 121 ILE n 1 122 HIS n 1 123 VAL n 1 124 GLY n 1 125 THR n 1 126 LYS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CLAX, CLEC2B, CLEC2D, LLT1, OCIL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'protein secreted into medium' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name human _entity_src_gen.pdbx_host_org_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'HEK293S GnTI-' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTT28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 69 ? ? ? A . n A 1 2 THR 2 70 ? ? ? A . n A 1 3 GLY 3 71 ? ? ? A . n A 1 4 GLN 4 72 ? ? ? A . n A 1 5 ALA 5 73 ? ? ? A . n A 1 6 ALA 6 74 74 ALA ALA A . n A 1 7 CYS 7 75 75 CYS CYS A . n A 1 8 PRO 8 76 76 PRO PRO A . n A 1 9 GLU 9 77 77 GLU GLU A . n A 1 10 SER 10 78 78 SER SER A . n A 1 11 TRP 11 79 79 TRP TRP A . n A 1 12 ILE 12 80 80 ILE ILE A . n A 1 13 GLY 13 81 81 GLY GLY A . n A 1 14 PHE 14 82 82 PHE PHE A . n A 1 15 GLN 15 83 83 GLN GLN A . n A 1 16 ARG 16 84 84 ARG ARG A . n A 1 17 LYS 17 85 85 LYS LYS A . n A 1 18 CYS 18 86 86 CYS CYS A . n A 1 19 PHE 19 87 87 PHE PHE A . n A 1 20 TYR 20 88 88 TYR TYR A . n A 1 21 PHE 21 89 89 PHE PHE A . n A 1 22 SER 22 90 90 SER SER A . n A 1 23 ASP 23 91 91 ASP ASP A . n A 1 24 ASP 24 92 92 ASP ASP A . n A 1 25 THR 25 93 93 THR THR A . n A 1 26 LYS 26 94 94 LYS LYS A . n A 1 27 ASN 27 95 95 ASN ASN A . n A 1 28 TRP 28 96 96 TRP TRP A . n A 1 29 THR 29 97 97 THR THR A . n A 1 30 SER 30 98 98 SER SER A . n A 1 31 SER 31 99 99 SER SER A . n A 1 32 GLN 32 100 100 GLN GLN A . n A 1 33 ARG 33 101 101 ARG ARG A . n A 1 34 PHE 34 102 102 PHE PHE A . n A 1 35 CYS 35 103 103 CYS CYS A . n A 1 36 ASP 36 104 104 ASP ASP A . n A 1 37 SER 37 105 105 SER SER A . n A 1 38 GLN 38 106 106 GLN GLN A . n A 1 39 ASP 39 107 107 ASP ASP A . n A 1 40 ALA 40 108 108 ALA ALA A . n A 1 41 ASP 41 109 109 ASP ASP A . n A 1 42 LEU 42 110 110 LEU LEU A . n A 1 43 ALA 43 111 111 ALA ALA A . n A 1 44 GLN 44 112 112 GLN GLN A . n A 1 45 VAL 45 113 113 VAL VAL A . n A 1 46 GLU 46 114 114 GLU GLU A . n A 1 47 SER 47 115 115 SER SER A . n A 1 48 PHE 48 116 116 PHE PHE A . n A 1 49 GLN 49 117 117 GLN GLN A . n A 1 50 GLU 50 118 118 GLU GLU A . n A 1 51 LEU 51 119 119 LEU LEU A . n A 1 52 ASN 52 120 120 ASN ASN A . n A 1 53 PHE 53 121 121 PHE PHE A . n A 1 54 LEU 54 122 122 LEU LEU A . n A 1 55 LEU 55 123 123 LEU LEU A . n A 1 56 ARG 56 124 124 ARG ARG A . n A 1 57 TYR 57 125 125 TYR TYR A . n A 1 58 LYS 58 126 126 LYS LYS A . n A 1 59 GLY 59 127 127 GLY GLY A . n A 1 60 PRO 60 128 128 PRO PRO A . n A 1 61 SER 61 129 129 SER SER A . n A 1 62 ASP 62 130 130 ASP ASP A . n A 1 63 HIS 63 131 131 HIS HIS A . n A 1 64 TRP 64 132 132 TRP TRP A . n A 1 65 ILE 65 133 133 ILE ILE A . n A 1 66 GLY 66 134 134 GLY GLY A . n A 1 67 LEU 67 135 135 LEU LEU A . n A 1 68 SER 68 136 136 SER SER A . n A 1 69 ARG 69 137 137 ARG ARG A . n A 1 70 GLU 70 138 138 GLU GLU A . n A 1 71 GLN 71 139 139 GLN GLN A . n A 1 72 GLY 72 140 140 GLY GLY A . n A 1 73 GLN 73 141 141 GLN GLN A . n A 1 74 PRO 74 142 142 PRO PRO A . n A 1 75 TRP 75 143 143 TRP TRP A . n A 1 76 LYS 76 144 144 LYS LYS A . n A 1 77 TRP 77 145 145 TRP TRP A . n A 1 78 ILE 78 146 146 ILE ILE A . n A 1 79 ASN 79 147 147 ASN ASN A . n A 1 80 GLY 80 148 148 GLY GLY A . n A 1 81 THR 81 149 149 THR THR A . n A 1 82 GLU 82 150 150 GLU GLU A . n A 1 83 TRP 83 151 151 TRP TRP A . n A 1 84 THR 84 152 152 THR THR A . n A 1 85 ARG 85 153 153 ARG ARG A . n A 1 86 GLN 86 154 154 GLN GLN A . n A 1 87 PHE 87 155 155 PHE PHE A . n A 1 88 PRO 88 156 156 PRO PRO A . n A 1 89 ILE 89 157 157 ILE ILE A . n A 1 90 LEU 90 158 158 LEU LEU A . n A 1 91 GLY 91 159 159 GLY GLY A . n A 1 92 ALA 92 160 160 ALA ALA A . n A 1 93 GLY 93 161 161 GLY GLY A . n A 1 94 GLU 94 162 162 GLU GLU A . n A 1 95 CYS 95 163 163 CYS CYS A . n A 1 96 ALA 96 164 164 ALA ALA A . n A 1 97 TYR 97 165 165 TYR TYR A . n A 1 98 LEU 98 166 166 LEU LEU A . n A 1 99 ASN 99 167 167 ASN ASN A . n A 1 100 ASP 100 168 168 ASP ASP A . n A 1 101 LYS 101 169 169 LYS LYS A . n A 1 102 GLY 102 170 170 GLY GLY A . n A 1 103 ALA 103 171 171 ALA ALA A . n A 1 104 SER 104 172 172 SER SER A . n A 1 105 SER 105 173 173 SER SER A . n A 1 106 ALA 106 174 174 ALA ALA A . n A 1 107 ARG 107 175 175 ARG ARG A . n A 1 108 CYS 108 176 176 CYS CYS A . n A 1 109 TYR 109 177 177 TYR TYR A . n A 1 110 THR 110 178 178 THR THR A . n A 1 111 GLU 111 179 179 GLU GLU A . n A 1 112 ARG 112 180 180 ARG ARG A . n A 1 113 LYS 113 181 181 LYS LYS A . n A 1 114 TRP 114 182 182 TRP TRP A . n A 1 115 ILE 115 183 183 ILE ILE A . n A 1 116 CYS 116 184 184 CYS CYS A . n A 1 117 SER 117 185 185 SER SER A . n A 1 118 LYS 118 186 186 LYS LYS A . n A 1 119 SER 119 187 187 SER SER A . n A 1 120 ASP 120 188 188 ASP ASP A . n A 1 121 ILE 121 189 ? ? ? A . n A 1 122 HIS 122 190 ? ? ? A . n A 1 123 VAL 123 191 ? ? ? A . n A 1 124 GLY 124 192 ? ? ? A . n A 1 125 THR 125 193 ? ? ? A . n A 1 126 LYS 126 194 ? ? ? A . n A 1 127 HIS 127 195 ? ? ? A . n A 1 128 HIS 128 196 ? ? ? A . n A 1 129 HIS 129 197 ? ? ? A . n A 1 130 HIS 130 198 ? ? ? A . n A 1 131 HIS 131 199 ? ? ? A . n A 1 132 HIS 132 200 ? ? ? A . n A 1 133 HIS 133 201 ? ? ? A . n A 1 134 HIS 134 202 ? ? ? A . n A 1 135 GLY 135 203 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 301 511 NAG NAG A . C 3 HOH 1 401 1 HOH HOH A . C 3 HOH 2 402 2 HOH HOH A . C 3 HOH 3 403 3 HOH HOH A . C 3 HOH 4 404 4 HOH HOH A . C 3 HOH 5 405 5 HOH HOH A . C 3 HOH 6 406 6 HOH HOH A . C 3 HOH 7 407 7 HOH HOH A . C 3 HOH 8 408 8 HOH HOH A . C 3 HOH 9 409 9 HOH HOH A . C 3 HOH 10 410 10 HOH HOH A . C 3 HOH 11 411 11 HOH HOH A . C 3 HOH 12 412 12 HOH HOH A . C 3 HOH 13 413 13 HOH HOH A . C 3 HOH 14 414 14 HOH HOH A . C 3 HOH 15 415 15 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MxCuBE 'data collection' . ? 1 BALBES phasing . ? 2 REFMAC refinement 5.8.0049 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 Sawaya 'data scaling' 'et al.' ? 6 # _cell.entry_id 4QKJ _cell.length_a 70.060 _cell.length_b 70.060 _cell.length_c 101.710 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4QKJ _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? # _exptl.entry_id 4QKJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_percent_sol 46.43 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 288 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pdbx_details '40%(v/v) PEG300 and 0.1M citrate phosphate buffer, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 288K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2011-11-24 _diffrn_detector.details 'Si Mirror, double crystal Si monochromator, Rh mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111) double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.pdbx_synchrotron_site BESSY _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9184 # _reflns.entry_id 4QKJ _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 39.0 _reflns.d_resolution_high 2.7 _reflns.number_obs 4431 _reflns.number_all 4431 _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.093 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.2 _reflns.B_iso_Wilson_estimate 66.1 _reflns.pdbx_redundancy 4.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.76 _reflns_shell.percent_possible_all 99.3 _reflns_shell.Rmerge_I_obs 0.757 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 4.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 273 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4QKJ _refine.ls_number_reflns_obs 4186 _refine.ls_number_reflns_all 4186 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.0 _refine.ls_d_res_high 2.75 _refine.ls_percent_reflns_obs 99.52 _refine.ls_R_factor_obs 0.23022 _refine.ls_R_factor_all 0.23022 _refine.ls_R_factor_R_work 0.22133 _refine.ls_R_factor_R_free 0.2978 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 223 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.894 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 40.052 _refine.aniso_B[1][1] -0.16 _refine.aniso_B[2][2] -0.16 _refine.aniso_B[3][3] 0.53 _refine.aniso_B[1][2] -0.08 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method 'throughout (except for the last cycle)' _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 3HUP _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'CCP4 STEREOCHEMISTRY LIBRARY, VERSION 6.4.0' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 1.171 _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.220 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 11.069 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 945 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 974 _refine_hist.d_res_high 2.75 _refine_hist.d_res_low 39.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.018 0.020 ? 993 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.006 0.020 ? 860 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.967 1.919 ? 1344 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.971 3.000 ? 1977 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 9.828 5.000 ? 114 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 40.451 23.774 ? 53 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 21.562 15.000 ? 158 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 14.554 15.000 ? 7 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.108 0.200 ? 129 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.008 0.020 ? 1134 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 259 ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it 3.959 3.878 ? 459 ? 'X-RAY DIFFRACTION' r_mcbond_other 3.957 3.868 ? 458 ? 'X-RAY DIFFRACTION' r_mcangle_it 6.515 5.788 ? 572 ? 'X-RAY DIFFRACTION' r_mcangle_other 6.510 5.799 ? 573 ? 'X-RAY DIFFRACTION' r_scbond_it 3.780 4.165 ? 534 ? 'X-RAY DIFFRACTION' r_scbond_other 3.777 4.165 ? 534 ? 'X-RAY DIFFRACTION' r_scangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_other 6.070 6.131 ? 773 ? 'X-RAY DIFFRACTION' r_long_range_B_refined 10.195 31.200 ? 1222 ? 'X-RAY DIFFRACTION' r_long_range_B_other 10.192 31.241 ? 1223 ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.75 _refine_ls_shell.d_res_low 2.822 _refine_ls_shell.number_reflns_R_work 293 _refine_ls_shell.R_factor_R_work 0.293 _refine_ls_shell.percent_reflns_obs 99.66 _refine_ls_shell.R_factor_R_free 0.314 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 12 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 281 _refine_ls_shell.redundancy_reflns_obs ? # _database_PDB_matrix.entry_id 4QKJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 4QKJ _struct.title 'Glycosylated form of human LLT1, a ligand for NKR-P1, in this structure forming hexamers' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4QKJ _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text ;C-type lectin like fold, ligand for human receptor NKR-P1, GlcNAc2Man5 glycosylation, anchored in membrane on cell surface, IMMUNE SYSTEM ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CLC2D_HUMAN _struct_ref.pdbx_db_accession Q9UHP7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEW TRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV ; _struct_ref.pdbx_align_begin 72 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4QKJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UHP7 _struct_ref_seq.db_align_beg 72 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 72 _struct_ref_seq.pdbx_auth_seq_align_end 191 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4QKJ ILE A 1 ? UNP Q9UHP7 ? ? 'expression tag' 69 1 1 4QKJ THR A 2 ? UNP Q9UHP7 ? ? 'expression tag' 70 2 1 4QKJ GLY A 3 ? UNP Q9UHP7 ? ? 'expression tag' 71 3 1 4QKJ CYS A 108 ? UNP Q9UHP7 HIS 176 'engineered mutation' 176 4 1 4QKJ GLY A 124 ? UNP Q9UHP7 ? ? 'expression tag' 192 5 1 4QKJ THR A 125 ? UNP Q9UHP7 ? ? 'expression tag' 193 6 1 4QKJ LYS A 126 ? UNP Q9UHP7 ? ? 'expression tag' 194 7 1 4QKJ HIS A 127 ? UNP Q9UHP7 ? ? 'expression tag' 195 8 1 4QKJ HIS A 128 ? UNP Q9UHP7 ? ? 'expression tag' 196 9 1 4QKJ HIS A 129 ? UNP Q9UHP7 ? ? 'expression tag' 197 10 1 4QKJ HIS A 130 ? UNP Q9UHP7 ? ? 'expression tag' 198 11 1 4QKJ HIS A 131 ? UNP Q9UHP7 ? ? 'expression tag' 199 12 1 4QKJ HIS A 132 ? UNP Q9UHP7 ? ? 'expression tag' 200 13 1 4QKJ HIS A 133 ? UNP Q9UHP7 ? ? 'expression tag' 201 14 1 4QKJ HIS A 134 ? UNP Q9UHP7 ? ? 'expression tag' 202 15 1 4QKJ GLY A 135 ? UNP Q9UHP7 ? ? 'expression tag' 203 16 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C 2 1 A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 x,x-y,-z+1/2 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 50.8550000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 27 ? GLN A 38 ? ASN A 95 GLN A 106 1 ? 12 HELX_P HELX_P2 2 SER A 47 ? GLY A 59 ? SER A 115 GLY A 127 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 75 A CYS 86 1_555 ? ? ? ? ? ? ? 2.002 ? ? disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 103 A CYS 184 1_555 ? ? ? ? ? ? ? 2.015 ? ? disulf3 disulf ? ? A CYS 95 SG ? ? ? 1_555 A CYS 108 SG ? ? A CYS 163 A CYS 176 1_555 ? ? ? ? ? ? ? 2.016 ? ? covale1 covale one ? A ASN 27 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 95 A NAG 301 1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG B . ? ASN A 27 ? NAG A 301 ? 1_555 ASN A 95 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 CYS A 7 ? CYS A 18 ? CYS A 75 ? 1_555 CYS A 86 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 35 ? CYS A 116 ? CYS A 103 ? 1_555 CYS A 184 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 95 ? CYS A 108 ? CYS A 163 ? 1_555 CYS A 176 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 12 ? GLY A 13 ? ILE A 80 GLY A 81 A 2 CYS A 18 ? PHE A 21 ? CYS A 86 PHE A 89 A 3 LYS A 113 ? LYS A 118 ? LYS A 181 LYS A 186 A 4 HIS A 63 ? SER A 68 ? HIS A 131 SER A 136 A 5 LYS A 76 ? TRP A 77 ? LYS A 144 TRP A 145 B 1 ASP A 41 ? LEU A 42 ? ASP A 109 LEU A 110 B 2 LYS A 113 ? LYS A 118 ? LYS A 181 LYS A 186 B 3 HIS A 63 ? SER A 68 ? HIS A 131 SER A 136 B 4 CYS A 95 ? LEU A 98 ? CYS A 163 LEU A 166 B 5 ALA A 103 ? ALA A 106 ? ALA A 171 ALA A 174 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 12 ? N ILE A 80 O PHE A 19 ? O PHE A 87 A 2 3 N TYR A 20 ? N TYR A 88 O CYS A 116 ? O CYS A 184 A 3 4 O LYS A 113 ? O LYS A 181 N TRP A 64 ? N TRP A 132 A 4 5 N SER A 68 ? N SER A 136 O LYS A 76 ? O LYS A 144 B 1 2 N ASP A 41 ? N ASP A 109 O SER A 117 ? O SER A 185 B 2 3 O LYS A 113 ? O LYS A 181 N TRP A 64 ? N TRP A 132 B 3 4 N HIS A 63 ? N HIS A 131 O LEU A 98 ? O LEU A 166 B 4 5 N TYR A 97 ? N TYR A 165 O SER A 104 ? O SER A 172 # _pdbx_entry_details.entry_id 4QKJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 114 ? ? OE1 A GLN 154 ? ? 2.08 2 1 O A LEU 110 ? ? NE2 A GLN 112 ? ? 2.19 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 130 ? ? CG A ASP 130 ? ? OD1 A ASP 130 ? ? 126.88 118.30 8.58 0.90 N 2 1 CB A ASP 130 ? ? CG A ASP 130 ? ? OD2 A ASP 130 ? ? 112.68 118.30 -5.62 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 78 ? ? 72.21 -12.40 2 1 SER A 105 ? ? -36.38 -24.87 3 1 ALA A 111 ? ? -33.60 133.97 4 1 ARG A 153 ? ? -69.86 53.06 5 1 ASN A 167 ? ? -90.02 -149.72 6 1 LYS A 186 ? ? -160.53 -158.34 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 140 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLN _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 141 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -149.50 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ASN _pdbx_struct_mod_residue.label_seq_id 27 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ASN _pdbx_struct_mod_residue.auth_seq_id 95 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASN _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 69 ? A ILE 1 2 1 Y 1 A THR 70 ? A THR 2 3 1 Y 1 A GLY 71 ? A GLY 3 4 1 Y 1 A GLN 72 ? A GLN 4 5 1 Y 1 A ALA 73 ? A ALA 5 6 1 Y 1 A ILE 189 ? A ILE 121 7 1 Y 1 A HIS 190 ? A HIS 122 8 1 Y 1 A VAL 191 ? A VAL 123 9 1 Y 1 A GLY 192 ? A GLY 124 10 1 Y 1 A THR 193 ? A THR 125 11 1 Y 1 A LYS 194 ? A LYS 126 12 1 Y 1 A HIS 195 ? A HIS 127 13 1 Y 1 A HIS 196 ? A HIS 128 14 1 Y 1 A HIS 197 ? A HIS 129 15 1 Y 1 A HIS 198 ? A HIS 130 16 1 Y 1 A HIS 199 ? A HIS 131 17 1 Y 1 A HIS 200 ? A HIS 132 18 1 Y 1 A HIS 201 ? A HIS 133 19 1 Y 1 A HIS 202 ? A HIS 134 20 1 Y 1 A GLY 203 ? A GLY 135 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 NAG C1 C N R 230 NAG C2 C N R 231 NAG C3 C N R 232 NAG C4 C N S 233 NAG C5 C N R 234 NAG C6 C N N 235 NAG C7 C N N 236 NAG C8 C N N 237 NAG N2 N N N 238 NAG O1 O N N 239 NAG O3 O N N 240 NAG O4 O N N 241 NAG O5 O N N 242 NAG O6 O N N 243 NAG O7 O N N 244 NAG H1 H N N 245 NAG H2 H N N 246 NAG H3 H N N 247 NAG H4 H N N 248 NAG H5 H N N 249 NAG H61 H N N 250 NAG H62 H N N 251 NAG H81 H N N 252 NAG H82 H N N 253 NAG H83 H N N 254 NAG HN2 H N N 255 NAG HO1 H N N 256 NAG HO3 H N N 257 NAG HO4 H N N 258 NAG HO6 H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 NAG C1 C2 sing N N 218 NAG C1 O1 sing N N 219 NAG C1 O5 sing N N 220 NAG C1 H1 sing N N 221 NAG C2 C3 sing N N 222 NAG C2 N2 sing N N 223 NAG C2 H2 sing N N 224 NAG C3 C4 sing N N 225 NAG C3 O3 sing N N 226 NAG C3 H3 sing N N 227 NAG C4 C5 sing N N 228 NAG C4 O4 sing N N 229 NAG C4 H4 sing N N 230 NAG C5 C6 sing N N 231 NAG C5 O5 sing N N 232 NAG C5 H5 sing N N 233 NAG C6 O6 sing N N 234 NAG C6 H61 sing N N 235 NAG C6 H62 sing N N 236 NAG C7 C8 sing N N 237 NAG C7 N2 sing N N 238 NAG C7 O7 doub N N 239 NAG C8 H81 sing N N 240 NAG C8 H82 sing N N 241 NAG C8 H83 sing N N 242 NAG N2 HN2 sing N N 243 NAG O1 HO1 sing N N 244 NAG O3 HO3 sing N N 245 NAG O4 HO4 sing N N 246 NAG O6 HO6 sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TRP N CA sing N N 317 TRP N H sing N N 318 TRP N H2 sing N N 319 TRP CA C sing N N 320 TRP CA CB sing N N 321 TRP CA HA sing N N 322 TRP C O doub N N 323 TRP C OXT sing N N 324 TRP CB CG sing N N 325 TRP CB HB2 sing N N 326 TRP CB HB3 sing N N 327 TRP CG CD1 doub Y N 328 TRP CG CD2 sing Y N 329 TRP CD1 NE1 sing Y N 330 TRP CD1 HD1 sing N N 331 TRP CD2 CE2 doub Y N 332 TRP CD2 CE3 sing Y N 333 TRP NE1 CE2 sing Y N 334 TRP NE1 HE1 sing N N 335 TRP CE2 CZ2 sing Y N 336 TRP CE3 CZ3 doub Y N 337 TRP CE3 HE3 sing N N 338 TRP CZ2 CH2 doub Y N 339 TRP CZ2 HZ2 sing N N 340 TRP CZ3 CH2 sing Y N 341 TRP CZ3 HZ3 sing N N 342 TRP CH2 HH2 sing N N 343 TRP OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3HUP _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4QKJ _atom_sites.fract_transf_matrix[1][1] 0.014273 _atom_sites.fract_transf_matrix[1][2] 0.008241 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016482 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009832 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ #