data_4QOX # _entry.id 4QOX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4QOX pdb_00004qox 10.2210/pdb4qox/pdb RCSB RCSB086328 ? ? WWPDB D_1000086328 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-09-03 2 'Structure model' 1 1 2017-11-22 3 'Structure model' 1 2 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.value' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 3 'Structure model' '_struct_ref_seq_dif.details' 29 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 4QOX _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-06-20 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wernimont, A.K.' 1 'Walker, J.R.' 2 'Hutchinson, A.' 3 'Seitova, A.' 4 'He, H.' 5 'Loppnau, P.' 6 'Neculai, M.' 7 'Amani, M.' 8 'Lin, Y.H.' 9 'Ravichandran, M.' 10 'Arrowsmith, C.H.' 11 'Edwards, A.M.' 12 'Bountra, C.' 13 'Hui, R.' 14 'Lovato, D.V.' 15 'Structural Genomics Consortium (SGC)' 16 # _citation.id primary _citation.title 'Crystal Structure of CDPK4 from Plasmodium Falciparum, PF3D7_0717500' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wernimont, A.K.' 1 ? primary 'Walker, J.R.' 2 ? primary 'Hutchinson, A.' 3 ? primary 'Seitova, A.' 4 ? primary 'He, H.' 5 ? primary 'Loppnau, P.' 6 ? primary 'Neculai, M.' 7 ? primary 'Amani, M.' 8 ? primary 'Lin, Y.H.' 9 ? primary 'Ravichandran, M.' 10 ? primary 'Arrowsmith, C.H.' 11 ? primary 'Edwards, A.M.' 12 ? primary 'Bountra, C.' 13 ? primary 'Hui, R.' 14 ? primary 'Lovato, D.V.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-dependent protein kinase 4' 62139.055 1 2.7.11.1 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn '3-(3-bromobenzyl)-1-tert-butyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine' 360.252 1 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGNTKNEHHKTNKKSLKGGNERHEMKESSVGISKKIVENSFNNSKLRPGMFIQNSNVVFNEQYK GIKILGKGSFGEVILSRDKHTGHEYAIKVISKKHVKRKTDKESLLREVELLKMLDHINIMKLYEFFEDNNYYYLVSDVYT GGELFDEIISRKRFYEIDAARIIKQILSGITYMHKNNVVHRDLKPENILLETKNKEDMIIKIIDFGLSTHFEYSKKMKDK IGTAYYIAPDVLHGTYDEKCDIWSCGVILYILLSGCPPFNGSNEYDILKKVEAGKYTFDLPQFKKISDKAKDLIKKMLMY TSAVRISARDALEHEWIKMMTSKDNLNIDIPSLELSIANIRQFQSTQKLAQAALLYMGSKLTTIDETKELTKIFKKMDKN GDGQLDRNELIIGYKELLKLKGEDTSDLDNAAIEYEVDQILNSIDLDQNGYIEYSEFLTVSIDRKLLLSTERLEKAFKLF DKDGSGKISANELAQLFGLSDVSSECWKTVLKEVDQNNDGEIDFKEFRDMLVKLCNY ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGNTKNEHHKTNKKSLKGGNERHEMKESSVGISKKIVENSFNNSKLRPGMFIQNSNVVFNEQYK GIKILGKGSFGEVILSRDKHTGHEYAIKVISKKHVKRKTDKESLLREVELLKMLDHINIMKLYEFFEDNNYYYLVSDVYT GGELFDEIISRKRFYEIDAARIIKQILSGITYMHKNNVVHRDLKPENILLETKNKEDMIIKIIDFGLSTHFEYSKKMKDK IGTAYYIAPDVLHGTYDEKCDIWSCGVILYILLSGCPPFNGSNEYDILKKVEAGKYTFDLPQFKKISDKAKDLIKKMLMY TSAVRISARDALEHEWIKMMTSKDNLNIDIPSLELSIANIRQFQSTQKLAQAALLYMGSKLTTIDETKELTKIFKKMDKN GDGQLDRNELIIGYKELLKLKGEDTSDLDNAAIEYEVDQILNSIDLDQNGYIEYSEFLTVSIDRKLLLSTERLEKAFKLF DKDGSGKISANELAQLFGLSDVSSECWKTVLKEVDQNNDGEIDFKEFRDMLVKLCNY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 '3-(3-bromobenzyl)-1-tert-butyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine' DXR 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 ASN n 1 20 THR n 1 21 LYS n 1 22 ASN n 1 23 GLU n 1 24 HIS n 1 25 HIS n 1 26 LYS n 1 27 THR n 1 28 ASN n 1 29 LYS n 1 30 LYS n 1 31 SER n 1 32 LEU n 1 33 LYS n 1 34 GLY n 1 35 GLY n 1 36 ASN n 1 37 GLU n 1 38 ARG n 1 39 HIS n 1 40 GLU n 1 41 MET n 1 42 LYS n 1 43 GLU n 1 44 SER n 1 45 SER n 1 46 VAL n 1 47 GLY n 1 48 ILE n 1 49 SER n 1 50 LYS n 1 51 LYS n 1 52 ILE n 1 53 VAL n 1 54 GLU n 1 55 ASN n 1 56 SER n 1 57 PHE n 1 58 ASN n 1 59 ASN n 1 60 SER n 1 61 LYS n 1 62 LEU n 1 63 ARG n 1 64 PRO n 1 65 GLY n 1 66 MET n 1 67 PHE n 1 68 ILE n 1 69 GLN n 1 70 ASN n 1 71 SER n 1 72 ASN n 1 73 VAL n 1 74 VAL n 1 75 PHE n 1 76 ASN n 1 77 GLU n 1 78 GLN n 1 79 TYR n 1 80 LYS n 1 81 GLY n 1 82 ILE n 1 83 LYS n 1 84 ILE n 1 85 LEU n 1 86 GLY n 1 87 LYS n 1 88 GLY n 1 89 SER n 1 90 PHE n 1 91 GLY n 1 92 GLU n 1 93 VAL n 1 94 ILE n 1 95 LEU n 1 96 SER n 1 97 ARG n 1 98 ASP n 1 99 LYS n 1 100 HIS n 1 101 THR n 1 102 GLY n 1 103 HIS n 1 104 GLU n 1 105 TYR n 1 106 ALA n 1 107 ILE n 1 108 LYS n 1 109 VAL n 1 110 ILE n 1 111 SER n 1 112 LYS n 1 113 LYS n 1 114 HIS n 1 115 VAL n 1 116 LYS n 1 117 ARG n 1 118 LYS n 1 119 THR n 1 120 ASP n 1 121 LYS n 1 122 GLU n 1 123 SER n 1 124 LEU n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 VAL n 1 129 GLU n 1 130 LEU n 1 131 LEU n 1 132 LYS n 1 133 MET n 1 134 LEU n 1 135 ASP n 1 136 HIS n 1 137 ILE n 1 138 ASN n 1 139 ILE n 1 140 MET n 1 141 LYS n 1 142 LEU n 1 143 TYR n 1 144 GLU n 1 145 PHE n 1 146 PHE n 1 147 GLU n 1 148 ASP n 1 149 ASN n 1 150 ASN n 1 151 TYR n 1 152 TYR n 1 153 TYR n 1 154 LEU n 1 155 VAL n 1 156 SER n 1 157 ASP n 1 158 VAL n 1 159 TYR n 1 160 THR n 1 161 GLY n 1 162 GLY n 1 163 GLU n 1 164 LEU n 1 165 PHE n 1 166 ASP n 1 167 GLU n 1 168 ILE n 1 169 ILE n 1 170 SER n 1 171 ARG n 1 172 LYS n 1 173 ARG n 1 174 PHE n 1 175 TYR n 1 176 GLU n 1 177 ILE n 1 178 ASP n 1 179 ALA n 1 180 ALA n 1 181 ARG n 1 182 ILE n 1 183 ILE n 1 184 LYS n 1 185 GLN n 1 186 ILE n 1 187 LEU n 1 188 SER n 1 189 GLY n 1 190 ILE n 1 191 THR n 1 192 TYR n 1 193 MET n 1 194 HIS n 1 195 LYS n 1 196 ASN n 1 197 ASN n 1 198 VAL n 1 199 VAL n 1 200 HIS n 1 201 ARG n 1 202 ASP n 1 203 LEU n 1 204 LYS n 1 205 PRO n 1 206 GLU n 1 207 ASN n 1 208 ILE n 1 209 LEU n 1 210 LEU n 1 211 GLU n 1 212 THR n 1 213 LYS n 1 214 ASN n 1 215 LYS n 1 216 GLU n 1 217 ASP n 1 218 MET n 1 219 ILE n 1 220 ILE n 1 221 LYS n 1 222 ILE n 1 223 ILE n 1 224 ASP n 1 225 PHE n 1 226 GLY n 1 227 LEU n 1 228 SER n 1 229 THR n 1 230 HIS n 1 231 PHE n 1 232 GLU n 1 233 TYR n 1 234 SER n 1 235 LYS n 1 236 LYS n 1 237 MET n 1 238 LYS n 1 239 ASP n 1 240 LYS n 1 241 ILE n 1 242 GLY n 1 243 THR n 1 244 ALA n 1 245 TYR n 1 246 TYR n 1 247 ILE n 1 248 ALA n 1 249 PRO n 1 250 ASP n 1 251 VAL n 1 252 LEU n 1 253 HIS n 1 254 GLY n 1 255 THR n 1 256 TYR n 1 257 ASP n 1 258 GLU n 1 259 LYS n 1 260 CYS n 1 261 ASP n 1 262 ILE n 1 263 TRP n 1 264 SER n 1 265 CYS n 1 266 GLY n 1 267 VAL n 1 268 ILE n 1 269 LEU n 1 270 TYR n 1 271 ILE n 1 272 LEU n 1 273 LEU n 1 274 SER n 1 275 GLY n 1 276 CYS n 1 277 PRO n 1 278 PRO n 1 279 PHE n 1 280 ASN n 1 281 GLY n 1 282 SER n 1 283 ASN n 1 284 GLU n 1 285 TYR n 1 286 ASP n 1 287 ILE n 1 288 LEU n 1 289 LYS n 1 290 LYS n 1 291 VAL n 1 292 GLU n 1 293 ALA n 1 294 GLY n 1 295 LYS n 1 296 TYR n 1 297 THR n 1 298 PHE n 1 299 ASP n 1 300 LEU n 1 301 PRO n 1 302 GLN n 1 303 PHE n 1 304 LYS n 1 305 LYS n 1 306 ILE n 1 307 SER n 1 308 ASP n 1 309 LYS n 1 310 ALA n 1 311 LYS n 1 312 ASP n 1 313 LEU n 1 314 ILE n 1 315 LYS n 1 316 LYS n 1 317 MET n 1 318 LEU n 1 319 MET n 1 320 TYR n 1 321 THR n 1 322 SER n 1 323 ALA n 1 324 VAL n 1 325 ARG n 1 326 ILE n 1 327 SER n 1 328 ALA n 1 329 ARG n 1 330 ASP n 1 331 ALA n 1 332 LEU n 1 333 GLU n 1 334 HIS n 1 335 GLU n 1 336 TRP n 1 337 ILE n 1 338 LYS n 1 339 MET n 1 340 MET n 1 341 THR n 1 342 SER n 1 343 LYS n 1 344 ASP n 1 345 ASN n 1 346 LEU n 1 347 ASN n 1 348 ILE n 1 349 ASP n 1 350 ILE n 1 351 PRO n 1 352 SER n 1 353 LEU n 1 354 GLU n 1 355 LEU n 1 356 SER n 1 357 ILE n 1 358 ALA n 1 359 ASN n 1 360 ILE n 1 361 ARG n 1 362 GLN n 1 363 PHE n 1 364 GLN n 1 365 SER n 1 366 THR n 1 367 GLN n 1 368 LYS n 1 369 LEU n 1 370 ALA n 1 371 GLN n 1 372 ALA n 1 373 ALA n 1 374 LEU n 1 375 LEU n 1 376 TYR n 1 377 MET n 1 378 GLY n 1 379 SER n 1 380 LYS n 1 381 LEU n 1 382 THR n 1 383 THR n 1 384 ILE n 1 385 ASP n 1 386 GLU n 1 387 THR n 1 388 LYS n 1 389 GLU n 1 390 LEU n 1 391 THR n 1 392 LYS n 1 393 ILE n 1 394 PHE n 1 395 LYS n 1 396 LYS n 1 397 MET n 1 398 ASP n 1 399 LYS n 1 400 ASN n 1 401 GLY n 1 402 ASP n 1 403 GLY n 1 404 GLN n 1 405 LEU n 1 406 ASP n 1 407 ARG n 1 408 ASN n 1 409 GLU n 1 410 LEU n 1 411 ILE n 1 412 ILE n 1 413 GLY n 1 414 TYR n 1 415 LYS n 1 416 GLU n 1 417 LEU n 1 418 LEU n 1 419 LYS n 1 420 LEU n 1 421 LYS n 1 422 GLY n 1 423 GLU n 1 424 ASP n 1 425 THR n 1 426 SER n 1 427 ASP n 1 428 LEU n 1 429 ASP n 1 430 ASN n 1 431 ALA n 1 432 ALA n 1 433 ILE n 1 434 GLU n 1 435 TYR n 1 436 GLU n 1 437 VAL n 1 438 ASP n 1 439 GLN n 1 440 ILE n 1 441 LEU n 1 442 ASN n 1 443 SER n 1 444 ILE n 1 445 ASP n 1 446 LEU n 1 447 ASP n 1 448 GLN n 1 449 ASN n 1 450 GLY n 1 451 TYR n 1 452 ILE n 1 453 GLU n 1 454 TYR n 1 455 SER n 1 456 GLU n 1 457 PHE n 1 458 LEU n 1 459 THR n 1 460 VAL n 1 461 SER n 1 462 ILE n 1 463 ASP n 1 464 ARG n 1 465 LYS n 1 466 LEU n 1 467 LEU n 1 468 LEU n 1 469 SER n 1 470 THR n 1 471 GLU n 1 472 ARG n 1 473 LEU n 1 474 GLU n 1 475 LYS n 1 476 ALA n 1 477 PHE n 1 478 LYS n 1 479 LEU n 1 480 PHE n 1 481 ASP n 1 482 LYS n 1 483 ASP n 1 484 GLY n 1 485 SER n 1 486 GLY n 1 487 LYS n 1 488 ILE n 1 489 SER n 1 490 ALA n 1 491 ASN n 1 492 GLU n 1 493 LEU n 1 494 ALA n 1 495 GLN n 1 496 LEU n 1 497 PHE n 1 498 GLY n 1 499 LEU n 1 500 SER n 1 501 ASP n 1 502 VAL n 1 503 SER n 1 504 SER n 1 505 GLU n 1 506 CYS n 1 507 TRP n 1 508 LYS n 1 509 THR n 1 510 VAL n 1 511 LEU n 1 512 LYS n 1 513 GLU n 1 514 VAL n 1 515 ASP n 1 516 GLN n 1 517 ASN n 1 518 ASN n 1 519 ASP n 1 520 GLY n 1 521 GLU n 1 522 ILE n 1 523 ASP n 1 524 PHE n 1 525 LYS n 1 526 GLU n 1 527 PHE n 1 528 ARG n 1 529 ASP n 1 530 MET n 1 531 LEU n 1 532 VAL n 1 533 LYS n 1 534 LEU n 1 535 CYS n 1 536 ASN n 1 537 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CDPK4, CPK4, PF07_0072' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line SF9SF9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name DH5-alpha _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DXR non-polymer . '3-(3-bromobenzyl)-1-tert-butyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine' ? 'C16 H18 Br N5' 360.252 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -8 ? ? ? A . n A 1 2 HIS 2 -7 ? ? ? A . n A 1 3 HIS 3 -6 ? ? ? A . n A 1 4 HIS 4 -5 ? ? ? A . n A 1 5 HIS 5 -4 ? ? ? A . n A 1 6 HIS 6 -3 ? ? ? A . n A 1 7 HIS 7 -2 ? ? ? A . n A 1 8 SER 8 -1 ? ? ? A . n A 1 9 SER 9 0 ? ? ? A . n A 1 10 GLY 10 1 ? ? ? A . n A 1 11 ARG 11 2 ? ? ? A . n A 1 12 GLU 12 3 ? ? ? A . n A 1 13 ASN 13 4 ? ? ? A . n A 1 14 LEU 14 5 ? ? ? A . n A 1 15 TYR 15 6 ? ? ? A . n A 1 16 PHE 16 7 ? ? ? A . n A 1 17 GLN 17 8 ? ? ? A . n A 1 18 GLY 18 9 ? ? ? A . n A 1 19 ASN 19 10 ? ? ? A . n A 1 20 THR 20 11 ? ? ? A . n A 1 21 LYS 21 12 ? ? ? A . n A 1 22 ASN 22 13 ? ? ? A . n A 1 23 GLU 23 14 ? ? ? A . n A 1 24 HIS 24 15 ? ? ? A . n A 1 25 HIS 25 16 ? ? ? A . n A 1 26 LYS 26 17 ? ? ? A . n A 1 27 THR 27 18 ? ? ? A . n A 1 28 ASN 28 19 ? ? ? A . n A 1 29 LYS 29 20 ? ? ? A . n A 1 30 LYS 30 21 ? ? ? A . n A 1 31 SER 31 22 ? ? ? A . n A 1 32 LEU 32 23 ? ? ? A . n A 1 33 LYS 33 24 ? ? ? A . n A 1 34 GLY 34 25 ? ? ? A . n A 1 35 GLY 35 26 ? ? ? A . n A 1 36 ASN 36 27 ? ? ? A . n A 1 37 GLU 37 28 ? ? ? A . n A 1 38 ARG 38 29 ? ? ? A . n A 1 39 HIS 39 30 ? ? ? A . n A 1 40 GLU 40 31 ? ? ? A . n A 1 41 MET 41 32 ? ? ? A . n A 1 42 LYS 42 33 ? ? ? A . n A 1 43 GLU 43 34 ? ? ? A . n A 1 44 SER 44 35 ? ? ? A . n A 1 45 SER 45 36 ? ? ? A . n A 1 46 VAL 46 37 ? ? ? A . n A 1 47 GLY 47 38 ? ? ? A . n A 1 48 ILE 48 39 ? ? ? A . n A 1 49 SER 49 40 ? ? ? A . n A 1 50 LYS 50 41 ? ? ? A . n A 1 51 LYS 51 42 ? ? ? A . n A 1 52 ILE 52 43 ? ? ? A . n A 1 53 VAL 53 44 ? ? ? A . n A 1 54 GLU 54 45 ? ? ? A . n A 1 55 ASN 55 46 ? ? ? A . n A 1 56 SER 56 47 ? ? ? A . n A 1 57 PHE 57 48 ? ? ? A . n A 1 58 ASN 58 49 ? ? ? A . n A 1 59 ASN 59 50 ? ? ? A . n A 1 60 SER 60 51 51 SER SER A . n A 1 61 LYS 61 52 52 LYS LYS A . n A 1 62 LEU 62 53 53 LEU LEU A . n A 1 63 ARG 63 54 54 ARG ARG A . n A 1 64 PRO 64 55 55 PRO PRO A . n A 1 65 GLY 65 56 56 GLY GLY A . n A 1 66 MET 66 57 57 MET MET A . n A 1 67 PHE 67 58 58 PHE PHE A . n A 1 68 ILE 68 59 59 ILE ILE A . n A 1 69 GLN 69 60 60 GLN GLN A . n A 1 70 ASN 70 61 61 ASN ASN A . n A 1 71 SER 71 62 62 SER SER A . n A 1 72 ASN 72 63 63 ASN ASN A . n A 1 73 VAL 73 64 64 VAL VAL A . n A 1 74 VAL 74 65 65 VAL VAL A . n A 1 75 PHE 75 66 66 PHE PHE A . n A 1 76 ASN 76 67 67 ASN ASN A . n A 1 77 GLU 77 68 68 GLU GLU A . n A 1 78 GLN 78 69 69 GLN GLN A . n A 1 79 TYR 79 70 70 TYR TYR A . n A 1 80 LYS 80 71 71 LYS LYS A . n A 1 81 GLY 81 72 72 GLY GLY A . n A 1 82 ILE 82 73 73 ILE ILE A . n A 1 83 LYS 83 74 74 LYS LYS A . n A 1 84 ILE 84 75 75 ILE ILE A . n A 1 85 LEU 85 76 76 LEU LEU A . n A 1 86 GLY 86 77 77 GLY GLY A . n A 1 87 LYS 87 78 78 LYS LYS A . n A 1 88 GLY 88 79 79 GLY GLY A . n A 1 89 SER 89 80 80 SER SER A . n A 1 90 PHE 90 81 81 PHE PHE A . n A 1 91 GLY 91 82 82 GLY GLY A . n A 1 92 GLU 92 83 83 GLU GLU A . n A 1 93 VAL 93 84 84 VAL VAL A . n A 1 94 ILE 94 85 85 ILE ILE A . n A 1 95 LEU 95 86 86 LEU LEU A . n A 1 96 SER 96 87 87 SER SER A . n A 1 97 ARG 97 88 88 ARG ARG A . n A 1 98 ASP 98 89 89 ASP ASP A . n A 1 99 LYS 99 90 90 LYS LYS A . n A 1 100 HIS 100 91 91 HIS HIS A . n A 1 101 THR 101 92 92 THR THR A . n A 1 102 GLY 102 93 93 GLY GLY A . n A 1 103 HIS 103 94 94 HIS HIS A . n A 1 104 GLU 104 95 95 GLU GLU A . n A 1 105 TYR 105 96 96 TYR TYR A . n A 1 106 ALA 106 97 97 ALA ALA A . n A 1 107 ILE 107 98 98 ILE ILE A . n A 1 108 LYS 108 99 99 LYS LYS A . n A 1 109 VAL 109 100 100 VAL VAL A . n A 1 110 ILE 110 101 101 ILE ILE A . n A 1 111 SER 111 102 102 SER SER A . n A 1 112 LYS 112 103 103 LYS LYS A . n A 1 113 LYS 113 104 104 LYS LYS A . n A 1 114 HIS 114 105 105 HIS HIS A . n A 1 115 VAL 115 106 106 VAL VAL A . n A 1 116 LYS 116 107 107 LYS LYS A . n A 1 117 ARG 117 108 108 ARG ARG A . n A 1 118 LYS 118 109 109 LYS LYS A . n A 1 119 THR 119 110 110 THR THR A . n A 1 120 ASP 120 111 111 ASP ASP A . n A 1 121 LYS 121 112 112 LYS LYS A . n A 1 122 GLU 122 113 113 GLU GLU A . n A 1 123 SER 123 114 114 SER SER A . n A 1 124 LEU 124 115 115 LEU LEU A . n A 1 125 LEU 125 116 116 LEU LEU A . n A 1 126 ARG 126 117 117 ARG ARG A . n A 1 127 GLU 127 118 118 GLU GLU A . n A 1 128 VAL 128 119 119 VAL VAL A . n A 1 129 GLU 129 120 120 GLU GLU A . n A 1 130 LEU 130 121 121 LEU LEU A . n A 1 131 LEU 131 122 122 LEU LEU A . n A 1 132 LYS 132 123 123 LYS LYS A . n A 1 133 MET 133 124 124 MET MET A . n A 1 134 LEU 134 125 125 LEU LEU A . n A 1 135 ASP 135 126 126 ASP ASP A . n A 1 136 HIS 136 127 127 HIS HIS A . n A 1 137 ILE 137 128 128 ILE ILE A . n A 1 138 ASN 138 129 129 ASN ASN A . n A 1 139 ILE 139 130 130 ILE ILE A . n A 1 140 MET 140 131 131 MET MET A . n A 1 141 LYS 141 132 132 LYS LYS A . n A 1 142 LEU 142 133 133 LEU LEU A . n A 1 143 TYR 143 134 134 TYR TYR A . n A 1 144 GLU 144 135 135 GLU GLU A . n A 1 145 PHE 145 136 136 PHE PHE A . n A 1 146 PHE 146 137 137 PHE PHE A . n A 1 147 GLU 147 138 138 GLU GLU A . n A 1 148 ASP 148 139 139 ASP ASP A . n A 1 149 ASN 149 140 140 ASN ASN A . n A 1 150 ASN 150 141 141 ASN ASN A . n A 1 151 TYR 151 142 142 TYR TYR A . n A 1 152 TYR 152 143 143 TYR TYR A . n A 1 153 TYR 153 144 144 TYR TYR A . n A 1 154 LEU 154 145 145 LEU LEU A . n A 1 155 VAL 155 146 146 VAL VAL A . n A 1 156 SER 156 147 147 SER SER A . n A 1 157 ASP 157 148 148 ASP ASP A . n A 1 158 VAL 158 149 149 VAL VAL A . n A 1 159 TYR 159 150 150 TYR TYR A . n A 1 160 THR 160 151 151 THR THR A . n A 1 161 GLY 161 152 152 GLY GLY A . n A 1 162 GLY 162 153 153 GLY GLY A . n A 1 163 GLU 163 154 154 GLU GLU A . n A 1 164 LEU 164 155 155 LEU LEU A . n A 1 165 PHE 165 156 156 PHE PHE A . n A 1 166 ASP 166 157 157 ASP ASP A . n A 1 167 GLU 167 158 158 GLU GLU A . n A 1 168 ILE 168 159 159 ILE ILE A . n A 1 169 ILE 169 160 160 ILE ILE A . n A 1 170 SER 170 161 161 SER SER A . n A 1 171 ARG 171 162 162 ARG ARG A . n A 1 172 LYS 172 163 163 LYS LYS A . n A 1 173 ARG 173 164 164 ARG ARG A . n A 1 174 PHE 174 165 165 PHE PHE A . n A 1 175 TYR 175 166 166 TYR TYR A . n A 1 176 GLU 176 167 167 GLU GLU A . n A 1 177 ILE 177 168 168 ILE ILE A . n A 1 178 ASP 178 169 169 ASP ASP A . n A 1 179 ALA 179 170 170 ALA ALA A . n A 1 180 ALA 180 171 171 ALA ALA A . n A 1 181 ARG 181 172 172 ARG ARG A . n A 1 182 ILE 182 173 173 ILE ILE A . n A 1 183 ILE 183 174 174 ILE ILE A . n A 1 184 LYS 184 175 175 LYS LYS A . n A 1 185 GLN 185 176 176 GLN GLN A . n A 1 186 ILE 186 177 177 ILE ILE A . n A 1 187 LEU 187 178 178 LEU LEU A . n A 1 188 SER 188 179 179 SER SER A . n A 1 189 GLY 189 180 180 GLY GLY A . n A 1 190 ILE 190 181 181 ILE ILE A . n A 1 191 THR 191 182 182 THR THR A . n A 1 192 TYR 192 183 183 TYR TYR A . n A 1 193 MET 193 184 184 MET MET A . n A 1 194 HIS 194 185 185 HIS HIS A . n A 1 195 LYS 195 186 186 LYS LYS A . n A 1 196 ASN 196 187 187 ASN ASN A . n A 1 197 ASN 197 188 188 ASN ASN A . n A 1 198 VAL 198 189 189 VAL VAL A . n A 1 199 VAL 199 190 190 VAL VAL A . n A 1 200 HIS 200 191 191 HIS HIS A . n A 1 201 ARG 201 192 192 ARG ARG A . n A 1 202 ASP 202 193 193 ASP ASP A . n A 1 203 LEU 203 194 194 LEU LEU A . n A 1 204 LYS 204 195 195 LYS LYS A . n A 1 205 PRO 205 196 196 PRO PRO A . n A 1 206 GLU 206 197 197 GLU GLU A . n A 1 207 ASN 207 198 198 ASN ASN A . n A 1 208 ILE 208 199 199 ILE ILE A . n A 1 209 LEU 209 200 200 LEU LEU A . n A 1 210 LEU 210 201 201 LEU LEU A . n A 1 211 GLU 211 202 202 GLU GLU A . n A 1 212 THR 212 203 203 THR THR A . n A 1 213 LYS 213 204 204 LYS LYS A . n A 1 214 ASN 214 205 205 ASN ASN A . n A 1 215 LYS 215 206 ? ? ? A . n A 1 216 GLU 216 207 207 GLU GLU A . n A 1 217 ASP 217 208 208 ASP ASP A . n A 1 218 MET 218 209 209 MET MET A . n A 1 219 ILE 219 210 210 ILE ILE A . n A 1 220 ILE 220 211 211 ILE ILE A . n A 1 221 LYS 221 212 212 LYS LYS A . n A 1 222 ILE 222 213 213 ILE ILE A . n A 1 223 ILE 223 214 214 ILE ILE A . n A 1 224 ASP 224 215 215 ASP ASP A . n A 1 225 PHE 225 216 216 PHE PHE A . n A 1 226 GLY 226 217 217 GLY GLY A . n A 1 227 LEU 227 218 218 LEU LEU A . n A 1 228 SER 228 219 219 SER SER A . n A 1 229 THR 229 220 220 THR THR A . n A 1 230 HIS 230 221 221 HIS HIS A . n A 1 231 PHE 231 222 222 PHE PHE A . n A 1 232 GLU 232 223 223 GLU GLU A . n A 1 233 TYR 233 224 224 TYR TYR A . n A 1 234 SER 234 225 225 SER SER A . n A 1 235 LYS 235 226 ? ? ? A . n A 1 236 LYS 236 227 ? ? ? A . n A 1 237 MET 237 228 ? ? ? A . n A 1 238 LYS 238 229 ? ? ? A . n A 1 239 ASP 239 230 ? ? ? A . n A 1 240 LYS 240 231 231 LYS LYS A . n A 1 241 ILE 241 232 232 ILE ILE A . n A 1 242 GLY 242 233 233 GLY GLY A . n A 1 243 THR 243 234 234 THR THR A . n A 1 244 ALA 244 235 235 ALA ALA A . n A 1 245 TYR 245 236 236 TYR TYR A . n A 1 246 TYR 246 237 237 TYR TYR A . n A 1 247 ILE 247 238 238 ILE ILE A . n A 1 248 ALA 248 239 239 ALA ALA A . n A 1 249 PRO 249 240 240 PRO PRO A . n A 1 250 ASP 250 241 241 ASP ASP A . n A 1 251 VAL 251 242 242 VAL VAL A . n A 1 252 LEU 252 243 243 LEU LEU A . n A 1 253 HIS 253 244 244 HIS HIS A . n A 1 254 GLY 254 245 245 GLY GLY A . n A 1 255 THR 255 246 246 THR THR A . n A 1 256 TYR 256 247 247 TYR TYR A . n A 1 257 ASP 257 248 248 ASP ASP A . n A 1 258 GLU 258 249 249 GLU GLU A . n A 1 259 LYS 259 250 250 LYS LYS A . n A 1 260 CYS 260 251 251 CYS CYS A . n A 1 261 ASP 261 252 252 ASP ASP A . n A 1 262 ILE 262 253 253 ILE ILE A . n A 1 263 TRP 263 254 254 TRP TRP A . n A 1 264 SER 264 255 255 SER SER A . n A 1 265 CYS 265 256 256 CYS CYS A . n A 1 266 GLY 266 257 257 GLY GLY A . n A 1 267 VAL 267 258 258 VAL VAL A . n A 1 268 ILE 268 259 259 ILE ILE A . n A 1 269 LEU 269 260 260 LEU LEU A . n A 1 270 TYR 270 261 261 TYR TYR A . n A 1 271 ILE 271 262 262 ILE ILE A . n A 1 272 LEU 272 263 263 LEU LEU A . n A 1 273 LEU 273 264 264 LEU LEU A . n A 1 274 SER 274 265 265 SER SER A . n A 1 275 GLY 275 266 266 GLY GLY A . n A 1 276 CYS 276 267 267 CYS CYS A . n A 1 277 PRO 277 268 268 PRO PRO A . n A 1 278 PRO 278 269 269 PRO PRO A . n A 1 279 PHE 279 270 270 PHE PHE A . n A 1 280 ASN 280 271 271 ASN ASN A . n A 1 281 GLY 281 272 272 GLY GLY A . n A 1 282 SER 282 273 273 SER SER A . n A 1 283 ASN 283 274 274 ASN ASN A . n A 1 284 GLU 284 275 275 GLU GLU A . n A 1 285 TYR 285 276 276 TYR TYR A . n A 1 286 ASP 286 277 277 ASP ASP A . n A 1 287 ILE 287 278 278 ILE ILE A . n A 1 288 LEU 288 279 279 LEU LEU A . n A 1 289 LYS 289 280 280 LYS LYS A . n A 1 290 LYS 290 281 281 LYS LYS A . n A 1 291 VAL 291 282 282 VAL VAL A . n A 1 292 GLU 292 283 283 GLU GLU A . n A 1 293 ALA 293 284 284 ALA ALA A . n A 1 294 GLY 294 285 285 GLY GLY A . n A 1 295 LYS 295 286 286 LYS LYS A . n A 1 296 TYR 296 287 287 TYR TYR A . n A 1 297 THR 297 288 288 THR THR A . n A 1 298 PHE 298 289 289 PHE PHE A . n A 1 299 ASP 299 290 290 ASP ASP A . n A 1 300 LEU 300 291 291 LEU LEU A . n A 1 301 PRO 301 292 292 PRO PRO A . n A 1 302 GLN 302 293 293 GLN GLN A . n A 1 303 PHE 303 294 294 PHE PHE A . n A 1 304 LYS 304 295 295 LYS LYS A . n A 1 305 LYS 305 296 296 LYS LYS A . n A 1 306 ILE 306 297 297 ILE ILE A . n A 1 307 SER 307 298 298 SER SER A . n A 1 308 ASP 308 299 299 ASP ASP A . n A 1 309 LYS 309 300 300 LYS LYS A . n A 1 310 ALA 310 301 301 ALA ALA A . n A 1 311 LYS 311 302 302 LYS LYS A . n A 1 312 ASP 312 303 303 ASP ASP A . n A 1 313 LEU 313 304 304 LEU LEU A . n A 1 314 ILE 314 305 305 ILE ILE A . n A 1 315 LYS 315 306 306 LYS LYS A . n A 1 316 LYS 316 307 307 LYS LYS A . n A 1 317 MET 317 308 308 MET MET A . n A 1 318 LEU 318 309 309 LEU LEU A . n A 1 319 MET 319 310 310 MET MET A . n A 1 320 TYR 320 311 311 TYR TYR A . n A 1 321 THR 321 312 312 THR THR A . n A 1 322 SER 322 313 313 SER SER A . n A 1 323 ALA 323 314 314 ALA ALA A . n A 1 324 VAL 324 315 315 VAL VAL A . n A 1 325 ARG 325 316 316 ARG ARG A . n A 1 326 ILE 326 317 317 ILE ILE A . n A 1 327 SER 327 318 318 SER SER A . n A 1 328 ALA 328 319 319 ALA ALA A . n A 1 329 ARG 329 320 320 ARG ARG A . n A 1 330 ASP 330 321 321 ASP ASP A . n A 1 331 ALA 331 322 322 ALA ALA A . n A 1 332 LEU 332 323 323 LEU LEU A . n A 1 333 GLU 333 324 324 GLU GLU A . n A 1 334 HIS 334 325 325 HIS HIS A . n A 1 335 GLU 335 326 326 GLU GLU A . n A 1 336 TRP 336 327 327 TRP TRP A . n A 1 337 ILE 337 328 328 ILE ILE A . n A 1 338 LYS 338 329 329 LYS LYS A . n A 1 339 MET 339 330 330 MET MET A . n A 1 340 MET 340 331 331 MET MET A . n A 1 341 THR 341 332 332 THR THR A . n A 1 342 SER 342 333 333 SER SER A . n A 1 343 LYS 343 334 334 LYS LYS A . n A 1 344 ASP 344 335 ? ? ? A . n A 1 345 ASN 345 336 ? ? ? A . n A 1 346 LEU 346 337 ? ? ? A . n A 1 347 ASN 347 338 ? ? ? A . n A 1 348 ILE 348 339 ? ? ? A . n A 1 349 ASP 349 340 ? ? ? A . n A 1 350 ILE 350 341 ? ? ? A . n A 1 351 PRO 351 342 ? ? ? A . n A 1 352 SER 352 343 ? ? ? A . n A 1 353 LEU 353 344 344 LEU LEU A . n A 1 354 GLU 354 345 345 GLU GLU A . n A 1 355 LEU 355 346 346 LEU LEU A . n A 1 356 SER 356 347 347 SER SER A . n A 1 357 ILE 357 348 348 ILE ILE A . n A 1 358 ALA 358 349 349 ALA ALA A . n A 1 359 ASN 359 350 350 ASN ASN A . n A 1 360 ILE 360 351 351 ILE ILE A . n A 1 361 ARG 361 352 352 ARG ARG A . n A 1 362 GLN 362 353 353 GLN GLN A . n A 1 363 PHE 363 354 354 PHE PHE A . n A 1 364 GLN 364 355 355 GLN GLN A . n A 1 365 SER 365 356 356 SER SER A . n A 1 366 THR 366 357 357 THR THR A . n A 1 367 GLN 367 358 358 GLN GLN A . n A 1 368 LYS 368 359 359 LYS LYS A . n A 1 369 LEU 369 360 360 LEU LEU A . n A 1 370 ALA 370 361 361 ALA ALA A . n A 1 371 GLN 371 362 362 GLN GLN A . n A 1 372 ALA 372 363 363 ALA ALA A . n A 1 373 ALA 373 364 364 ALA ALA A . n A 1 374 LEU 374 365 365 LEU LEU A . n A 1 375 LEU 375 366 366 LEU LEU A . n A 1 376 TYR 376 367 367 TYR TYR A . n A 1 377 MET 377 368 368 MET MET A . n A 1 378 GLY 378 369 369 GLY GLY A . n A 1 379 SER 379 370 370 SER SER A . n A 1 380 LYS 380 371 371 LYS LYS A . n A 1 381 LEU 381 372 372 LEU LEU A . n A 1 382 THR 382 373 373 THR THR A . n A 1 383 THR 383 374 374 THR THR A . n A 1 384 ILE 384 375 375 ILE ILE A . n A 1 385 ASP 385 376 376 ASP ASP A . n A 1 386 GLU 386 377 377 GLU GLU A . n A 1 387 THR 387 378 378 THR THR A . n A 1 388 LYS 388 379 379 LYS LYS A . n A 1 389 GLU 389 380 380 GLU GLU A . n A 1 390 LEU 390 381 381 LEU LEU A . n A 1 391 THR 391 382 382 THR THR A . n A 1 392 LYS 392 383 383 LYS LYS A . n A 1 393 ILE 393 384 384 ILE ILE A . n A 1 394 PHE 394 385 385 PHE PHE A . n A 1 395 LYS 395 386 386 LYS LYS A . n A 1 396 LYS 396 387 387 LYS LYS A . n A 1 397 MET 397 388 388 MET MET A . n A 1 398 ASP 398 389 389 ASP ASP A . n A 1 399 LYS 399 390 390 LYS LYS A . n A 1 400 ASN 400 391 391 ASN ASN A . n A 1 401 GLY 401 392 392 GLY GLY A . n A 1 402 ASP 402 393 393 ASP ASP A . n A 1 403 GLY 403 394 394 GLY GLY A . n A 1 404 GLN 404 395 395 GLN GLN A . n A 1 405 LEU 405 396 396 LEU LEU A . n A 1 406 ASP 406 397 397 ASP ASP A . n A 1 407 ARG 407 398 398 ARG ARG A . n A 1 408 ASN 408 399 399 ASN ASN A . n A 1 409 GLU 409 400 400 GLU GLU A . n A 1 410 LEU 410 401 401 LEU LEU A . n A 1 411 ILE 411 402 402 ILE ILE A . n A 1 412 ILE 412 403 403 ILE ILE A . n A 1 413 GLY 413 404 404 GLY GLY A . n A 1 414 TYR 414 405 405 TYR TYR A . n A 1 415 LYS 415 406 406 LYS LYS A . n A 1 416 GLU 416 407 407 GLU GLU A . n A 1 417 LEU 417 408 408 LEU LEU A . n A 1 418 LEU 418 409 409 LEU LEU A . n A 1 419 LYS 419 410 410 LYS LYS A . n A 1 420 LEU 420 411 411 LEU LEU A . n A 1 421 LYS 421 412 412 LYS LYS A . n A 1 422 GLY 422 413 413 GLY GLY A . n A 1 423 GLU 423 414 414 GLU GLU A . n A 1 424 ASP 424 415 ? ? ? A . n A 1 425 THR 425 416 416 THR THR A . n A 1 426 SER 426 417 417 SER SER A . n A 1 427 ASP 427 418 418 ASP ASP A . n A 1 428 LEU 428 419 419 LEU LEU A . n A 1 429 ASP 429 420 420 ASP ASP A . n A 1 430 ASN 430 421 421 ASN ASN A . n A 1 431 ALA 431 422 422 ALA ALA A . n A 1 432 ALA 432 423 423 ALA ALA A . n A 1 433 ILE 433 424 424 ILE ILE A . n A 1 434 GLU 434 425 425 GLU GLU A . n A 1 435 TYR 435 426 426 TYR TYR A . n A 1 436 GLU 436 427 427 GLU GLU A . n A 1 437 VAL 437 428 428 VAL VAL A . n A 1 438 ASP 438 429 429 ASP ASP A . n A 1 439 GLN 439 430 430 GLN GLN A . n A 1 440 ILE 440 431 431 ILE ILE A . n A 1 441 LEU 441 432 432 LEU LEU A . n A 1 442 ASN 442 433 433 ASN ASN A . n A 1 443 SER 443 434 434 SER SER A . n A 1 444 ILE 444 435 435 ILE ILE A . n A 1 445 ASP 445 436 436 ASP ASP A . n A 1 446 LEU 446 437 437 LEU LEU A . n A 1 447 ASP 447 438 438 ASP ASP A . n A 1 448 GLN 448 439 439 GLN GLN A . n A 1 449 ASN 449 440 440 ASN ASN A . n A 1 450 GLY 450 441 441 GLY GLY A . n A 1 451 TYR 451 442 442 TYR TYR A . n A 1 452 ILE 452 443 443 ILE ILE A . n A 1 453 GLU 453 444 444 GLU GLU A . n A 1 454 TYR 454 445 445 TYR TYR A . n A 1 455 SER 455 446 446 SER SER A . n A 1 456 GLU 456 447 447 GLU GLU A . n A 1 457 PHE 457 448 448 PHE PHE A . n A 1 458 LEU 458 449 449 LEU LEU A . n A 1 459 THR 459 450 450 THR THR A . n A 1 460 VAL 460 451 451 VAL VAL A . n A 1 461 SER 461 452 452 SER SER A . n A 1 462 ILE 462 453 453 ILE ILE A . n A 1 463 ASP 463 454 454 ASP ASP A . n A 1 464 ARG 464 455 455 ARG ARG A . n A 1 465 LYS 465 456 456 LYS LYS A . n A 1 466 LEU 466 457 457 LEU LEU A . n A 1 467 LEU 467 458 458 LEU LEU A . n A 1 468 LEU 468 459 459 LEU LEU A . n A 1 469 SER 469 460 460 SER SER A . n A 1 470 THR 470 461 461 THR THR A . n A 1 471 GLU 471 462 462 GLU GLU A . n A 1 472 ARG 472 463 463 ARG ARG A . n A 1 473 LEU 473 464 464 LEU LEU A . n A 1 474 GLU 474 465 465 GLU GLU A . n A 1 475 LYS 475 466 466 LYS LYS A . n A 1 476 ALA 476 467 467 ALA ALA A . n A 1 477 PHE 477 468 468 PHE PHE A . n A 1 478 LYS 478 469 469 LYS LYS A . n A 1 479 LEU 479 470 470 LEU LEU A . n A 1 480 PHE 480 471 471 PHE PHE A . n A 1 481 ASP 481 472 472 ASP ASP A . n A 1 482 LYS 482 473 473 LYS LYS A . n A 1 483 ASP 483 474 474 ASP ASP A . n A 1 484 GLY 484 475 475 GLY GLY A . n A 1 485 SER 485 476 476 SER SER A . n A 1 486 GLY 486 477 477 GLY GLY A . n A 1 487 LYS 487 478 478 LYS LYS A . n A 1 488 ILE 488 479 479 ILE ILE A . n A 1 489 SER 489 480 480 SER SER A . n A 1 490 ALA 490 481 481 ALA ALA A . n A 1 491 ASN 491 482 482 ASN ASN A . n A 1 492 GLU 492 483 483 GLU GLU A . n A 1 493 LEU 493 484 484 LEU LEU A . n A 1 494 ALA 494 485 485 ALA ALA A . n A 1 495 GLN 495 486 486 GLN GLN A . n A 1 496 LEU 496 487 487 LEU LEU A . n A 1 497 PHE 497 488 488 PHE PHE A . n A 1 498 GLY 498 489 489 GLY GLY A . n A 1 499 LEU 499 490 490 LEU LEU A . n A 1 500 SER 500 491 491 SER SER A . n A 1 501 ASP 501 492 492 ASP ASP A . n A 1 502 VAL 502 493 493 VAL VAL A . n A 1 503 SER 503 494 494 SER SER A . n A 1 504 SER 504 495 495 SER SER A . n A 1 505 GLU 505 496 496 GLU GLU A . n A 1 506 CYS 506 497 497 CYS CYS A . n A 1 507 TRP 507 498 498 TRP TRP A . n A 1 508 LYS 508 499 499 LYS LYS A . n A 1 509 THR 509 500 500 THR THR A . n A 1 510 VAL 510 501 501 VAL VAL A . n A 1 511 LEU 511 502 502 LEU LEU A . n A 1 512 LYS 512 503 503 LYS LYS A . n A 1 513 GLU 513 504 504 GLU GLU A . n A 1 514 VAL 514 505 505 VAL VAL A . n A 1 515 ASP 515 506 506 ASP ASP A . n A 1 516 GLN 516 507 507 GLN GLN A . n A 1 517 ASN 517 508 508 ASN ASN A . n A 1 518 ASN 518 509 509 ASN ASN A . n A 1 519 ASP 519 510 510 ASP ASP A . n A 1 520 GLY 520 511 511 GLY GLY A . n A 1 521 GLU 521 512 512 GLU GLU A . n A 1 522 ILE 522 513 513 ILE ILE A . n A 1 523 ASP 523 514 514 ASP ASP A . n A 1 524 PHE 524 515 515 PHE PHE A . n A 1 525 LYS 525 516 516 LYS LYS A . n A 1 526 GLU 526 517 517 GLU GLU A . n A 1 527 PHE 527 518 518 PHE PHE A . n A 1 528 ARG 528 519 519 ARG ARG A . n A 1 529 ASP 529 520 520 ASP ASP A . n A 1 530 MET 530 521 521 MET MET A . n A 1 531 LEU 531 522 522 LEU LEU A . n A 1 532 VAL 532 523 523 VAL VAL A . n A 1 533 LYS 533 524 524 LYS LYS A . n A 1 534 LEU 534 525 525 LEU LEU A . n A 1 535 CYS 535 526 526 CYS CYS A . n A 1 536 ASN 536 527 527 ASN ASN A . n A 1 537 TYR 537 528 528 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 601 1 MG MG A . C 3 DXR 1 602 1 DXR DXR A . D 4 HOH 1 701 1 HOH HOH A . D 4 HOH 2 702 2 HOH HOH A . D 4 HOH 3 703 3 HOH HOH A . D 4 HOH 4 704 5 HOH HOH A . D 4 HOH 5 705 6 HOH HOH A . D 4 HOH 6 706 7 HOH HOH A . D 4 HOH 7 707 8 HOH HOH A . D 4 HOH 8 708 10 HOH HOH A . D 4 HOH 9 709 11 HOH HOH A . D 4 HOH 10 710 12 HOH HOH A . D 4 HOH 11 711 13 HOH HOH A . D 4 HOH 12 712 14 HOH HOH A . D 4 HOH 13 713 15 HOH HOH A . D 4 HOH 14 714 16 HOH HOH A . D 4 HOH 15 715 17 HOH HOH A . D 4 HOH 16 716 18 HOH HOH A . D 4 HOH 17 717 19 HOH HOH A . D 4 HOH 18 718 20 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 52 ? CE ? A LYS 61 CE 2 1 Y 1 A LYS 52 ? NZ ? A LYS 61 NZ 3 1 Y 1 A LEU 53 ? CG ? A LEU 62 CG 4 1 Y 1 A LEU 53 ? CD1 ? A LEU 62 CD1 5 1 Y 1 A LEU 53 ? CD2 ? A LEU 62 CD2 6 1 Y 1 A SER 62 ? OG ? A SER 71 OG 7 1 Y 1 A ASN 63 ? CG ? A ASN 72 CG 8 1 Y 1 A ASN 63 ? OD1 ? A ASN 72 OD1 9 1 Y 1 A ASN 63 ? ND2 ? A ASN 72 ND2 10 1 Y 1 A SER 80 ? OG ? A SER 89 OG 11 1 Y 1 A LYS 104 ? CG ? A LYS 113 CG 12 1 Y 1 A LYS 104 ? CD ? A LYS 113 CD 13 1 Y 1 A LYS 104 ? CE ? A LYS 113 CE 14 1 Y 1 A LYS 104 ? NZ ? A LYS 113 NZ 15 1 Y 1 A LYS 107 ? CG ? A LYS 116 CG 16 1 Y 1 A LYS 107 ? CD ? A LYS 116 CD 17 1 Y 1 A LYS 107 ? CE ? A LYS 116 CE 18 1 Y 1 A LYS 107 ? NZ ? A LYS 116 NZ 19 1 Y 1 A LYS 109 ? CD ? A LYS 118 CD 20 1 Y 1 A LYS 109 ? CE ? A LYS 118 CE 21 1 Y 1 A LYS 109 ? NZ ? A LYS 118 NZ 22 1 Y 1 A LYS 112 ? CG ? A LYS 121 CG 23 1 Y 1 A LYS 112 ? CD ? A LYS 121 CD 24 1 Y 1 A LYS 112 ? CE ? A LYS 121 CE 25 1 Y 1 A LYS 112 ? NZ ? A LYS 121 NZ 26 1 Y 1 A GLU 113 ? CG ? A GLU 122 CG 27 1 Y 1 A GLU 113 ? CD ? A GLU 122 CD 28 1 Y 1 A GLU 113 ? OE1 ? A GLU 122 OE1 29 1 Y 1 A GLU 113 ? OE2 ? A GLU 122 OE2 30 1 Y 1 A ASN 140 ? CG ? A ASN 149 CG 31 1 Y 1 A ASN 140 ? OD1 ? A ASN 149 OD1 32 1 Y 1 A ASN 140 ? ND2 ? A ASN 149 ND2 33 1 Y 1 A SER 147 ? OG ? A SER 156 OG 34 1 Y 1 A LYS 163 ? CG ? A LYS 172 CG 35 1 Y 1 A LYS 163 ? CD ? A LYS 172 CD 36 1 Y 1 A LYS 163 ? CE ? A LYS 172 CE 37 1 Y 1 A LYS 163 ? NZ ? A LYS 172 NZ 38 1 Y 1 A LYS 186 ? CE ? A LYS 195 CE 39 1 Y 1 A LYS 186 ? NZ ? A LYS 195 NZ 40 1 Y 1 A THR 203 ? OG1 ? A THR 212 OG1 41 1 Y 1 A THR 203 ? CG2 ? A THR 212 CG2 42 1 Y 1 A LYS 204 ? CG ? A LYS 213 CG 43 1 Y 1 A LYS 204 ? CD ? A LYS 213 CD 44 1 Y 1 A LYS 204 ? CE ? A LYS 213 CE 45 1 Y 1 A LYS 204 ? NZ ? A LYS 213 NZ 46 1 Y 1 A GLU 207 ? CG ? A GLU 216 CG 47 1 Y 1 A GLU 207 ? CD ? A GLU 216 CD 48 1 Y 1 A GLU 207 ? OE1 ? A GLU 216 OE1 49 1 Y 1 A GLU 207 ? OE2 ? A GLU 216 OE2 50 1 Y 1 A ASP 208 ? CG ? A ASP 217 CG 51 1 Y 1 A ASP 208 ? OD1 ? A ASP 217 OD1 52 1 Y 1 A ASP 208 ? OD2 ? A ASP 217 OD2 53 1 Y 1 A MET 209 ? CG ? A MET 218 CG 54 1 Y 1 A MET 209 ? SD ? A MET 218 SD 55 1 Y 1 A MET 209 ? CE ? A MET 218 CE 56 1 Y 1 A GLU 223 ? CG ? A GLU 232 CG 57 1 Y 1 A GLU 223 ? CD ? A GLU 232 CD 58 1 Y 1 A GLU 223 ? OE1 ? A GLU 232 OE1 59 1 Y 1 A GLU 223 ? OE2 ? A GLU 232 OE2 60 1 Y 1 A SER 225 ? OG ? A SER 234 OG 61 1 Y 1 A LYS 231 ? CG ? A LYS 240 CG 62 1 Y 1 A LYS 231 ? CD ? A LYS 240 CD 63 1 Y 1 A LYS 231 ? CE ? A LYS 240 CE 64 1 Y 1 A LYS 231 ? NZ ? A LYS 240 NZ 65 1 Y 1 A THR 246 ? OG1 ? A THR 255 OG1 66 1 Y 1 A THR 246 ? CG2 ? A THR 255 CG2 67 1 Y 1 A TYR 247 ? CG ? A TYR 256 CG 68 1 Y 1 A TYR 247 ? CD1 ? A TYR 256 CD1 69 1 Y 1 A TYR 247 ? CD2 ? A TYR 256 CD2 70 1 Y 1 A TYR 247 ? CE1 ? A TYR 256 CE1 71 1 Y 1 A TYR 247 ? CE2 ? A TYR 256 CE2 72 1 Y 1 A TYR 247 ? CZ ? A TYR 256 CZ 73 1 Y 1 A TYR 247 ? OH ? A TYR 256 OH 74 1 Y 1 A SER 273 ? OG ? A SER 282 OG 75 1 Y 1 A LYS 286 ? CG ? A LYS 295 CG 76 1 Y 1 A LYS 286 ? CD ? A LYS 295 CD 77 1 Y 1 A LYS 286 ? CE ? A LYS 295 CE 78 1 Y 1 A LYS 286 ? NZ ? A LYS 295 NZ 79 1 Y 1 A ASP 290 ? CG ? A ASP 299 CG 80 1 Y 1 A ASP 290 ? OD1 ? A ASP 299 OD1 81 1 Y 1 A ASP 290 ? OD2 ? A ASP 299 OD2 82 1 Y 1 A LYS 329 ? CE ? A LYS 338 CE 83 1 Y 1 A LYS 329 ? NZ ? A LYS 338 NZ 84 1 Y 1 A MET 330 ? CG ? A MET 339 CG 85 1 Y 1 A MET 330 ? SD ? A MET 339 SD 86 1 Y 1 A MET 330 ? CE ? A MET 339 CE 87 1 Y 1 A LYS 334 ? CG ? A LYS 343 CG 88 1 Y 1 A LYS 334 ? CD ? A LYS 343 CD 89 1 Y 1 A LYS 334 ? CE ? A LYS 343 CE 90 1 Y 1 A LYS 334 ? NZ ? A LYS 343 NZ 91 1 Y 1 A LEU 344 ? CG ? A LEU 353 CG 92 1 Y 1 A LEU 344 ? CD1 ? A LEU 353 CD1 93 1 Y 1 A LEU 344 ? CD2 ? A LEU 353 CD2 94 1 Y 1 A LYS 410 ? CE ? A LYS 419 CE 95 1 Y 1 A LYS 410 ? NZ ? A LYS 419 NZ 96 1 Y 1 A LYS 412 ? CG ? A LYS 421 CG 97 1 Y 1 A LYS 412 ? CD ? A LYS 421 CD 98 1 Y 1 A LYS 412 ? CE ? A LYS 421 CE 99 1 Y 1 A LYS 412 ? NZ ? A LYS 421 NZ 100 1 Y 1 A GLU 414 ? CG ? A GLU 423 CG 101 1 Y 1 A GLU 414 ? CD ? A GLU 423 CD 102 1 Y 1 A GLU 414 ? OE1 ? A GLU 423 OE1 103 1 Y 1 A GLU 414 ? OE2 ? A GLU 423 OE2 104 1 Y 1 A THR 416 ? OG1 ? A THR 425 OG1 105 1 Y 1 A THR 416 ? CG2 ? A THR 425 CG2 106 1 Y 1 A LYS 466 ? CG ? A LYS 475 CG 107 1 Y 1 A LYS 466 ? CD ? A LYS 475 CD 108 1 Y 1 A LYS 466 ? CE ? A LYS 475 CE 109 1 Y 1 A LYS 466 ? NZ ? A LYS 475 NZ 110 1 Y 1 A SER 476 ? OG ? A SER 485 OG 111 1 Y 1 A ASP 492 ? CG ? A ASP 501 CG 112 1 Y 1 A ASP 492 ? OD1 ? A ASP 501 OD1 113 1 Y 1 A ASP 492 ? OD2 ? A ASP 501 OD2 114 1 Y 1 A SER 494 ? OG ? A SER 503 OG 115 1 Y 1 A SER 495 ? OG ? A SER 504 OG 116 1 Y 1 A GLU 496 ? CG ? A GLU 505 CG 117 1 Y 1 A GLU 496 ? CD ? A GLU 505 CD 118 1 Y 1 A GLU 496 ? OE1 ? A GLU 505 OE1 119 1 Y 1 A GLU 496 ? OE2 ? A GLU 505 OE2 120 1 Y 1 A ASN 508 ? CG ? A ASN 517 CG 121 1 Y 1 A ASN 508 ? OD1 ? A ASN 517 OD1 122 1 Y 1 A ASN 508 ? ND2 ? A ASN 517 ND2 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 PHASER 2.5.6 'Tue May 20 11:52:06 2014' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 2 PHENIX 1.9_1692 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 3 PDB_EXTRACT 3.14 'Dec. 10, 2013' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 HKL-3000 . ? ? ? ? 'data collection' ? ? ? 5 DENZO . ? ? ? ? 'data reduction' ? ? ? 6 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 7 HKL-3000 . ? ? ? ? 'data scaling' ? ? ? # _cell.length_a 70.289 _cell.length_b 75.967 _cell.length_c 92.688 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4QOX _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 4QOX _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 4QOX _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 38.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details ;5% glycerol 1mM 3MBPP1 5 mM TCEP 28% PEG2000 MME 0.1 M BisTris pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2014-06-14 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength .97915 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 18-ID' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list .97915 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 18-ID # _reflns.entry_id 4QOX _reflns.d_resolution_high 2.750 _reflns.d_resolution_low 45.000 _reflns.number_obs 13454 _reflns.pdbx_Rmerge_I_obs 0.143 _reflns.pdbx_netI_over_sigmaI 5.300 _reflns.pdbx_chi_squared 0.973 _reflns.pdbx_redundancy 7.500 _reflns.percent_possible_obs 100.000 _reflns.B_iso_Wilson_estimate 55.870 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all 13464 _reflns.pdbx_Rsym_value ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.750 2.800 ? ? ? 0.902 2.86 ? 0.519 7.700 ? 674 100.000 1 1 2.800 2.850 ? ? ? 0.742 ? ? 0.553 7.700 ? 641 100.000 2 1 2.850 2.900 ? ? ? 0.633 ? ? 0.554 7.700 ? 672 100.000 3 1 2.900 2.960 ? ? ? 0.592 ? ? 0.621 7.700 ? 652 100.000 4 1 2.960 3.030 ? ? ? 0.518 ? ? 0.611 7.700 ? 667 100.000 5 1 3.030 3.100 ? ? ? 0.466 ? ? 0.609 7.600 ? 641 100.000 6 1 3.100 3.170 ? ? ? 0.384 ? ? 0.663 7.700 ? 666 100.000 7 1 3.170 3.260 ? ? ? 0.311 ? ? 0.745 7.700 ? 649 100.000 8 1 3.260 3.360 ? ? ? 0.281 ? ? 0.744 7.600 ? 684 100.000 9 1 3.360 3.460 ? ? ? 0.239 ? ? 0.868 7.600 ? 655 100.000 10 1 3.460 3.590 ? ? ? 0.180 ? ? 0.828 7.600 ? 656 100.000 11 1 3.590 3.730 ? ? ? 0.172 ? ? 1.035 7.600 ? 683 100.000 12 1 3.730 3.900 ? ? ? 0.136 ? ? 1.111 7.600 ? 666 100.000 13 1 3.900 4.110 ? ? ? 0.114 ? ? 1.134 7.600 ? 670 100.000 14 1 4.110 4.360 ? ? ? 0.097 ? ? 1.305 7.500 ? 664 100.000 15 1 4.360 4.700 ? ? ? 0.095 ? ? 1.503 7.400 ? 692 100.000 16 1 4.700 5.170 ? ? ? 0.097 ? ? 1.488 7.400 ? 675 100.000 17 1 5.170 5.920 ? ? ? 0.100 ? ? 1.201 7.200 ? 688 100.000 18 1 5.920 7.450 ? ? ? 0.079 ? ? 1.036 7.100 ? 701 100.000 19 1 7.450 45.000 ? ? ? 0.082 ? ? 2.431 6.500 ? 758 99.900 20 1 # _refine.entry_id 4QOX _refine.ls_d_res_high 2.7480 _refine.ls_d_res_low 39.5630 _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.7500 _refine.ls_number_reflns_obs 13411 _refine.ls_number_reflns_all 13444 _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details random _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2058 _refine.ls_R_factor_R_work 0.2025 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2655 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0300 _refine.ls_number_reflns_R_free 675 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 58.3087 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 139.800 _refine.B_iso_min 19.770 _refine.pdbx_overall_phase_error 26.7600 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3629 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 3670 _refine_hist.d_res_high 2.7480 _refine_hist.d_res_low 39.5630 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 3745 0.003 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 5054 0.596 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 569 0.020 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 635 0.003 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 1362 13.834 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 2.7484 2.9606 5 99.0000 2451 . 0.2422 0.3047 . 155 . 2606 . . 'X-RAY DIFFRACTION' 2.9606 3.2584 5 100.0000 2531 . 0.2409 0.3244 . 99 . 2630 . . 'X-RAY DIFFRACTION' 3.2584 3.7296 5 100.0000 2555 . 0.2126 0.2848 . 123 . 2678 . . 'X-RAY DIFFRACTION' 3.7296 4.6977 5 100.0000 2538 . 0.1708 0.2601 . 151 . 2689 . . 'X-RAY DIFFRACTION' 4.6977 39.5672 5 100.0000 2661 . 0.2015 0.2384 . 147 . 2808 . . 'X-RAY DIFFRACTION' # _struct.entry_id 4QOX _struct.title 'Crystal Structure of CDPK4 from Plasmodium Falciparum, PF3D7_0717500' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4QOX _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Structural Genomics, Structural Genomics Consortium, SGC, cdpk, plasmodium, malaria, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDPK4_PLAF7 _struct_ref.pdbx_db_accession Q8IBS5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NTKNEHHKTNKKSLKGGNERHEMKESSVGISKKIVENSFNNSKLRPGMFIQNSNVVFNEQYKGIKILGKGSFGEVILSRD KHTGHEYAIKVISKKHVKRKTDKESLLREVELLKMLDHINIMKLYEFFEDNNYYYLVSDVYTGGELFDEIISRKRFYEID AARIIKQILSGITYMHKNNVVHRDLKPENILLETKNKEDMIIKIIDFGLSTHFEYSKKMKDKIGTAYYIAPDVLHGTYDE KCDIWSCGVILYILLSGCPPFNGSNEYDILKKVEAGKYTFDLPQFKKISDKAKDLIKKMLMYTSAVRISARDALEHEWIK MMTSKDNLNIDIPSLELSIANIRQFQSTQKLAQAALLYMGSKLTTIDETKELTKIFKKMDKNGDGQLDRNELIIGYKELL KLKGEDTSDLDNAAIEYEVDQILNSIDLDQNGYIEYSEFLTVSIDRKLLLSTERLEKAFKLFDKDGSGKISANELAQLFG LSDVSSECWKTVLKEVDQNNDGEIDFKEFRDMLVKLCNY ; _struct_ref.pdbx_align_begin 10 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4QOX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 537 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IBS5 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 528 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 528 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4QOX MET A 1 ? UNP Q8IBS5 ? ? 'expression tag' -8 1 1 4QOX HIS A 2 ? UNP Q8IBS5 ? ? 'expression tag' -7 2 1 4QOX HIS A 3 ? UNP Q8IBS5 ? ? 'expression tag' -6 3 1 4QOX HIS A 4 ? UNP Q8IBS5 ? ? 'expression tag' -5 4 1 4QOX HIS A 5 ? UNP Q8IBS5 ? ? 'expression tag' -4 5 1 4QOX HIS A 6 ? UNP Q8IBS5 ? ? 'expression tag' -3 6 1 4QOX HIS A 7 ? UNP Q8IBS5 ? ? 'expression tag' -2 7 1 4QOX SER A 8 ? UNP Q8IBS5 ? ? 'expression tag' -1 8 1 4QOX SER A 9 ? UNP Q8IBS5 ? ? 'expression tag' 0 9 1 4QOX GLY A 10 ? UNP Q8IBS5 ? ? 'expression tag' 1 10 1 4QOX ARG A 11 ? UNP Q8IBS5 ? ? 'expression tag' 2 11 1 4QOX GLU A 12 ? UNP Q8IBS5 ? ? 'expression tag' 3 12 1 4QOX ASN A 13 ? UNP Q8IBS5 ? ? 'expression tag' 4 13 1 4QOX LEU A 14 ? UNP Q8IBS5 ? ? 'expression tag' 5 14 1 4QOX TYR A 15 ? UNP Q8IBS5 ? ? 'expression tag' 6 15 1 4QOX PHE A 16 ? UNP Q8IBS5 ? ? 'expression tag' 7 16 1 4QOX GLN A 17 ? UNP Q8IBS5 ? ? 'expression tag' 8 17 1 4QOX GLY A 18 ? UNP Q8IBS5 ? ? 'expression tag' 9 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 120 ? MET A 133 ? ASP A 111 MET A 124 1 ? 14 HELX_P HELX_P2 2 LEU A 164 ? ILE A 169 ? LEU A 155 ILE A 160 1 ? 6 HELX_P HELX_P3 3 GLU A 176 ? ASN A 196 ? GLU A 167 ASN A 187 1 ? 21 HELX_P HELX_P4 4 LYS A 204 ? GLU A 206 ? LYS A 195 GLU A 197 5 ? 3 HELX_P HELX_P5 5 ALA A 248 ? HIS A 253 ? ALA A 239 HIS A 244 1 ? 6 HELX_P HELX_P6 6 LYS A 259 ? GLY A 275 ? LYS A 250 GLY A 266 1 ? 17 HELX_P HELX_P7 7 ASN A 283 ? GLY A 294 ? ASN A 274 GLY A 285 1 ? 12 HELX_P HELX_P8 8 SER A 307 ? LEU A 318 ? SER A 298 LEU A 309 1 ? 12 HELX_P HELX_P9 9 SER A 327 ? GLU A 333 ? SER A 318 GLU A 324 1 ? 7 HELX_P HELX_P10 10 HIS A 334 ? THR A 341 ? HIS A 325 THR A 332 1 ? 8 HELX_P HELX_P11 11 SER A 356 ? LYS A 396 ? SER A 347 LYS A 387 1 ? 41 HELX_P HELX_P12 12 ARG A 407 ? LEU A 420 ? ARG A 398 LEU A 411 1 ? 14 HELX_P HELX_P13 13 SER A 426 ? ASN A 442 ? SER A 417 ASN A 433 1 ? 17 HELX_P HELX_P14 14 TYR A 454 ? ASP A 481 ? TYR A 445 ASP A 472 1 ? 28 HELX_P HELX_P15 15 SER A 489 ? SER A 500 ? SER A 480 SER A 491 1 ? 12 HELX_P HELX_P16 16 SER A 503 ? ASP A 515 ? SER A 494 ASP A 506 1 ? 13 HELX_P HELX_P17 17 ASP A 523 ? TYR A 537 ? ASP A 514 TYR A 528 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 398 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 389 A MG 601 1_555 ? ? ? ? ? ? ? 2.492 ? ? metalc2 metalc ? ? A ASN 400 OD1 ? ? ? 1_555 B MG . MG ? ? A ASN 391 A MG 601 1_555 ? ? ? ? ? ? ? 2.504 ? ? metalc3 metalc ? ? A ASP 402 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 393 A MG 601 1_555 ? ? ? ? ? ? ? 2.885 ? ? metalc4 metalc ? ? A GLN 404 O ? ? ? 1_555 B MG . MG ? ? A GLN 395 A MG 601 1_555 ? ? ? ? ? ? ? 2.698 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 601 A HOH 702 1_555 ? ? ? ? ? ? ? 2.789 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 398 ? A ASP 389 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASN 400 ? A ASN 391 ? 1_555 71.7 ? 2 OD1 ? A ASP 398 ? A ASP 389 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 402 ? A ASP 393 ? 1_555 65.2 ? 3 OD1 ? A ASN 400 ? A ASN 391 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 402 ? A ASP 393 ? 1_555 69.2 ? 4 OD1 ? A ASP 398 ? A ASP 389 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? A GLN 404 ? A GLN 395 ? 1_555 103.4 ? 5 OD1 ? A ASN 400 ? A ASN 391 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? A GLN 404 ? A GLN 395 ? 1_555 143.6 ? 6 OD1 ? A ASP 402 ? A ASP 393 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? A GLN 404 ? A GLN 395 ? 1_555 76.1 ? 7 OD1 ? A ASP 398 ? A ASP 389 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? D HOH . ? A HOH 702 ? 1_555 147.1 ? 8 OD1 ? A ASN 400 ? A ASN 391 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? D HOH . ? A HOH 702 ? 1_555 111.5 ? 9 OD1 ? A ASP 402 ? A ASP 393 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? D HOH . ? A HOH 702 ? 1_555 147.6 ? 10 O ? A GLN 404 ? A GLN 395 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? D HOH . ? A HOH 702 ? 1_555 92.1 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 3 ? D ? 2 ? E ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 74 ? PHE A 75 ? VAL A 65 PHE A 66 A 2 TYR A 79 ? GLY A 88 ? TYR A 70 GLY A 79 A 3 GLY A 91 ? ASP A 98 ? GLY A 82 ASP A 89 A 4 GLU A 104 ? SER A 111 ? GLU A 95 SER A 102 A 5 TYR A 151 ? SER A 156 ? TYR A 142 SER A 147 A 6 LEU A 142 ? GLU A 147 ? LEU A 133 GLU A 138 B 1 VAL A 115 ? ARG A 117 ? VAL A 106 ARG A 108 B 2 PHE A 231 ? TYR A 233 ? PHE A 222 TYR A 224 C 1 GLY A 162 ? GLU A 163 ? GLY A 153 GLU A 154 C 2 ILE A 208 ? LEU A 210 ? ILE A 199 LEU A 201 C 3 ILE A 220 ? ILE A 222 ? ILE A 211 ILE A 213 D 1 PHE A 174 ? TYR A 175 ? PHE A 165 TYR A 166 D 2 GLU A 354 ? LEU A 355 ? GLU A 345 LEU A 346 E 1 GLN A 404 ? ASP A 406 ? GLN A 395 ASP A 397 E 2 TYR A 451 ? GLU A 453 ? TYR A 442 GLU A 444 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 75 ? N PHE A 66 O TYR A 79 ? O TYR A 70 A 2 3 N LYS A 83 ? N LYS A 74 O LEU A 95 ? O LEU A 86 A 3 4 N GLU A 92 ? N GLU A 83 O VAL A 109 ? O VAL A 100 A 4 5 N ILE A 110 ? N ILE A 101 O TYR A 152 ? O TYR A 143 A 5 6 O VAL A 155 ? O VAL A 146 N TYR A 143 ? N TYR A 134 B 1 2 N LYS A 116 ? N LYS A 107 O GLU A 232 ? O GLU A 223 C 1 2 N GLY A 162 ? N GLY A 153 O LEU A 210 ? O LEU A 201 C 2 3 N LEU A 209 ? N LEU A 200 O LYS A 221 ? O LYS A 212 D 1 2 N PHE A 174 ? N PHE A 165 O LEU A 355 ? O LEU A 346 E 1 2 N LEU A 405 ? N LEU A 396 O ILE A 452 ? O ILE A 443 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 601 ? 5 'BINDING SITE FOR RESIDUE MG A 601' AC2 Software A DXR 602 ? 12 'BINDING SITE FOR RESIDUE DXR A 602' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 398 ? ASP A 389 . ? 1_555 ? 2 AC1 5 ASN A 400 ? ASN A 391 . ? 1_555 ? 3 AC1 5 ASP A 402 ? ASP A 393 . ? 1_555 ? 4 AC1 5 GLN A 404 ? GLN A 395 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 702 . ? 1_555 ? 6 AC2 12 LEU A 85 ? LEU A 76 . ? 1_555 ? 7 AC2 12 LYS A 87 ? LYS A 78 . ? 1_555 ? 8 AC2 12 VAL A 93 ? VAL A 84 . ? 1_555 ? 9 AC2 12 ALA A 106 ? ALA A 97 . ? 1_555 ? 10 AC2 12 LYS A 108 ? LYS A 99 . ? 1_555 ? 11 AC2 12 MET A 140 ? MET A 131 . ? 1_555 ? 12 AC2 12 LEU A 154 ? LEU A 145 . ? 1_555 ? 13 AC2 12 SER A 156 ? SER A 147 . ? 1_555 ? 14 AC2 12 ASP A 157 ? ASP A 148 . ? 1_555 ? 15 AC2 12 TYR A 159 ? TYR A 150 . ? 1_555 ? 16 AC2 12 ILE A 223 ? ILE A 214 . ? 1_555 ? 17 AC2 12 ASP A 224 ? ASP A 215 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 69 ? ? -148.82 -19.28 2 1 ILE A 73 ? ? -133.15 -55.18 3 1 PHE A 81 ? ? 68.26 -6.68 4 1 ASP A 139 ? ? -124.00 -142.95 5 1 ARG A 192 ? ? 65.24 -27.81 6 1 ASP A 208 ? ? -117.04 72.23 7 1 ASP A 248 ? ? -137.23 -159.21 8 1 LEU A 309 ? ? -99.48 31.03 9 1 ASP A 436 ? ? -65.88 94.25 10 1 SER A 480 ? ? -68.50 -177.96 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.750 _diffrn_reflns.pdbx_d_res_low 45.000 _diffrn_reflns.pdbx_number_obs 13454 _diffrn_reflns.pdbx_Rmerge_I_obs 0.143 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 0.97 _diffrn_reflns.pdbx_redundancy 7.50 _diffrn_reflns.pdbx_rejects ? _diffrn_reflns.pdbx_percent_possible_obs 100.00 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.number 100901 _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 7.45 45.00 ? ? 0.082 ? 2.431 6.50 ? 1 5.92 7.45 ? ? 0.079 ? 1.036 7.10 ? 1 5.17 5.92 ? ? 0.100 ? 1.201 7.20 ? 1 4.70 5.17 ? ? 0.097 ? 1.488 7.40 ? 1 4.36 4.70 ? ? 0.095 ? 1.503 7.40 ? 1 4.11 4.36 ? ? 0.097 ? 1.305 7.50 ? 1 3.90 4.11 ? ? 0.114 ? 1.134 7.60 ? 1 3.73 3.90 ? ? 0.136 ? 1.111 7.60 ? 1 3.59 3.73 ? ? 0.172 ? 1.035 7.60 ? 1 3.46 3.59 ? ? 0.180 ? 0.828 7.60 ? 1 3.36 3.46 ? ? 0.239 ? 0.868 7.60 ? 1 3.26 3.36 ? ? 0.281 ? 0.744 7.60 ? 1 3.17 3.26 ? ? 0.311 ? 0.745 7.70 ? 1 3.10 3.17 ? ? 0.384 ? 0.663 7.70 ? 1 3.03 3.10 ? ? 0.466 ? 0.609 7.60 ? 1 2.96 3.03 ? ? 0.518 ? 0.611 7.70 ? 1 2.90 2.96 ? ? 0.592 ? 0.621 7.70 ? 1 2.85 2.90 ? ? 0.633 ? 0.554 7.70 ? 1 2.80 2.85 ? ? 0.742 ? 0.553 7.70 ? 1 2.75 2.80 ? ? 0.902 ? 0.519 7.70 ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 27.3025 -10.8107 -0.8831 0.2490 0.3216 0.2765 -0.0088 0.0215 -0.0156 1.1787 3.4732 2.9724 -0.0411 1.3696 -2.2556 0.0315 -0.0263 -0.0255 -0.2453 -0.0681 -0.0649 0.3459 -0.1447 -0.0441 'X-RAY DIFFRACTION' 2 ? refined 43.3163 -1.0776 4.5655 0.3535 0.2722 0.3523 -0.0064 0.0478 -0.0338 1.4064 0.5122 1.2761 -0.2025 1.0181 -0.4865 -0.0474 -0.0181 0.0722 -0.0430 0.2011 -0.0483 0.0373 -0.0318 -0.0338 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 0 A 0 ;chain 'A' and (resid 51 through 248 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 0 A 0 ;chain 'A' and (resid 249 through 528 ) ; ? ? ? ? ? # _pdbx_phasing_MR.entry_id 4QOX _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.550 _pdbx_phasing_MR.d_res_low_rotation 39.560 _pdbx_phasing_MR.d_res_high_translation 5.550 _pdbx_phasing_MR.d_res_low_translation 39.560 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -8 ? A MET 1 2 1 Y 1 A HIS -7 ? A HIS 2 3 1 Y 1 A HIS -6 ? A HIS 3 4 1 Y 1 A HIS -5 ? A HIS 4 5 1 Y 1 A HIS -4 ? A HIS 5 6 1 Y 1 A HIS -3 ? A HIS 6 7 1 Y 1 A HIS -2 ? A HIS 7 8 1 Y 1 A SER -1 ? A SER 8 9 1 Y 1 A SER 0 ? A SER 9 10 1 Y 1 A GLY 1 ? A GLY 10 11 1 Y 1 A ARG 2 ? A ARG 11 12 1 Y 1 A GLU 3 ? A GLU 12 13 1 Y 1 A ASN 4 ? A ASN 13 14 1 Y 1 A LEU 5 ? A LEU 14 15 1 Y 1 A TYR 6 ? A TYR 15 16 1 Y 1 A PHE 7 ? A PHE 16 17 1 Y 1 A GLN 8 ? A GLN 17 18 1 Y 1 A GLY 9 ? A GLY 18 19 1 Y 1 A ASN 10 ? A ASN 19 20 1 Y 1 A THR 11 ? A THR 20 21 1 Y 1 A LYS 12 ? A LYS 21 22 1 Y 1 A ASN 13 ? A ASN 22 23 1 Y 1 A GLU 14 ? A GLU 23 24 1 Y 1 A HIS 15 ? A HIS 24 25 1 Y 1 A HIS 16 ? A HIS 25 26 1 Y 1 A LYS 17 ? A LYS 26 27 1 Y 1 A THR 18 ? A THR 27 28 1 Y 1 A ASN 19 ? A ASN 28 29 1 Y 1 A LYS 20 ? A LYS 29 30 1 Y 1 A LYS 21 ? A LYS 30 31 1 Y 1 A SER 22 ? A SER 31 32 1 Y 1 A LEU 23 ? A LEU 32 33 1 Y 1 A LYS 24 ? A LYS 33 34 1 Y 1 A GLY 25 ? A GLY 34 35 1 Y 1 A GLY 26 ? A GLY 35 36 1 Y 1 A ASN 27 ? A ASN 36 37 1 Y 1 A GLU 28 ? A GLU 37 38 1 Y 1 A ARG 29 ? A ARG 38 39 1 Y 1 A HIS 30 ? A HIS 39 40 1 Y 1 A GLU 31 ? A GLU 40 41 1 Y 1 A MET 32 ? A MET 41 42 1 Y 1 A LYS 33 ? A LYS 42 43 1 Y 1 A GLU 34 ? A GLU 43 44 1 Y 1 A SER 35 ? A SER 44 45 1 Y 1 A SER 36 ? A SER 45 46 1 Y 1 A VAL 37 ? A VAL 46 47 1 Y 1 A GLY 38 ? A GLY 47 48 1 Y 1 A ILE 39 ? A ILE 48 49 1 Y 1 A SER 40 ? A SER 49 50 1 Y 1 A LYS 41 ? A LYS 50 51 1 Y 1 A LYS 42 ? A LYS 51 52 1 Y 1 A ILE 43 ? A ILE 52 53 1 Y 1 A VAL 44 ? A VAL 53 54 1 Y 1 A GLU 45 ? A GLU 54 55 1 Y 1 A ASN 46 ? A ASN 55 56 1 Y 1 A SER 47 ? A SER 56 57 1 Y 1 A PHE 48 ? A PHE 57 58 1 Y 1 A ASN 49 ? A ASN 58 59 1 Y 1 A ASN 50 ? A ASN 59 60 1 Y 1 A LYS 206 ? A LYS 215 61 1 Y 1 A LYS 226 ? A LYS 235 62 1 Y 1 A LYS 227 ? A LYS 236 63 1 Y 1 A MET 228 ? A MET 237 64 1 Y 1 A LYS 229 ? A LYS 238 65 1 Y 1 A ASP 230 ? A ASP 239 66 1 Y 1 A ASP 335 ? A ASP 344 67 1 Y 1 A ASN 336 ? A ASN 345 68 1 Y 1 A LEU 337 ? A LEU 346 69 1 Y 1 A ASN 338 ? A ASN 347 70 1 Y 1 A ILE 339 ? A ILE 348 71 1 Y 1 A ASP 340 ? A ASP 349 72 1 Y 1 A ILE 341 ? A ILE 350 73 1 Y 1 A PRO 342 ? A PRO 351 74 1 Y 1 A SER 343 ? A SER 352 75 1 Y 1 A ASP 415 ? A ASP 424 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DXR N1 N Y N 88 DXR C2 C Y N 89 DXR N3 N Y N 90 DXR C4 C Y N 91 DXR C5 C Y N 92 DXR C6 C Y N 93 DXR NAG N N N 94 DXR CAH C Y N 95 DXR NAI N Y N 96 DXR NAJ N Y N 97 DXR CAK C N N 98 DXR CAL C N N 99 DXR CAM C N N 100 DXR CAN C N N 101 DXR CAO C N N 102 DXR CAP C Y N 103 DXR CAQ C Y N 104 DXR CAR C Y N 105 DXR CAS C Y N 106 DXR CAT C Y N 107 DXR CAU C Y N 108 DXR BRAV BR N N 109 DXR H2 H N N 110 DXR HNAG H N N 111 DXR HNAA H N N 112 DXR HAL H N N 113 DXR HALA H N N 114 DXR HALB H N N 115 DXR HAM H N N 116 DXR HAMA H N N 117 DXR HAMB H N N 118 DXR HAN H N N 119 DXR HANA H N N 120 DXR HANB H N N 121 DXR HAO H N N 122 DXR HAOA H N N 123 DXR HAQ H N N 124 DXR HAS H N N 125 DXR HAT H N N 126 DXR HAU H N N 127 GLN N N N N 128 GLN CA C N S 129 GLN C C N N 130 GLN O O N N 131 GLN CB C N N 132 GLN CG C N N 133 GLN CD C N N 134 GLN OE1 O N N 135 GLN NE2 N N N 136 GLN OXT O N N 137 GLN H H N N 138 GLN H2 H N N 139 GLN HA H N N 140 GLN HB2 H N N 141 GLN HB3 H N N 142 GLN HG2 H N N 143 GLN HG3 H N N 144 GLN HE21 H N N 145 GLN HE22 H N N 146 GLN HXT H N N 147 GLU N N N N 148 GLU CA C N S 149 GLU C C N N 150 GLU O O N N 151 GLU CB C N N 152 GLU CG C N N 153 GLU CD C N N 154 GLU OE1 O N N 155 GLU OE2 O N N 156 GLU OXT O N N 157 GLU H H N N 158 GLU H2 H N N 159 GLU HA H N N 160 GLU HB2 H N N 161 GLU HB3 H N N 162 GLU HG2 H N N 163 GLU HG3 H N N 164 GLU HE2 H N N 165 GLU HXT H N N 166 GLY N N N N 167 GLY CA C N N 168 GLY C C N N 169 GLY O O N N 170 GLY OXT O N N 171 GLY H H N N 172 GLY H2 H N N 173 GLY HA2 H N N 174 GLY HA3 H N N 175 GLY HXT H N N 176 HIS N N N N 177 HIS CA C N S 178 HIS C C N N 179 HIS O O N N 180 HIS CB C N N 181 HIS CG C Y N 182 HIS ND1 N Y N 183 HIS CD2 C Y N 184 HIS CE1 C Y N 185 HIS NE2 N Y N 186 HIS OXT O N N 187 HIS H H N N 188 HIS H2 H N N 189 HIS HA H N N 190 HIS HB2 H N N 191 HIS HB3 H N N 192 HIS HD1 H N N 193 HIS HD2 H N N 194 HIS HE1 H N N 195 HIS HE2 H N N 196 HIS HXT H N N 197 HOH O O N N 198 HOH H1 H N N 199 HOH H2 H N N 200 ILE N N N N 201 ILE CA C N S 202 ILE C C N N 203 ILE O O N N 204 ILE CB C N S 205 ILE CG1 C N N 206 ILE CG2 C N N 207 ILE CD1 C N N 208 ILE OXT O N N 209 ILE H H N N 210 ILE H2 H N N 211 ILE HA H N N 212 ILE HB H N N 213 ILE HG12 H N N 214 ILE HG13 H N N 215 ILE HG21 H N N 216 ILE HG22 H N N 217 ILE HG23 H N N 218 ILE HD11 H N N 219 ILE HD12 H N N 220 ILE HD13 H N N 221 ILE HXT H N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 MG MG MG N N 290 PHE N N N N 291 PHE CA C N S 292 PHE C C N N 293 PHE O O N N 294 PHE CB C N N 295 PHE CG C Y N 296 PHE CD1 C Y N 297 PHE CD2 C Y N 298 PHE CE1 C Y N 299 PHE CE2 C Y N 300 PHE CZ C Y N 301 PHE OXT O N N 302 PHE H H N N 303 PHE H2 H N N 304 PHE HA H N N 305 PHE HB2 H N N 306 PHE HB3 H N N 307 PHE HD1 H N N 308 PHE HD2 H N N 309 PHE HE1 H N N 310 PHE HE2 H N N 311 PHE HZ H N N 312 PHE HXT H N N 313 PRO N N N N 314 PRO CA C N S 315 PRO C C N N 316 PRO O O N N 317 PRO CB C N N 318 PRO CG C N N 319 PRO CD C N N 320 PRO OXT O N N 321 PRO H H N N 322 PRO HA H N N 323 PRO HB2 H N N 324 PRO HB3 H N N 325 PRO HG2 H N N 326 PRO HG3 H N N 327 PRO HD2 H N N 328 PRO HD3 H N N 329 PRO HXT H N N 330 SER N N N N 331 SER CA C N S 332 SER C C N N 333 SER O O N N 334 SER CB C N N 335 SER OG O N N 336 SER OXT O N N 337 SER H H N N 338 SER H2 H N N 339 SER HA H N N 340 SER HB2 H N N 341 SER HB3 H N N 342 SER HG H N N 343 SER HXT H N N 344 THR N N N N 345 THR CA C N S 346 THR C C N N 347 THR O O N N 348 THR CB C N R 349 THR OG1 O N N 350 THR CG2 C N N 351 THR OXT O N N 352 THR H H N N 353 THR H2 H N N 354 THR HA H N N 355 THR HB H N N 356 THR HG1 H N N 357 THR HG21 H N N 358 THR HG22 H N N 359 THR HG23 H N N 360 THR HXT H N N 361 TRP N N N N 362 TRP CA C N S 363 TRP C C N N 364 TRP O O N N 365 TRP CB C N N 366 TRP CG C Y N 367 TRP CD1 C Y N 368 TRP CD2 C Y N 369 TRP NE1 N Y N 370 TRP CE2 C Y N 371 TRP CE3 C Y N 372 TRP CZ2 C Y N 373 TRP CZ3 C Y N 374 TRP CH2 C Y N 375 TRP OXT O N N 376 TRP H H N N 377 TRP H2 H N N 378 TRP HA H N N 379 TRP HB2 H N N 380 TRP HB3 H N N 381 TRP HD1 H N N 382 TRP HE1 H N N 383 TRP HE3 H N N 384 TRP HZ2 H N N 385 TRP HZ3 H N N 386 TRP HH2 H N N 387 TRP HXT H N N 388 TYR N N N N 389 TYR CA C N S 390 TYR C C N N 391 TYR O O N N 392 TYR CB C N N 393 TYR CG C Y N 394 TYR CD1 C Y N 395 TYR CD2 C Y N 396 TYR CE1 C Y N 397 TYR CE2 C Y N 398 TYR CZ C Y N 399 TYR OH O N N 400 TYR OXT O N N 401 TYR H H N N 402 TYR H2 H N N 403 TYR HA H N N 404 TYR HB2 H N N 405 TYR HB3 H N N 406 TYR HD1 H N N 407 TYR HD2 H N N 408 TYR HE1 H N N 409 TYR HE2 H N N 410 TYR HH H N N 411 TYR HXT H N N 412 VAL N N N N 413 VAL CA C N S 414 VAL C C N N 415 VAL O O N N 416 VAL CB C N N 417 VAL CG1 C N N 418 VAL CG2 C N N 419 VAL OXT O N N 420 VAL H H N N 421 VAL H2 H N N 422 VAL HA H N N 423 VAL HB H N N 424 VAL HG11 H N N 425 VAL HG12 H N N 426 VAL HG13 H N N 427 VAL HG21 H N N 428 VAL HG22 H N N 429 VAL HG23 H N N 430 VAL HXT H N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DXR C2 N1 doub Y N 83 DXR N1 C6 sing Y N 84 DXR N3 C2 sing Y N 85 DXR C2 H2 sing N N 86 DXR N3 C4 doub Y N 87 DXR NAG C4 sing N N 88 DXR C4 C5 sing Y N 89 DXR C5 C6 doub Y N 90 DXR C5 CAH sing Y N 91 DXR C6 NAJ sing Y N 92 DXR NAG HNAG sing N N 93 DXR NAG HNAA sing N N 94 DXR CAO CAH sing N N 95 DXR CAH NAI doub Y N 96 DXR NAJ NAI sing Y N 97 DXR NAJ CAK sing N N 98 DXR CAM CAK sing N N 99 DXR CAK CAL sing N N 100 DXR CAK CAN sing N N 101 DXR CAL HAL sing N N 102 DXR CAL HALA sing N N 103 DXR CAL HALB sing N N 104 DXR CAM HAM sing N N 105 DXR CAM HAMA sing N N 106 DXR CAM HAMB sing N N 107 DXR CAN HAN sing N N 108 DXR CAN HANA sing N N 109 DXR CAN HANB sing N N 110 DXR CAP CAO sing N N 111 DXR CAO HAO sing N N 112 DXR CAO HAOA sing N N 113 DXR CAU CAP doub Y N 114 DXR CAP CAQ sing Y N 115 DXR CAR CAQ doub Y N 116 DXR CAQ HAQ sing N N 117 DXR CAS CAR sing Y N 118 DXR CAR BRAV sing N N 119 DXR CAT CAS doub Y N 120 DXR CAS HAS sing N N 121 DXR CAT CAU sing Y N 122 DXR CAT HAT sing N N 123 DXR CAU HAU sing N N 124 GLN N CA sing N N 125 GLN N H sing N N 126 GLN N H2 sing N N 127 GLN CA C sing N N 128 GLN CA CB sing N N 129 GLN CA HA sing N N 130 GLN C O doub N N 131 GLN C OXT sing N N 132 GLN CB CG sing N N 133 GLN CB HB2 sing N N 134 GLN CB HB3 sing N N 135 GLN CG CD sing N N 136 GLN CG HG2 sing N N 137 GLN CG HG3 sing N N 138 GLN CD OE1 doub N N 139 GLN CD NE2 sing N N 140 GLN NE2 HE21 sing N N 141 GLN NE2 HE22 sing N N 142 GLN OXT HXT sing N N 143 GLU N CA sing N N 144 GLU N H sing N N 145 GLU N H2 sing N N 146 GLU CA C sing N N 147 GLU CA CB sing N N 148 GLU CA HA sing N N 149 GLU C O doub N N 150 GLU C OXT sing N N 151 GLU CB CG sing N N 152 GLU CB HB2 sing N N 153 GLU CB HB3 sing N N 154 GLU CG CD sing N N 155 GLU CG HG2 sing N N 156 GLU CG HG3 sing N N 157 GLU CD OE1 doub N N 158 GLU CD OE2 sing N N 159 GLU OE2 HE2 sing N N 160 GLU OXT HXT sing N N 161 GLY N CA sing N N 162 GLY N H sing N N 163 GLY N H2 sing N N 164 GLY CA C sing N N 165 GLY CA HA2 sing N N 166 GLY CA HA3 sing N N 167 GLY C O doub N N 168 GLY C OXT sing N N 169 GLY OXT HXT sing N N 170 HIS N CA sing N N 171 HIS N H sing N N 172 HIS N H2 sing N N 173 HIS CA C sing N N 174 HIS CA CB sing N N 175 HIS CA HA sing N N 176 HIS C O doub N N 177 HIS C OXT sing N N 178 HIS CB CG sing N N 179 HIS CB HB2 sing N N 180 HIS CB HB3 sing N N 181 HIS CG ND1 sing Y N 182 HIS CG CD2 doub Y N 183 HIS ND1 CE1 doub Y N 184 HIS ND1 HD1 sing N N 185 HIS CD2 NE2 sing Y N 186 HIS CD2 HD2 sing N N 187 HIS CE1 NE2 sing Y N 188 HIS CE1 HE1 sing N N 189 HIS NE2 HE2 sing N N 190 HIS OXT HXT sing N N 191 HOH O H1 sing N N 192 HOH O H2 sing N N 193 ILE N CA sing N N 194 ILE N H sing N N 195 ILE N H2 sing N N 196 ILE CA C sing N N 197 ILE CA CB sing N N 198 ILE CA HA sing N N 199 ILE C O doub N N 200 ILE C OXT sing N N 201 ILE CB CG1 sing N N 202 ILE CB CG2 sing N N 203 ILE CB HB sing N N 204 ILE CG1 CD1 sing N N 205 ILE CG1 HG12 sing N N 206 ILE CG1 HG13 sing N N 207 ILE CG2 HG21 sing N N 208 ILE CG2 HG22 sing N N 209 ILE CG2 HG23 sing N N 210 ILE CD1 HD11 sing N N 211 ILE CD1 HD12 sing N N 212 ILE CD1 HD13 sing N N 213 ILE OXT HXT sing N N 214 LEU N CA sing N N 215 LEU N H sing N N 216 LEU N H2 sing N N 217 LEU CA C sing N N 218 LEU CA CB sing N N 219 LEU CA HA sing N N 220 LEU C O doub N N 221 LEU C OXT sing N N 222 LEU CB CG sing N N 223 LEU CB HB2 sing N N 224 LEU CB HB3 sing N N 225 LEU CG CD1 sing N N 226 LEU CG CD2 sing N N 227 LEU CG HG sing N N 228 LEU CD1 HD11 sing N N 229 LEU CD1 HD12 sing N N 230 LEU CD1 HD13 sing N N 231 LEU CD2 HD21 sing N N 232 LEU CD2 HD22 sing N N 233 LEU CD2 HD23 sing N N 234 LEU OXT HXT sing N N 235 LYS N CA sing N N 236 LYS N H sing N N 237 LYS N H2 sing N N 238 LYS CA C sing N N 239 LYS CA CB sing N N 240 LYS CA HA sing N N 241 LYS C O doub N N 242 LYS C OXT sing N N 243 LYS CB CG sing N N 244 LYS CB HB2 sing N N 245 LYS CB HB3 sing N N 246 LYS CG CD sing N N 247 LYS CG HG2 sing N N 248 LYS CG HG3 sing N N 249 LYS CD CE sing N N 250 LYS CD HD2 sing N N 251 LYS CD HD3 sing N N 252 LYS CE NZ sing N N 253 LYS CE HE2 sing N N 254 LYS CE HE3 sing N N 255 LYS NZ HZ1 sing N N 256 LYS NZ HZ2 sing N N 257 LYS NZ HZ3 sing N N 258 LYS OXT HXT sing N N 259 MET N CA sing N N 260 MET N H sing N N 261 MET N H2 sing N N 262 MET CA C sing N N 263 MET CA CB sing N N 264 MET CA HA sing N N 265 MET C O doub N N 266 MET C OXT sing N N 267 MET CB CG sing N N 268 MET CB HB2 sing N N 269 MET CB HB3 sing N N 270 MET CG SD sing N N 271 MET CG HG2 sing N N 272 MET CG HG3 sing N N 273 MET SD CE sing N N 274 MET CE HE1 sing N N 275 MET CE HE2 sing N N 276 MET CE HE3 sing N N 277 MET OXT HXT sing N N 278 PHE N CA sing N N 279 PHE N H sing N N 280 PHE N H2 sing N N 281 PHE CA C sing N N 282 PHE CA CB sing N N 283 PHE CA HA sing N N 284 PHE C O doub N N 285 PHE C OXT sing N N 286 PHE CB CG sing N N 287 PHE CB HB2 sing N N 288 PHE CB HB3 sing N N 289 PHE CG CD1 doub Y N 290 PHE CG CD2 sing Y N 291 PHE CD1 CE1 sing Y N 292 PHE CD1 HD1 sing N N 293 PHE CD2 CE2 doub Y N 294 PHE CD2 HD2 sing N N 295 PHE CE1 CZ doub Y N 296 PHE CE1 HE1 sing N N 297 PHE CE2 CZ sing Y N 298 PHE CE2 HE2 sing N N 299 PHE CZ HZ sing N N 300 PHE OXT HXT sing N N 301 PRO N CA sing N N 302 PRO N CD sing N N 303 PRO N H sing N N 304 PRO CA C sing N N 305 PRO CA CB sing N N 306 PRO CA HA sing N N 307 PRO C O doub N N 308 PRO C OXT sing N N 309 PRO CB CG sing N N 310 PRO CB HB2 sing N N 311 PRO CB HB3 sing N N 312 PRO CG CD sing N N 313 PRO CG HG2 sing N N 314 PRO CG HG3 sing N N 315 PRO CD HD2 sing N N 316 PRO CD HD3 sing N N 317 PRO OXT HXT sing N N 318 SER N CA sing N N 319 SER N H sing N N 320 SER N H2 sing N N 321 SER CA C sing N N 322 SER CA CB sing N N 323 SER CA HA sing N N 324 SER C O doub N N 325 SER C OXT sing N N 326 SER CB OG sing N N 327 SER CB HB2 sing N N 328 SER CB HB3 sing N N 329 SER OG HG sing N N 330 SER OXT HXT sing N N 331 THR N CA sing N N 332 THR N H sing N N 333 THR N H2 sing N N 334 THR CA C sing N N 335 THR CA CB sing N N 336 THR CA HA sing N N 337 THR C O doub N N 338 THR C OXT sing N N 339 THR CB OG1 sing N N 340 THR CB CG2 sing N N 341 THR CB HB sing N N 342 THR OG1 HG1 sing N N 343 THR CG2 HG21 sing N N 344 THR CG2 HG22 sing N N 345 THR CG2 HG23 sing N N 346 THR OXT HXT sing N N 347 TRP N CA sing N N 348 TRP N H sing N N 349 TRP N H2 sing N N 350 TRP CA C sing N N 351 TRP CA CB sing N N 352 TRP CA HA sing N N 353 TRP C O doub N N 354 TRP C OXT sing N N 355 TRP CB CG sing N N 356 TRP CB HB2 sing N N 357 TRP CB HB3 sing N N 358 TRP CG CD1 doub Y N 359 TRP CG CD2 sing Y N 360 TRP CD1 NE1 sing Y N 361 TRP CD1 HD1 sing N N 362 TRP CD2 CE2 doub Y N 363 TRP CD2 CE3 sing Y N 364 TRP NE1 CE2 sing Y N 365 TRP NE1 HE1 sing N N 366 TRP CE2 CZ2 sing Y N 367 TRP CE3 CZ3 doub Y N 368 TRP CE3 HE3 sing N N 369 TRP CZ2 CH2 doub Y N 370 TRP CZ2 HZ2 sing N N 371 TRP CZ3 CH2 sing Y N 372 TRP CZ3 HZ3 sing N N 373 TRP CH2 HH2 sing N N 374 TRP OXT HXT sing N N 375 TYR N CA sing N N 376 TYR N H sing N N 377 TYR N H2 sing N N 378 TYR CA C sing N N 379 TYR CA CB sing N N 380 TYR CA HA sing N N 381 TYR C O doub N N 382 TYR C OXT sing N N 383 TYR CB CG sing N N 384 TYR CB HB2 sing N N 385 TYR CB HB3 sing N N 386 TYR CG CD1 doub Y N 387 TYR CG CD2 sing Y N 388 TYR CD1 CE1 sing Y N 389 TYR CD1 HD1 sing N N 390 TYR CD2 CE2 doub Y N 391 TYR CD2 HD2 sing N N 392 TYR CE1 CZ doub Y N 393 TYR CE1 HE1 sing N N 394 TYR CE2 CZ sing Y N 395 TYR CE2 HE2 sing N N 396 TYR CZ OH sing N N 397 TYR OH HH sing N N 398 TYR OXT HXT sing N N 399 VAL N CA sing N N 400 VAL N H sing N N 401 VAL N H2 sing N N 402 VAL CA C sing N N 403 VAL CA CB sing N N 404 VAL CA HA sing N N 405 VAL C O doub N N 406 VAL C OXT sing N N 407 VAL CB CG1 sing N N 408 VAL CB CG2 sing N N 409 VAL CB HB sing N N 410 VAL CG1 HG11 sing N N 411 VAL CG1 HG12 sing N N 412 VAL CG1 HG13 sing N N 413 VAL CG2 HG21 sing N N 414 VAL CG2 HG22 sing N N 415 VAL CG2 HG23 sing N N 416 VAL OXT HXT sing N N 417 # _atom_sites.entry_id 4QOX _atom_sites.fract_transf_matrix[1][1] 0.014227 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013164 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010789 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol BR C MG N O S # loop_