data_4QOB # _entry.id 4QOB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4QOB RCSB RCSB086306 WWPDB D_1000086306 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4QOB _pdbx_database_status.recvd_initial_deposition_date 2014-06-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Park, H.H.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of cPOP1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Park, H.H.' _citation_author.ordinal 1 # _cell.entry_id 4QOB _cell.length_a 94.458 _cell.length_b 94.458 _cell.length_c 94.458 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4QOB _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pyrin domain-containing protein 1' 11193.035 2 ? ? ? ? 2 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PAAD-only protein 1, Pyrin-only protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLE EAARLQRAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLE EAARLQRAALEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 THR n 1 4 LYS n 1 5 ARG n 1 6 GLU n 1 7 ALA n 1 8 ILE n 1 9 LEU n 1 10 LYS n 1 11 VAL n 1 12 LEU n 1 13 GLU n 1 14 ASN n 1 15 LEU n 1 16 THR n 1 17 PRO n 1 18 GLU n 1 19 GLU n 1 20 LEU n 1 21 LYS n 1 22 LYS n 1 23 PHE n 1 24 LYS n 1 25 MET n 1 26 LYS n 1 27 LEU n 1 28 GLY n 1 29 THR n 1 30 VAL n 1 31 PRO n 1 32 LEU n 1 33 ARG n 1 34 GLU n 1 35 GLY n 1 36 PHE n 1 37 GLU n 1 38 ARG n 1 39 ILE n 1 40 PRO n 1 41 ARG n 1 42 GLY n 1 43 ALA n 1 44 LEU n 1 45 GLY n 1 46 GLN n 1 47 LEU n 1 48 ASP n 1 49 ILE n 1 50 VAL n 1 51 ASP n 1 52 LEU n 1 53 THR n 1 54 ASP n 1 55 LYS n 1 56 LEU n 1 57 VAL n 1 58 ALA n 1 59 SER n 1 60 TYR n 1 61 TYR n 1 62 GLU n 1 63 ASP n 1 64 TYR n 1 65 ALA n 1 66 ALA n 1 67 GLU n 1 68 LEU n 1 69 VAL n 1 70 VAL n 1 71 ALA n 1 72 VAL n 1 73 LEU n 1 74 ARG n 1 75 ASP n 1 76 MET n 1 77 ARG n 1 78 MET n 1 79 LEU n 1 80 GLU n 1 81 GLU n 1 82 ALA n 1 83 ALA n 1 84 ARG n 1 85 LEU n 1 86 GLN n 1 87 ARG n 1 88 ALA n 1 89 ALA n 1 90 LEU n 1 91 GLU n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PYDC1, ASC2, ASCI, POP1, PYC1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYDC1_HUMAN _struct_ref.pdbx_db_accession Q8WXC3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLE EAARLQRAA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4QOB A 1 ? 89 ? Q8WXC3 1 ? 89 ? 1 89 2 1 4QOB B 1 ? 89 ? Q8WXC3 1 ? 89 ? 1 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4QOB LEU A 90 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 90 1 1 4QOB GLU A 91 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 91 2 1 4QOB HIS A 92 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 92 3 1 4QOB HIS A 93 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 93 4 1 4QOB HIS A 94 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 94 5 1 4QOB HIS A 95 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 95 6 1 4QOB HIS A 96 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 96 7 1 4QOB HIS A 97 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 97 8 2 4QOB LEU B 90 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 90 9 2 4QOB GLU B 91 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 91 10 2 4QOB HIS B 92 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 92 11 2 4QOB HIS B 93 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 93 12 2 4QOB HIS B 94 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 94 13 2 4QOB HIS B 95 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 95 14 2 4QOB HIS B 96 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 96 15 2 4QOB HIS B 97 ? UNP Q8WXC3 ? ? 'EXPRESSION TAG' 97 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4QOB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_percent_sol 60.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '3.6M sodium formate, 0.1M Tris-HCl pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 297K' # _diffrn.id 1 _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2013-11-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0000 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4QOB _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.7 _reflns.number_obs 10004 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.78 _reflns_shell.percent_possible_all 95 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4QOB _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7061 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 38.59 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 99.06 _refine.ls_R_factor_obs 0.25244 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.24737 _refine.ls_R_factor_R_free 0.29986 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.9 _refine.ls_number_reflns_R_free 778 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.901 _refine.correlation_coeff_Fo_to_Fc_free 0.876 _refine.B_iso_mean 38.087 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.695 _refine.pdbx_overall_ESU_R_Free 0.377 _refine.overall_SU_ML 0.237 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 11.293 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1390 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 1412 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 38.59 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.019 ? 1404 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 1458 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.675 2.024 ? 1886 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.848 3.000 ? 3348 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.145 5.000 ? 172 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.802 23.226 ? 62 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 20.217 15.000 ? 281 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 14.909 15.000 ? 16 'X-RAY DIFFRACTION' ? r_chiral_restr 0.089 0.200 ? 222 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 1522 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 286 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.770 3.434 ? 694 'X-RAY DIFFRACTION' ? r_mcbond_other 2.746 3.430 ? 693 'X-RAY DIFFRACTION' ? r_mcangle_it 4.434 5.128 ? 864 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.916 4.019 ? 708 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.704 _refine_ls_shell.d_res_low 2.774 _refine_ls_shell.number_reflns_R_work 497 _refine_ls_shell.R_factor_R_work 0.360 _refine_ls_shell.percent_reflns_obs 96.34 _refine_ls_shell.R_factor_R_free 0.342 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 55 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 4QOB _struct.title 'Crystal structure of cPOP1' _struct.pdbx_descriptor 'Pyrin domain-containing protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4QOB _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Death domain superfamily, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? ASN A 14 ? THR A 3 ASN A 14 1 ? 12 HELX_P HELX_P2 2 THR A 16 ? GLY A 28 ? THR A 16 GLY A 28 1 ? 13 HELX_P HELX_P3 3 PRO A 40 ? GLN A 46 ? PRO A 40 GLN A 46 1 ? 7 HELX_P HELX_P4 4 ASP A 48 ? TYR A 61 ? ASP A 48 TYR A 61 1 ? 14 HELX_P HELX_P5 5 TYR A 61 ? MET A 76 ? TYR A 61 MET A 76 1 ? 16 HELX_P HELX_P6 6 MET A 78 ? ALA A 89 ? MET A 78 ALA A 89 1 ? 12 HELX_P HELX_P7 7 LYS B 4 ? ASN B 14 ? LYS B 4 ASN B 14 1 ? 11 HELX_P HELX_P8 8 THR B 16 ? GLY B 28 ? THR B 16 GLY B 28 1 ? 13 HELX_P HELX_P9 9 PRO B 40 ? GLN B 46 ? PRO B 40 GLN B 46 1 ? 7 HELX_P HELX_P10 10 ASP B 48 ? TYR B 61 ? ASP B 48 TYR B 61 1 ? 14 HELX_P HELX_P11 11 TYR B 61 ? MET B 76 ? TYR B 61 MET B 76 1 ? 16 HELX_P HELX_P12 12 GLU B 80 ? ALA B 88 ? GLU B 80 ALA B 88 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 4QOB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4QOB _atom_sites.fract_transf_matrix[1][1] 0.010587 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010587 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010587 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SD SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LEU 90 90 ? ? ? A . n A 1 91 GLU 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 GLY 2 2 ? ? ? B . n B 1 3 THR 3 3 3 THR THR B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 ARG 5 5 5 ARG ARG B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 ALA 7 7 7 ALA ALA B . n B 1 8 ILE 8 8 8 ILE ILE B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 ASN 14 14 14 ASN ASN B . n B 1 15 LEU 15 15 15 LEU LEU B . n B 1 16 THR 16 16 16 THR THR B . n B 1 17 PRO 17 17 17 PRO PRO B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 LYS 21 21 21 LYS LYS B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 PHE 23 23 23 PHE PHE B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 MET 25 25 25 MET MSE B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 GLY 28 28 28 GLY GLY B . n B 1 29 THR 29 29 29 THR THR B . n B 1 30 VAL 30 30 30 VAL VAL B . n B 1 31 PRO 31 31 31 PRO PRO B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 ARG 33 33 33 ARG ARG B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 GLY 35 35 35 GLY GLY B . n B 1 36 PHE 36 36 36 PHE PHE B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ARG 38 38 38 ARG ARG B . n B 1 39 ILE 39 39 39 ILE ILE B . n B 1 40 PRO 40 40 40 PRO PRO B . n B 1 41 ARG 41 41 41 ARG ARG B . n B 1 42 GLY 42 42 42 GLY GLY B . n B 1 43 ALA 43 43 43 ALA ALA B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 GLY 45 45 45 GLY GLY B . n B 1 46 GLN 46 46 46 GLN GLN B . n B 1 47 LEU 47 47 47 LEU LEU B . n B 1 48 ASP 48 48 48 ASP ASP B . n B 1 49 ILE 49 49 49 ILE ILE B . n B 1 50 VAL 50 50 50 VAL VAL B . n B 1 51 ASP 51 51 51 ASP ASP B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 THR 53 53 53 THR THR B . n B 1 54 ASP 54 54 54 ASP ASP B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 LEU 56 56 56 LEU LEU B . n B 1 57 VAL 57 57 57 VAL VAL B . n B 1 58 ALA 58 58 58 ALA ALA B . n B 1 59 SER 59 59 59 SER SER B . n B 1 60 TYR 60 60 60 TYR TYR B . n B 1 61 TYR 61 61 61 TYR TYR B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 ASP 63 63 63 ASP ASP B . n B 1 64 TYR 64 64 64 TYR TYR B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 ALA 66 66 66 ALA ALA B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 LEU 68 68 68 LEU LEU B . n B 1 69 VAL 69 69 69 VAL VAL B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 VAL 72 72 72 VAL VAL B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 ARG 74 74 74 ARG ARG B . n B 1 75 ASP 75 75 75 ASP ASP B . n B 1 76 MET 76 76 76 MET MET B . n B 1 77 ARG 77 77 77 ARG ARG B . n B 1 78 MET 78 78 78 MET MET B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 ARG 84 84 84 ARG ARG B . n B 1 85 LEU 85 85 85 LEU LEU B . n B 1 86 GLN 86 86 86 GLN GLN B . n B 1 87 ARG 87 87 87 ARG ARG B . n B 1 88 ALA 88 88 88 ALA ALA B . n B 1 89 ALA 89 89 89 ALA ALA B . n B 1 90 LEU 90 90 ? ? ? B . n B 1 91 GLU 91 91 ? ? ? B . n B 1 92 HIS 92 92 ? ? ? B . n B 1 93 HIS 93 93 ? ? ? B . n B 1 94 HIS 94 94 ? ? ? B . n B 1 95 HIS 95 95 ? ? ? B . n B 1 96 HIS 96 96 ? ? ? B . n B 1 97 HIS 97 97 ? ? ? B . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-11-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SOLVE phasing . ? 2 PHENIX refinement '(phenix.refine: 1.8_1069)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 REFMAC refinement 5.7.0032 ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 3 ? ? O A HOH 110 ? ? 1.99 2 1 N A GLU 6 ? ? O A HOH 110 ? ? 2.17 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 B _pdbx_validate_rmsd_bond.auth_comp_id_1 MET _pdbx_validate_rmsd_bond.auth_seq_id_1 25 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SD _pdbx_validate_rmsd_bond.auth_asym_id_2 B _pdbx_validate_rmsd_bond.auth_comp_id_2 MET _pdbx_validate_rmsd_bond.auth_seq_id_2 25 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.991 _pdbx_validate_rmsd_bond.bond_target_value 1.807 _pdbx_validate_rmsd_bond.bond_deviation 0.184 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.026 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 46 ? ? -86.42 41.04 2 1 TYR A 61 ? ? 72.17 162.47 3 1 GLN B 46 ? ? -92.02 45.12 4 1 TYR B 61 ? ? 67.17 161.91 5 1 LEU B 79 ? ? -89.47 35.59 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LEU _pdbx_validate_peptide_omega.auth_asym_id_1 B _pdbx_validate_peptide_omega.auth_seq_id_1 79 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 B _pdbx_validate_peptide_omega.auth_seq_id_2 80 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 143.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A LEU 90 ? A LEU 90 4 1 Y 1 A GLU 91 ? A GLU 91 5 1 Y 1 A HIS 92 ? A HIS 92 6 1 Y 1 A HIS 93 ? A HIS 93 7 1 Y 1 A HIS 94 ? A HIS 94 8 1 Y 1 A HIS 95 ? A HIS 95 9 1 Y 1 A HIS 96 ? A HIS 96 10 1 Y 1 A HIS 97 ? A HIS 97 11 1 Y 1 B MET 1 ? B MET 1 12 1 Y 1 B GLY 2 ? B GLY 2 13 1 Y 1 B LEU 90 ? B LEU 90 14 1 Y 1 B GLU 91 ? B GLU 91 15 1 Y 1 B HIS 92 ? B HIS 92 16 1 Y 1 B HIS 93 ? B HIS 93 17 1 Y 1 B HIS 94 ? B HIS 94 18 1 Y 1 B HIS 95 ? B HIS 95 19 1 Y 1 B HIS 96 ? B HIS 96 20 1 Y 1 B HIS 97 ? B HIS 97 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 1 HOH HOH A . C 2 HOH 2 102 3 HOH HOH A . C 2 HOH 3 103 4 HOH HOH A . C 2 HOH 4 104 8 HOH HOH A . C 2 HOH 5 105 9 HOH HOH A . C 2 HOH 6 106 11 HOH HOH A . C 2 HOH 7 107 12 HOH HOH A . C 2 HOH 8 108 13 HOH HOH A . C 2 HOH 9 109 14 HOH HOH A . C 2 HOH 10 110 18 HOH HOH A . C 2 HOH 11 111 20 HOH HOH A . C 2 HOH 12 112 21 HOH HOH A . C 2 HOH 13 113 22 HOH HOH A . D 2 HOH 1 101 2 HOH HOH B . D 2 HOH 2 102 5 HOH HOH B . D 2 HOH 3 103 6 HOH HOH B . D 2 HOH 4 104 7 HOH HOH B . D 2 HOH 5 105 10 HOH HOH B . D 2 HOH 6 106 15 HOH HOH B . D 2 HOH 7 107 16 HOH HOH B . D 2 HOH 8 108 17 HOH HOH B . D 2 HOH 9 109 19 HOH HOH B . #