data_4QQ5 # _entry.id 4QQ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4QQ5 RCSB RCSB086372 WWPDB D_1000086372 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4QQC . unspecified PDB 4QQJ . unspecified PDB 4QQT . unspecified PDB 4QRC . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4QQ5 _pdbx_database_status.recvd_initial_deposition_date 2014-06-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, Z.' 1 'Mohammadi, M.' 2 # _citation.id primary _citation.title 'DFG-out Mode of Inhibition by an Irreversible Type-1 Inhibitor Capable of Overcoming Gate-Keeper Mutations in FGF Receptors.' _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_volume 10 _citation.page_first 299 _citation.page_last 309 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1554-8929 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25317566 _citation.pdbx_database_id_DOI 10.1021/cb500674s # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Huang, Z.' 1 primary 'Tan, L.' 2 primary 'Wang, H.' 3 primary 'Liu, Y.' 4 primary 'Blais, S.' 5 primary 'Deng, J.' 6 primary 'Neubert, T.A.' 7 primary 'Gray, N.S.' 8 primary 'Li, X.' 9 primary 'Mohammadi, M.' 10 # _cell.entry_id 4QQ5 _cell.length_a 139.599 _cell.length_b 139.599 _cell.length_c 49.660 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 9 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4QQ5 _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fibroblast growth factor receptor 4' 36173.598 1 2.7.10.1 'R669E, V550L' 'Kinase domain of FGF Receptor 4' ? 2 non-polymer syn ;N-(4-{[3-(3,5-dimethoxyphenyl)-7-{[4-(4-methylpiperazin-1-yl)phenyl]amino}-2-oxo-3,4-dihydropyrimido[4,5-d]pyrimidin-1(2H)-yl]methyl}phenyl)propanamide ; 636.743 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name FGFR-4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSQDPLLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNAS DKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVILECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLV SCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDEVYTHQS DVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAV SEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSQDPLLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNAS DKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVILECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLV SCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDEVYTHQS DVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAV SEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLN n 1 13 ASP n 1 14 PRO n 1 15 LEU n 1 16 LEU n 1 17 ALA n 1 18 GLY n 1 19 LEU n 1 20 VAL n 1 21 SER n 1 22 LEU n 1 23 ASP n 1 24 LEU n 1 25 PRO n 1 26 LEU n 1 27 ASP n 1 28 PRO n 1 29 LEU n 1 30 TRP n 1 31 GLU n 1 32 PHE n 1 33 PRO n 1 34 ARG n 1 35 ASP n 1 36 ARG n 1 37 LEU n 1 38 VAL n 1 39 LEU n 1 40 GLY n 1 41 LYS n 1 42 PRO n 1 43 LEU n 1 44 GLY n 1 45 GLU n 1 46 GLY n 1 47 CYS n 1 48 PHE n 1 49 GLY n 1 50 GLN n 1 51 VAL n 1 52 VAL n 1 53 ARG n 1 54 ALA n 1 55 GLU n 1 56 ALA n 1 57 PHE n 1 58 GLY n 1 59 MET n 1 60 ASP n 1 61 PRO n 1 62 ALA n 1 63 ARG n 1 64 PRO n 1 65 ASP n 1 66 GLN n 1 67 ALA n 1 68 SER n 1 69 THR n 1 70 VAL n 1 71 ALA n 1 72 VAL n 1 73 LYS n 1 74 MET n 1 75 LEU n 1 76 LYS n 1 77 ASP n 1 78 ASN n 1 79 ALA n 1 80 SER n 1 81 ASP n 1 82 LYS n 1 83 ASP n 1 84 LEU n 1 85 ALA n 1 86 ASP n 1 87 LEU n 1 88 VAL n 1 89 SER n 1 90 GLU n 1 91 MET n 1 92 GLU n 1 93 VAL n 1 94 MET n 1 95 LYS n 1 96 LEU n 1 97 ILE n 1 98 GLY n 1 99 ARG n 1 100 HIS n 1 101 LYS n 1 102 ASN n 1 103 ILE n 1 104 ILE n 1 105 ASN n 1 106 LEU n 1 107 LEU n 1 108 GLY n 1 109 VAL n 1 110 CYS n 1 111 THR n 1 112 GLN n 1 113 GLU n 1 114 GLY n 1 115 PRO n 1 116 LEU n 1 117 TYR n 1 118 VAL n 1 119 ILE n 1 120 LEU n 1 121 GLU n 1 122 CYS n 1 123 ALA n 1 124 ALA n 1 125 LYS n 1 126 GLY n 1 127 ASN n 1 128 LEU n 1 129 ARG n 1 130 GLU n 1 131 PHE n 1 132 LEU n 1 133 ARG n 1 134 ALA n 1 135 ARG n 1 136 ARG n 1 137 PRO n 1 138 PRO n 1 139 GLY n 1 140 PRO n 1 141 ASP n 1 142 LEU n 1 143 SER n 1 144 PRO n 1 145 ASP n 1 146 GLY n 1 147 PRO n 1 148 ARG n 1 149 SER n 1 150 SER n 1 151 GLU n 1 152 GLY n 1 153 PRO n 1 154 LEU n 1 155 SER n 1 156 PHE n 1 157 PRO n 1 158 VAL n 1 159 LEU n 1 160 VAL n 1 161 SER n 1 162 CYS n 1 163 ALA n 1 164 TYR n 1 165 GLN n 1 166 VAL n 1 167 ALA n 1 168 ARG n 1 169 GLY n 1 170 MET n 1 171 GLN n 1 172 TYR n 1 173 LEU n 1 174 GLU n 1 175 SER n 1 176 ARG n 1 177 LYS n 1 178 CYS n 1 179 ILE n 1 180 HIS n 1 181 ARG n 1 182 ASP n 1 183 LEU n 1 184 ALA n 1 185 ALA n 1 186 ARG n 1 187 ASN n 1 188 VAL n 1 189 LEU n 1 190 VAL n 1 191 THR n 1 192 GLU n 1 193 ASP n 1 194 ASN n 1 195 VAL n 1 196 MET n 1 197 LYS n 1 198 ILE n 1 199 ALA n 1 200 ASP n 1 201 PHE n 1 202 GLY n 1 203 LEU n 1 204 ALA n 1 205 ARG n 1 206 GLY n 1 207 VAL n 1 208 HIS n 1 209 HIS n 1 210 ILE n 1 211 ASP n 1 212 TYR n 1 213 TYR n 1 214 LYS n 1 215 LYS n 1 216 THR n 1 217 SER n 1 218 ASN n 1 219 GLY n 1 220 ARG n 1 221 LEU n 1 222 PRO n 1 223 VAL n 1 224 LYS n 1 225 TRP n 1 226 MET n 1 227 ALA n 1 228 PRO n 1 229 GLU n 1 230 ALA n 1 231 LEU n 1 232 PHE n 1 233 ASP n 1 234 GLU n 1 235 VAL n 1 236 TYR n 1 237 THR n 1 238 HIS n 1 239 GLN n 1 240 SER n 1 241 ASP n 1 242 VAL n 1 243 TRP n 1 244 SER n 1 245 PHE n 1 246 GLY n 1 247 ILE n 1 248 LEU n 1 249 LEU n 1 250 TRP n 1 251 GLU n 1 252 ILE n 1 253 PHE n 1 254 THR n 1 255 LEU n 1 256 GLY n 1 257 GLY n 1 258 SER n 1 259 PRO n 1 260 TYR n 1 261 PRO n 1 262 GLY n 1 263 ILE n 1 264 PRO n 1 265 VAL n 1 266 GLU n 1 267 GLU n 1 268 LEU n 1 269 PHE n 1 270 SER n 1 271 LEU n 1 272 LEU n 1 273 ARG n 1 274 GLU n 1 275 GLY n 1 276 HIS n 1 277 ARG n 1 278 MET n 1 279 ASP n 1 280 ARG n 1 281 PRO n 1 282 PRO n 1 283 HIS n 1 284 CYS n 1 285 PRO n 1 286 PRO n 1 287 GLU n 1 288 LEU n 1 289 TYR n 1 290 GLY n 1 291 LEU n 1 292 MET n 1 293 ARG n 1 294 GLU n 1 295 CYS n 1 296 TRP n 1 297 HIS n 1 298 ALA n 1 299 ALA n 1 300 PRO n 1 301 SER n 1 302 GLN n 1 303 ARG n 1 304 PRO n 1 305 THR n 1 306 PHE n 1 307 LYS n 1 308 GLN n 1 309 LEU n 1 310 VAL n 1 311 GLU n 1 312 ALA n 1 313 LEU n 1 314 ASP n 1 315 LYS n 1 316 VAL n 1 317 LEU n 1 318 LEU n 1 319 ALA n 1 320 VAL n 1 321 SER n 1 322 GLU n 1 323 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FGFR4, JTK2, TKF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FGFR4_HUMAN _struct_ref.pdbx_db_accession P22455 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVM KLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLE SRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFT LGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE ; _struct_ref.pdbx_align_begin 445 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4QQ5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 15 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 323 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22455 _struct_ref_seq.db_align_beg 445 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 753 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 450 _struct_ref_seq.pdbx_auth_seq_align_end 758 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4QQ5 MET A 1 ? UNP P22455 ? ? 'EXPRESSION TAG' 436 1 1 4QQ5 GLY A 2 ? UNP P22455 ? ? 'EXPRESSION TAG' 437 2 1 4QQ5 SER A 3 ? UNP P22455 ? ? 'EXPRESSION TAG' 438 3 1 4QQ5 SER A 4 ? UNP P22455 ? ? 'EXPRESSION TAG' 439 4 1 4QQ5 HIS A 5 ? UNP P22455 ? ? 'EXPRESSION TAG' 440 5 1 4QQ5 HIS A 6 ? UNP P22455 ? ? 'EXPRESSION TAG' 441 6 1 4QQ5 HIS A 7 ? UNP P22455 ? ? 'EXPRESSION TAG' 442 7 1 4QQ5 HIS A 8 ? UNP P22455 ? ? 'EXPRESSION TAG' 443 8 1 4QQ5 HIS A 9 ? UNP P22455 ? ? 'EXPRESSION TAG' 444 9 1 4QQ5 HIS A 10 ? UNP P22455 ? ? 'EXPRESSION TAG' 445 10 1 4QQ5 SER A 11 ? UNP P22455 ? ? 'EXPRESSION TAG' 446 11 1 4QQ5 GLN A 12 ? UNP P22455 ? ? 'EXPRESSION TAG' 447 12 1 4QQ5 ASP A 13 ? UNP P22455 ? ? 'EXPRESSION TAG' 448 13 1 4QQ5 PRO A 14 ? UNP P22455 ? ? 'EXPRESSION TAG' 449 14 1 4QQ5 LEU A 120 ? UNP P22455 VAL 550 'ENGINEERED MUTATION' 555 15 1 4QQ5 GLU A 234 ? UNP P22455 ARG 664 'ENGINEERED MUTATION' 669 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 37O non-polymer . ;N-(4-{[3-(3,5-dimethoxyphenyl)-7-{[4-(4-methylpiperazin-1-yl)phenyl]amino}-2-oxo-3,4-dihydropyrimido[4,5-d]pyrimidin-1(2H)-yl]methyl}phenyl)propanamide ; ? 'C35 H40 N8 O4' 636.743 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4QQ5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.57 _exptl_crystal.density_percent_sol 52.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;0.1 M HEPES, 1.0 to 1.2 M (NH4)2SO4, and 10 mM Yttrium (III) Chloride Hexahydrate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2014-04-11 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97947 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97947 # _reflns.entry_id 4QQ5 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.2 _reflns.number_obs 18138 _reflns.number_all 18138 _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.102 _reflns.pdbx_Rsym_value 0.102 _reflns.pdbx_netI_over_sigmaI 13.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.24 _reflns_shell.percent_possible_all 90.1 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4QQ5 _refine.ls_number_reflns_obs 18134 _refine.ls_number_reflns_all 18134 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.98 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 38.372 _refine.ls_d_res_high 2.203 _refine.ls_percent_reflns_obs 99.11 _refine.ls_R_factor_obs 0.1972 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1930 _refine.ls_R_factor_R_free 0.2338 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.99 _refine.ls_number_reflns_R_free 1812 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'pdb entry 2PSQ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.24 _refine.pdbx_overall_phase_error 24.35 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2143 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2190 _refine_hist.d_res_high 2.203 _refine_hist.d_res_low 38.372 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.008 ? ? 2241 ? 'X-RAY DIFFRACTION' f_angle_d 1.229 ? ? 3044 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 17.984 ? ? 836 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.042 ? ? 334 ? 'X-RAY DIFFRACTION' f_plane_restr 0.007 ? ? 389 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.2025 2.2621 1188 0.2090 91.00 0.2432 . . 129 . . . . 'X-RAY DIFFRACTION' . 2.2621 2.3286 1236 0.2290 98.00 0.2645 . . 140 . . . . 'X-RAY DIFFRACTION' . 2.3286 2.4038 1269 0.2215 100.00 0.2638 . . 139 . . . . 'X-RAY DIFFRACTION' . 2.4038 2.4897 1278 0.2164 100.00 0.2893 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.4897 2.5893 1252 0.2270 100.00 0.3011 . . 139 . . . . 'X-RAY DIFFRACTION' . 2.5893 2.7071 1236 0.2110 100.00 0.2699 . . 136 . . . . 'X-RAY DIFFRACTION' . 2.7071 2.8498 1277 0.2257 100.00 0.2785 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.8498 3.0283 1264 0.2100 100.00 0.2345 . . 142 . . . . 'X-RAY DIFFRACTION' . 3.0283 3.2620 1266 0.2178 100.00 0.2761 . . 138 . . . . 'X-RAY DIFFRACTION' . 3.2620 3.5901 1277 0.1943 100.00 0.2315 . . 139 . . . . 'X-RAY DIFFRACTION' . 3.5901 4.1090 1263 0.1671 100.00 0.2035 . . 139 . . . . 'X-RAY DIFFRACTION' . 4.1090 5.1749 1257 0.1555 100.00 0.1858 . . 143 . . . . 'X-RAY DIFFRACTION' . 5.1749 38.3775 1259 0.1761 100.00 0.2071 . . 141 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4QQ5 _struct.title ;Crystal Structure of FGF Receptor (FGFR) 4 Kinase Harboring the V550L Gate-Keeper Mutation in Complex With FIIN-2, an Irreversible Tyrosine Kinase Inhibitor Capable of Overcoming FGFR Kinase Gate-Keeper Mutations ; _struct.pdbx_descriptor 'Fibroblast growth factor receptor 4 (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4QQ5 _struct_keywords.pdbx_keywords 'Transferase/transferase inhibitor' _struct_keywords.text 'Kinase Domain Fold, Cell Signaling, Phosphotransferase, Plasmamembrane, Transferase-transferase inhibitor complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 13 ? LEU A 19 ? ASP A 448 LEU A 454 1 ? 7 HELX_P HELX_P2 2 PRO A 33 ? ASP A 35 ? PRO A 468 ASP A 470 5 ? 3 HELX_P HELX_P3 3 SER A 80 ? GLY A 98 ? SER A 515 GLY A 533 1 ? 19 HELX_P HELX_P4 4 ASN A 127 ? ARG A 135 ? ASN A 562 ARG A 570 1 ? 9 HELX_P HELX_P5 5 SER A 155 ? ARG A 176 ? SER A 590 ARG A 611 1 ? 22 HELX_P HELX_P6 6 ALA A 184 ? ARG A 186 ? ALA A 619 ARG A 621 5 ? 3 HELX_P HELX_P7 7 LEU A 221 ? MET A 226 ? LEU A 656 MET A 661 5 ? 6 HELX_P HELX_P8 8 ALA A 227 ? GLU A 234 ? ALA A 662 GLU A 669 1 ? 8 HELX_P HELX_P9 9 THR A 237 ? THR A 254 ? THR A 672 THR A 689 1 ? 18 HELX_P HELX_P10 10 PRO A 264 ? GLU A 274 ? PRO A 699 GLU A 709 1 ? 11 HELX_P HELX_P11 11 PRO A 285 ? TRP A 296 ? PRO A 720 TRP A 731 1 ? 12 HELX_P HELX_P12 12 ALA A 299 ? ARG A 303 ? ALA A 734 ARG A 738 5 ? 5 HELX_P HELX_P13 13 THR A 305 ? ALA A 319 ? THR A 740 ALA A 754 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 47 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 37O _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C46 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 482 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 37O _struct_conn.ptnr2_auth_seq_id 801 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.747 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 12 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 447 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 13 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 448 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.43 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 37 ? PRO A 42 ? LEU A 472 PRO A 477 A 2 GLN A 50 ? PHE A 57 ? GLN A 485 PHE A 492 A 3 ALA A 67 ? MET A 74 ? ALA A 502 MET A 509 A 4 TYR A 117 ? GLU A 121 ? TYR A 552 GLU A 556 A 5 LEU A 106 ? CYS A 110 ? LEU A 541 CYS A 545 B 1 VAL A 188 ? VAL A 190 ? VAL A 623 VAL A 625 B 2 MET A 196 ? ILE A 198 ? MET A 631 ILE A 633 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 41 ? N LYS A 476 O ARG A 53 ? O ARG A 488 A 2 3 N VAL A 52 ? N VAL A 487 O VAL A 72 ? O VAL A 507 A 3 4 N ALA A 71 ? N ALA A 506 O LEU A 120 ? O LEU A 555 A 4 5 O ILE A 119 ? O ILE A 554 N LEU A 107 ? N LEU A 542 B 1 2 N LEU A 189 ? N LEU A 624 O LYS A 197 ? O LYS A 632 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'BINDING SITE FOR RESIDUE 37O A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 LEU A 43 ? LEU A 478 . ? 1_555 ? 2 AC1 16 GLU A 45 ? GLU A 480 . ? 1_555 ? 3 AC1 16 GLY A 46 ? GLY A 481 . ? 1_555 ? 4 AC1 16 CYS A 47 ? CYS A 482 . ? 1_555 ? 5 AC1 16 PHE A 48 ? PHE A 483 . ? 1_555 ? 6 AC1 16 LYS A 73 ? LYS A 508 . ? 1_555 ? 7 AC1 16 GLU A 90 ? GLU A 525 . ? 1_555 ? 8 AC1 16 LEU A 120 ? LEU A 555 . ? 1_555 ? 9 AC1 16 GLU A 121 ? GLU A 556 . ? 1_555 ? 10 AC1 16 ALA A 123 ? ALA A 558 . ? 1_555 ? 11 AC1 16 ALA A 124 ? ALA A 559 . ? 1_555 ? 12 AC1 16 GLY A 126 ? GLY A 561 . ? 1_555 ? 13 AC1 16 LEU A 189 ? LEU A 624 . ? 1_555 ? 14 AC1 16 ALA A 199 ? ALA A 634 . ? 1_555 ? 15 AC1 16 ASP A 200 ? ASP A 635 . ? 1_555 ? 16 AC1 16 PHE A 201 ? PHE A 636 . ? 1_555 ? # _database_PDB_matrix.entry_id 4QQ5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4QQ5 _atom_sites.fract_transf_matrix[1][1] 0.007163 _atom_sites.fract_transf_matrix[1][2] 0.004136 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008272 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020137 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 436 ? ? ? A . n A 1 2 GLY 2 437 ? ? ? A . n A 1 3 SER 3 438 ? ? ? A . n A 1 4 SER 4 439 ? ? ? A . n A 1 5 HIS 5 440 ? ? ? A . n A 1 6 HIS 6 441 ? ? ? A . n A 1 7 HIS 7 442 ? ? ? A . n A 1 8 HIS 8 443 ? ? ? A . n A 1 9 HIS 9 444 ? ? ? A . n A 1 10 HIS 10 445 ? ? ? A . n A 1 11 SER 11 446 ? ? ? A . n A 1 12 GLN 12 447 447 GLN ALA A . n A 1 13 ASP 13 448 448 ASP ASP A . n A 1 14 PRO 14 449 449 PRO PRO A . n A 1 15 LEU 15 450 450 LEU LEU A . n A 1 16 LEU 16 451 451 LEU LEU A . n A 1 17 ALA 17 452 452 ALA ALA A . n A 1 18 GLY 18 453 453 GLY GLY A . n A 1 19 LEU 19 454 454 LEU LEU A . n A 1 20 VAL 20 455 455 VAL VAL A . n A 1 21 SER 21 456 456 SER SER A . n A 1 22 LEU 22 457 457 LEU LEU A . n A 1 23 ASP 23 458 458 ASP ASP A . n A 1 24 LEU 24 459 459 LEU LEU A . n A 1 25 PRO 25 460 460 PRO PRO A . n A 1 26 LEU 26 461 461 LEU LEU A . n A 1 27 ASP 27 462 462 ASP ASP A . n A 1 28 PRO 28 463 463 PRO PRO A . n A 1 29 LEU 29 464 464 LEU LEU A . n A 1 30 TRP 30 465 465 TRP TRP A . n A 1 31 GLU 31 466 466 GLU GLU A . n A 1 32 PHE 32 467 467 PHE PHE A . n A 1 33 PRO 33 468 468 PRO PRO A . n A 1 34 ARG 34 469 469 ARG ARG A . n A 1 35 ASP 35 470 470 ASP ASP A . n A 1 36 ARG 36 471 471 ARG ARG A . n A 1 37 LEU 37 472 472 LEU LEU A . n A 1 38 VAL 38 473 473 VAL VAL A . n A 1 39 LEU 39 474 474 LEU LEU A . n A 1 40 GLY 40 475 475 GLY GLY A . n A 1 41 LYS 41 476 476 LYS LYS A . n A 1 42 PRO 42 477 477 PRO PRO A . n A 1 43 LEU 43 478 478 LEU LEU A . n A 1 44 GLY 44 479 479 GLY GLY A . n A 1 45 GLU 45 480 480 GLU GLU A . n A 1 46 GLY 46 481 481 GLY GLY A . n A 1 47 CYS 47 482 482 CYS CYS A . n A 1 48 PHE 48 483 483 PHE PHE A . n A 1 49 GLY 49 484 484 GLY GLY A . n A 1 50 GLN 50 485 485 GLN GLN A . n A 1 51 VAL 51 486 486 VAL VAL A . n A 1 52 VAL 52 487 487 VAL VAL A . n A 1 53 ARG 53 488 488 ARG ARG A . n A 1 54 ALA 54 489 489 ALA ALA A . n A 1 55 GLU 55 490 490 GLU GLU A . n A 1 56 ALA 56 491 491 ALA ALA A . n A 1 57 PHE 57 492 492 PHE PHE A . n A 1 58 GLY 58 493 493 GLY GLY A . n A 1 59 MET 59 494 494 MET MET A . n A 1 60 ASP 60 495 ? ? ? A . n A 1 61 PRO 61 496 ? ? ? A . n A 1 62 ALA 62 497 ? ? ? A . n A 1 63 ARG 63 498 ? ? ? A . n A 1 64 PRO 64 499 ? ? ? A . n A 1 65 ASP 65 500 500 ASP ALA A . n A 1 66 GLN 66 501 501 GLN GLN A . n A 1 67 ALA 67 502 502 ALA ALA A . n A 1 68 SER 68 503 503 SER SER A . n A 1 69 THR 69 504 504 THR THR A . n A 1 70 VAL 70 505 505 VAL VAL A . n A 1 71 ALA 71 506 506 ALA ALA A . n A 1 72 VAL 72 507 507 VAL VAL A . n A 1 73 LYS 73 508 508 LYS LYS A . n A 1 74 MET 74 509 509 MET MET A . n A 1 75 LEU 75 510 510 LEU LEU A . n A 1 76 LYS 76 511 511 LYS ALA A . n A 1 77 ASP 77 512 512 ASP ASP A . n A 1 78 ASN 78 513 513 ASN ASN A . n A 1 79 ALA 79 514 514 ALA ALA A . n A 1 80 SER 80 515 515 SER SER A . n A 1 81 ASP 81 516 516 ASP ASP A . n A 1 82 LYS 82 517 517 LYS LYS A . n A 1 83 ASP 83 518 518 ASP ASP A . n A 1 84 LEU 84 519 519 LEU LEU A . n A 1 85 ALA 85 520 520 ALA ALA A . n A 1 86 ASP 86 521 521 ASP ASP A . n A 1 87 LEU 87 522 522 LEU LEU A . n A 1 88 VAL 88 523 523 VAL VAL A . n A 1 89 SER 89 524 524 SER SER A . n A 1 90 GLU 90 525 525 GLU GLU A . n A 1 91 MET 91 526 526 MET MET A . n A 1 92 GLU 92 527 527 GLU GLU A . n A 1 93 VAL 93 528 528 VAL VAL A . n A 1 94 MET 94 529 529 MET MET A . n A 1 95 LYS 95 530 530 LYS LYS A . n A 1 96 LEU 96 531 531 LEU LEU A . n A 1 97 ILE 97 532 532 ILE ILE A . n A 1 98 GLY 98 533 533 GLY GLY A . n A 1 99 ARG 99 534 534 ARG ARG A . n A 1 100 HIS 100 535 535 HIS HIS A . n A 1 101 LYS 101 536 536 LYS LYS A . n A 1 102 ASN 102 537 537 ASN ASN A . n A 1 103 ILE 103 538 538 ILE ILE A . n A 1 104 ILE 104 539 539 ILE ILE A . n A 1 105 ASN 105 540 540 ASN ASN A . n A 1 106 LEU 106 541 541 LEU LEU A . n A 1 107 LEU 107 542 542 LEU LEU A . n A 1 108 GLY 108 543 543 GLY GLY A . n A 1 109 VAL 109 544 544 VAL VAL A . n A 1 110 CYS 110 545 545 CYS CYS A . n A 1 111 THR 111 546 546 THR THR A . n A 1 112 GLN 112 547 547 GLN GLN A . n A 1 113 GLU 113 548 548 GLU GLU A . n A 1 114 GLY 114 549 549 GLY GLY A . n A 1 115 PRO 115 550 550 PRO PRO A . n A 1 116 LEU 116 551 551 LEU LEU A . n A 1 117 TYR 117 552 552 TYR TYR A . n A 1 118 VAL 118 553 553 VAL VAL A . n A 1 119 ILE 119 554 554 ILE ILE A . n A 1 120 LEU 120 555 555 LEU LEU A . n A 1 121 GLU 121 556 556 GLU GLU A . n A 1 122 CYS 122 557 557 CYS CYS A . n A 1 123 ALA 123 558 558 ALA ALA A . n A 1 124 ALA 124 559 559 ALA ALA A . n A 1 125 LYS 125 560 560 LYS LYS A . n A 1 126 GLY 126 561 561 GLY GLY A . n A 1 127 ASN 127 562 562 ASN ASN A . n A 1 128 LEU 128 563 563 LEU LEU A . n A 1 129 ARG 129 564 564 ARG ARG A . n A 1 130 GLU 130 565 565 GLU GLU A . n A 1 131 PHE 131 566 566 PHE PHE A . n A 1 132 LEU 132 567 567 LEU LEU A . n A 1 133 ARG 133 568 568 ARG ARG A . n A 1 134 ALA 134 569 569 ALA ALA A . n A 1 135 ARG 135 570 570 ARG ARG A . n A 1 136 ARG 136 571 571 ARG ARG A . n A 1 137 PRO 137 572 572 PRO PRO A . n A 1 138 PRO 138 573 573 PRO PRO A . n A 1 139 GLY 139 574 ? ? ? A . n A 1 140 PRO 140 575 ? ? ? A . n A 1 141 ASP 141 576 ? ? ? A . n A 1 142 LEU 142 577 ? ? ? A . n A 1 143 SER 143 578 ? ? ? A . n A 1 144 PRO 144 579 ? ? ? A . n A 1 145 ASP 145 580 ? ? ? A . n A 1 146 GLY 146 581 ? ? ? A . n A 1 147 PRO 147 582 ? ? ? A . n A 1 148 ARG 148 583 ? ? ? A . n A 1 149 SER 149 584 ? ? ? A . n A 1 150 SER 150 585 ? ? ? A . n A 1 151 GLU 151 586 ? ? ? A . n A 1 152 GLY 152 587 587 GLY GLY A . n A 1 153 PRO 153 588 588 PRO PRO A . n A 1 154 LEU 154 589 589 LEU LEU A . n A 1 155 SER 155 590 590 SER SER A . n A 1 156 PHE 156 591 591 PHE PHE A . n A 1 157 PRO 157 592 592 PRO PRO A . n A 1 158 VAL 158 593 593 VAL VAL A . n A 1 159 LEU 159 594 594 LEU LEU A . n A 1 160 VAL 160 595 595 VAL VAL A . n A 1 161 SER 161 596 596 SER SER A . n A 1 162 CYS 162 597 597 CYS CYS A . n A 1 163 ALA 163 598 598 ALA ALA A . n A 1 164 TYR 164 599 599 TYR TYR A . n A 1 165 GLN 165 600 600 GLN GLN A . n A 1 166 VAL 166 601 601 VAL VAL A . n A 1 167 ALA 167 602 602 ALA ALA A . n A 1 168 ARG 168 603 603 ARG ARG A . n A 1 169 GLY 169 604 604 GLY GLY A . n A 1 170 MET 170 605 605 MET MET A . n A 1 171 GLN 171 606 606 GLN GLN A . n A 1 172 TYR 172 607 607 TYR TYR A . n A 1 173 LEU 173 608 608 LEU LEU A . n A 1 174 GLU 174 609 609 GLU GLU A . n A 1 175 SER 175 610 610 SER SER A . n A 1 176 ARG 176 611 611 ARG ARG A . n A 1 177 LYS 177 612 612 LYS LYS A . n A 1 178 CYS 178 613 613 CYS CYS A . n A 1 179 ILE 179 614 614 ILE ILE A . n A 1 180 HIS 180 615 615 HIS HIS A . n A 1 181 ARG 181 616 616 ARG ARG A . n A 1 182 ASP 182 617 617 ASP ASP A . n A 1 183 LEU 183 618 618 LEU LEU A . n A 1 184 ALA 184 619 619 ALA ALA A . n A 1 185 ALA 185 620 620 ALA ALA A . n A 1 186 ARG 186 621 621 ARG ARG A . n A 1 187 ASN 187 622 622 ASN ASN A . n A 1 188 VAL 188 623 623 VAL VAL A . n A 1 189 LEU 189 624 624 LEU LEU A . n A 1 190 VAL 190 625 625 VAL VAL A . n A 1 191 THR 191 626 626 THR THR A . n A 1 192 GLU 192 627 627 GLU GLU A . n A 1 193 ASP 193 628 628 ASP ASP A . n A 1 194 ASN 194 629 629 ASN ASN A . n A 1 195 VAL 195 630 630 VAL VAL A . n A 1 196 MET 196 631 631 MET MET A . n A 1 197 LYS 197 632 632 LYS LYS A . n A 1 198 ILE 198 633 633 ILE ILE A . n A 1 199 ALA 199 634 634 ALA ALA A . n A 1 200 ASP 200 635 635 ASP ASP A . n A 1 201 PHE 201 636 636 PHE PHE A . n A 1 202 GLY 202 637 637 GLY GLY A . n A 1 203 LEU 203 638 638 LEU LEU A . n A 1 204 ALA 204 639 639 ALA ALA A . n A 1 205 ARG 205 640 ? ? ? A . n A 1 206 GLY 206 641 ? ? ? A . n A 1 207 VAL 207 642 ? ? ? A . n A 1 208 HIS 208 643 ? ? ? A . n A 1 209 HIS 209 644 ? ? ? A . n A 1 210 ILE 210 645 ? ? ? A . n A 1 211 ASP 211 646 ? ? ? A . n A 1 212 TYR 212 647 ? ? ? A . n A 1 213 TYR 213 648 ? ? ? A . n A 1 214 LYS 214 649 ? ? ? A . n A 1 215 LYS 215 650 ? ? ? A . n A 1 216 THR 216 651 ? ? ? A . n A 1 217 SER 217 652 ? ? ? A . n A 1 218 ASN 218 653 ? ? ? A . n A 1 219 GLY 219 654 ? ? ? A . n A 1 220 ARG 220 655 ? ? ? A . n A 1 221 LEU 221 656 656 LEU LEU A . n A 1 222 PRO 222 657 657 PRO PRO A . n A 1 223 VAL 223 658 658 VAL VAL A . n A 1 224 LYS 224 659 659 LYS LYS A . n A 1 225 TRP 225 660 660 TRP TRP A . n A 1 226 MET 226 661 661 MET MET A . n A 1 227 ALA 227 662 662 ALA ALA A . n A 1 228 PRO 228 663 663 PRO PRO A . n A 1 229 GLU 229 664 664 GLU GLU A . n A 1 230 ALA 230 665 665 ALA ALA A . n A 1 231 LEU 231 666 666 LEU LEU A . n A 1 232 PHE 232 667 667 PHE PHE A . n A 1 233 ASP 233 668 668 ASP ASP A . n A 1 234 GLU 234 669 669 GLU GLU A . n A 1 235 VAL 235 670 670 VAL VAL A . n A 1 236 TYR 236 671 671 TYR TYR A . n A 1 237 THR 237 672 672 THR THR A . n A 1 238 HIS 238 673 673 HIS HIS A . n A 1 239 GLN 239 674 674 GLN GLN A . n A 1 240 SER 240 675 675 SER SER A . n A 1 241 ASP 241 676 676 ASP ASP A . n A 1 242 VAL 242 677 677 VAL VAL A . n A 1 243 TRP 243 678 678 TRP TRP A . n A 1 244 SER 244 679 679 SER SER A . n A 1 245 PHE 245 680 680 PHE PHE A . n A 1 246 GLY 246 681 681 GLY GLY A . n A 1 247 ILE 247 682 682 ILE ILE A . n A 1 248 LEU 248 683 683 LEU LEU A . n A 1 249 LEU 249 684 684 LEU LEU A . n A 1 250 TRP 250 685 685 TRP TRP A . n A 1 251 GLU 251 686 686 GLU GLU A . n A 1 252 ILE 252 687 687 ILE ILE A . n A 1 253 PHE 253 688 688 PHE PHE A . n A 1 254 THR 254 689 689 THR THR A . n A 1 255 LEU 255 690 690 LEU LEU A . n A 1 256 GLY 256 691 691 GLY GLY A . n A 1 257 GLY 257 692 692 GLY GLY A . n A 1 258 SER 258 693 693 SER SER A . n A 1 259 PRO 259 694 694 PRO PRO A . n A 1 260 TYR 260 695 695 TYR TYR A . n A 1 261 PRO 261 696 696 PRO PRO A . n A 1 262 GLY 262 697 697 GLY GLY A . n A 1 263 ILE 263 698 698 ILE ILE A . n A 1 264 PRO 264 699 699 PRO PRO A . n A 1 265 VAL 265 700 700 VAL VAL A . n A 1 266 GLU 266 701 701 GLU GLU A . n A 1 267 GLU 267 702 702 GLU GLU A . n A 1 268 LEU 268 703 703 LEU LEU A . n A 1 269 PHE 269 704 704 PHE PHE A . n A 1 270 SER 270 705 705 SER SER A . n A 1 271 LEU 271 706 706 LEU LEU A . n A 1 272 LEU 272 707 707 LEU LEU A . n A 1 273 ARG 273 708 708 ARG ALA A . n A 1 274 GLU 274 709 709 GLU GLU A . n A 1 275 GLY 275 710 710 GLY GLY A . n A 1 276 HIS 276 711 711 HIS HIS A . n A 1 277 ARG 277 712 712 ARG ARG A . n A 1 278 MET 278 713 713 MET MET A . n A 1 279 ASP 279 714 714 ASP ASP A . n A 1 280 ARG 280 715 715 ARG ARG A . n A 1 281 PRO 281 716 716 PRO PRO A . n A 1 282 PRO 282 717 717 PRO PRO A . n A 1 283 HIS 283 718 718 HIS HIS A . n A 1 284 CYS 284 719 719 CYS CYS A . n A 1 285 PRO 285 720 720 PRO PRO A . n A 1 286 PRO 286 721 721 PRO PRO A . n A 1 287 GLU 287 722 722 GLU GLU A . n A 1 288 LEU 288 723 723 LEU LEU A . n A 1 289 TYR 289 724 724 TYR TYR A . n A 1 290 GLY 290 725 725 GLY GLY A . n A 1 291 LEU 291 726 726 LEU LEU A . n A 1 292 MET 292 727 727 MET MET A . n A 1 293 ARG 293 728 728 ARG ARG A . n A 1 294 GLU 294 729 729 GLU GLU A . n A 1 295 CYS 295 730 730 CYS CYS A . n A 1 296 TRP 296 731 731 TRP TRP A . n A 1 297 HIS 297 732 732 HIS HIS A . n A 1 298 ALA 298 733 733 ALA ALA A . n A 1 299 ALA 299 734 734 ALA ALA A . n A 1 300 PRO 300 735 735 PRO PRO A . n A 1 301 SER 301 736 736 SER SER A . n A 1 302 GLN 302 737 737 GLN GLN A . n A 1 303 ARG 303 738 738 ARG ARG A . n A 1 304 PRO 304 739 739 PRO PRO A . n A 1 305 THR 305 740 740 THR THR A . n A 1 306 PHE 306 741 741 PHE PHE A . n A 1 307 LYS 307 742 742 LYS LYS A . n A 1 308 GLN 308 743 743 GLN GLN A . n A 1 309 LEU 309 744 744 LEU LEU A . n A 1 310 VAL 310 745 745 VAL VAL A . n A 1 311 GLU 311 746 746 GLU GLU A . n A 1 312 ALA 312 747 747 ALA ALA A . n A 1 313 LEU 313 748 748 LEU LEU A . n A 1 314 ASP 314 749 749 ASP ASP A . n A 1 315 LYS 315 750 750 LYS LYS A . n A 1 316 VAL 316 751 751 VAL VAL A . n A 1 317 LEU 317 752 752 LEU LEU A . n A 1 318 LEU 318 753 753 LEU LEU A . n A 1 319 ALA 319 754 754 ALA ALA A . n A 1 320 VAL 320 755 755 VAL VAL A . n A 1 321 SER 321 756 ? ? ? A . n A 1 322 GLU 322 757 ? ? ? A . n A 1 323 GLU 323 758 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 37O _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 801 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id 37O _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2,3 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2220 ? 2 MORE -25 ? 2 'SSA (A^2)' 39650 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_675 -y+1,x-y+2,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 241.7925606858 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_465 -x+y-1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -209.3985000000 -0.8660254038 -0.5000000000 0.0000000000 120.8962803429 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-29 2 'Structure model' 1 1 2015-01-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -61.4920 _pdbx_refine_tls.origin_y 142.2560 _pdbx_refine_tls.origin_z 11.1489 _pdbx_refine_tls.T[1][1] 0.1892 _pdbx_refine_tls.T[2][2] 0.1280 _pdbx_refine_tls.T[3][3] 0.1622 _pdbx_refine_tls.T[1][2] -0.0232 _pdbx_refine_tls.T[1][3] -0.0017 _pdbx_refine_tls.T[2][3] 0.0121 _pdbx_refine_tls.L[1][1] 0.2120 _pdbx_refine_tls.L[2][2] 0.4140 _pdbx_refine_tls.L[3][3] 0.2598 _pdbx_refine_tls.L[1][2] 0.1099 _pdbx_refine_tls.L[1][3] 0.0491 _pdbx_refine_tls.L[2][3] 0.3206 _pdbx_refine_tls.S[1][1] 0.0271 _pdbx_refine_tls.S[1][2] -0.0244 _pdbx_refine_tls.S[1][3] -0.0147 _pdbx_refine_tls.S[2][1] -0.0892 _pdbx_refine_tls.S[2][2] 0.0002 _pdbx_refine_tls.S[2][3] -0.0082 _pdbx_refine_tls.S[3][1] -0.1023 _pdbx_refine_tls.S[3][2] -0.0198 _pdbx_refine_tls.S[3][3] 0.0002 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-3000 'data collection' . ? 1 PHENIX 'model building' . ? 2 PHENIX refinement '(phenix.refine: 1.8.4_1496)' ? 3 HKL-3000 'data reduction' . ? 4 HKL-3000 'data scaling' . ? 5 PHASER phasing . ? 6 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A GLY 549 ? ? N A PRO 550 ? ? CA A PRO 550 ? ? 130.44 119.30 11.14 1.50 Y 2 1 C A LEU 656 ? ? N A PRO 657 ? ? CA A PRO 657 ? ? 128.80 119.30 9.50 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 448 ? ? -145.19 -89.41 2 1 PRO A 477 ? ? -49.73 153.51 3 1 LEU A 589 ? ? -107.32 61.15 4 1 ARG A 616 ? ? 82.96 -11.73 5 1 ASP A 617 ? ? -143.51 42.66 6 1 PRO A 657 ? ? -47.81 -19.48 7 1 PHE A 704 ? ? -6.46 -92.25 8 1 CYS A 719 ? ? -165.12 114.90 9 1 ALA A 754 ? ? -68.11 26.10 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LEU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 703 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PHE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 704 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 144.10 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 447 ? CG ? A GLN 12 CG 2 1 Y 1 A GLN 447 ? CD ? A GLN 12 CD 3 1 Y 1 A GLN 447 ? OE1 ? A GLN 12 OE1 4 1 Y 1 A GLN 447 ? NE2 ? A GLN 12 NE2 5 1 Y 1 A ASP 500 ? CG ? A ASP 65 CG 6 1 Y 1 A ASP 500 ? OD1 ? A ASP 65 OD1 7 1 Y 1 A ASP 500 ? OD2 ? A ASP 65 OD2 8 1 Y 1 A LYS 511 ? CG ? A LYS 76 CG 9 1 Y 1 A LYS 511 ? CD ? A LYS 76 CD 10 1 Y 1 A LYS 511 ? CE ? A LYS 76 CE 11 1 Y 1 A LYS 511 ? NZ ? A LYS 76 NZ 12 1 Y 1 A ARG 708 ? CG ? A ARG 273 CG 13 1 Y 1 A ARG 708 ? CD ? A ARG 273 CD 14 1 Y 1 A ARG 708 ? NE ? A ARG 273 NE 15 1 Y 1 A ARG 708 ? CZ ? A ARG 273 CZ 16 1 Y 1 A ARG 708 ? NH1 ? A ARG 273 NH1 17 1 Y 1 A ARG 708 ? NH2 ? A ARG 273 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 436 ? A MET 1 2 1 Y 1 A GLY 437 ? A GLY 2 3 1 Y 1 A SER 438 ? A SER 3 4 1 Y 1 A SER 439 ? A SER 4 5 1 Y 1 A HIS 440 ? A HIS 5 6 1 Y 1 A HIS 441 ? A HIS 6 7 1 Y 1 A HIS 442 ? A HIS 7 8 1 Y 1 A HIS 443 ? A HIS 8 9 1 Y 1 A HIS 444 ? A HIS 9 10 1 Y 1 A HIS 445 ? A HIS 10 11 1 Y 1 A SER 446 ? A SER 11 12 1 Y 1 A ASP 495 ? A ASP 60 13 1 Y 1 A PRO 496 ? A PRO 61 14 1 Y 1 A ALA 497 ? A ALA 62 15 1 Y 1 A ARG 498 ? A ARG 63 16 1 Y 1 A PRO 499 ? A PRO 64 17 1 Y 1 A GLY 574 ? A GLY 139 18 1 Y 1 A PRO 575 ? A PRO 140 19 1 Y 1 A ASP 576 ? A ASP 141 20 1 Y 1 A LEU 577 ? A LEU 142 21 1 Y 1 A SER 578 ? A SER 143 22 1 Y 1 A PRO 579 ? A PRO 144 23 1 Y 1 A ASP 580 ? A ASP 145 24 1 Y 1 A GLY 581 ? A GLY 146 25 1 Y 1 A PRO 582 ? A PRO 147 26 1 Y 1 A ARG 583 ? A ARG 148 27 1 Y 1 A SER 584 ? A SER 149 28 1 Y 1 A SER 585 ? A SER 150 29 1 Y 1 A GLU 586 ? A GLU 151 30 1 Y 1 A ARG 640 ? A ARG 205 31 1 Y 1 A GLY 641 ? A GLY 206 32 1 Y 1 A VAL 642 ? A VAL 207 33 1 Y 1 A HIS 643 ? A HIS 208 34 1 Y 1 A HIS 644 ? A HIS 209 35 1 Y 1 A ILE 645 ? A ILE 210 36 1 Y 1 A ASP 646 ? A ASP 211 37 1 Y 1 A TYR 647 ? A TYR 212 38 1 Y 1 A TYR 648 ? A TYR 213 39 1 Y 1 A LYS 649 ? A LYS 214 40 1 Y 1 A LYS 650 ? A LYS 215 41 1 Y 1 A THR 651 ? A THR 216 42 1 Y 1 A SER 652 ? A SER 217 43 1 Y 1 A ASN 653 ? A ASN 218 44 1 Y 1 A GLY 654 ? A GLY 219 45 1 Y 1 A ARG 655 ? A ARG 220 46 1 Y 1 A SER 756 ? A SER 321 47 1 Y 1 A GLU 757 ? A GLU 322 48 1 Y 1 A GLU 758 ? A GLU 323 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;N-(4-{[3-(3,5-dimethoxyphenyl)-7-{[4-(4-methylpiperazin-1-yl)phenyl]amino}-2-oxo-3,4-dihydropyrimido[4,5-d]pyrimidin-1(2H)-yl]methyl}phenyl)propanamide ; _pdbx_entity_nonpoly.comp_id 37O #