data_4QXL # _entry.id 4QXL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4QXL RCSB RCSB086640 WWPDB D_1000086640 # _pdbx_database_status.entry_id 4QXL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-07-21 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, J.' 1 'Monzingo, A.F.' 2 'Keatinge-Clay, A.T.' 3 'Harshey, R.M.' 4 # _citation.id primary _citation.title 'Structure of Salmonella FlhE, Conserved Member of a Flagellar Type III Secretion Operon.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 427 _citation.page_first 1254 _citation.page_last 1262 _citation.year 2015 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25545591 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2014.11.022 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lee, J.' 1 primary 'Monzingo, A.F.' 2 primary 'Keatinge-Clay, A.T.' 3 primary 'Harshey, R.M.' 4 # _cell.length_a 25.425 _cell.length_b 36.755 _cell.length_c 111.468 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4QXL _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 4QXL _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Flagellar protein flhE' 13032.729 1 ? ? 'UNP residues 17-130' ? 2 water nat water 18.015 86 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AGEGAWQDSGMGVTLNYRGVSASSSPLSARQPVSGVMTLVAWRYELNGPTPAGLRVRLCSQSRCVELDGQSGTTHGFAHV PAVEPLRFVWEVPGGGRLIPALKVRSNQVIVNYRHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;AGEGAWQDSGMGVTLNYRGVSASSSPLSARQPVSGVMTLVAWRYELNGPTPAGLRVRLCSQSRCVELDGQSGTTHGFAHV PAVEPLRFVWEVPGGGRLIPALKVRSNQVIVNYRHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLY n 1 3 GLU n 1 4 GLY n 1 5 ALA n 1 6 TRP n 1 7 GLN n 1 8 ASP n 1 9 SER n 1 10 GLY n 1 11 MET n 1 12 GLY n 1 13 VAL n 1 14 THR n 1 15 LEU n 1 16 ASN n 1 17 TYR n 1 18 ARG n 1 19 GLY n 1 20 VAL n 1 21 SER n 1 22 ALA n 1 23 SER n 1 24 SER n 1 25 SER n 1 26 PRO n 1 27 LEU n 1 28 SER n 1 29 ALA n 1 30 ARG n 1 31 GLN n 1 32 PRO n 1 33 VAL n 1 34 SER n 1 35 GLY n 1 36 VAL n 1 37 MET n 1 38 THR n 1 39 LEU n 1 40 VAL n 1 41 ALA n 1 42 TRP n 1 43 ARG n 1 44 TYR n 1 45 GLU n 1 46 LEU n 1 47 ASN n 1 48 GLY n 1 49 PRO n 1 50 THR n 1 51 PRO n 1 52 ALA n 1 53 GLY n 1 54 LEU n 1 55 ARG n 1 56 VAL n 1 57 ARG n 1 58 LEU n 1 59 CYS n 1 60 SER n 1 61 GLN n 1 62 SER n 1 63 ARG n 1 64 CYS n 1 65 VAL n 1 66 GLU n 1 67 LEU n 1 68 ASP n 1 69 GLY n 1 70 GLN n 1 71 SER n 1 72 GLY n 1 73 THR n 1 74 THR n 1 75 HIS n 1 76 GLY n 1 77 PHE n 1 78 ALA n 1 79 HIS n 1 80 VAL n 1 81 PRO n 1 82 ALA n 1 83 VAL n 1 84 GLU n 1 85 PRO n 1 86 LEU n 1 87 ARG n 1 88 PHE n 1 89 VAL n 1 90 TRP n 1 91 GLU n 1 92 VAL n 1 93 PRO n 1 94 GLY n 1 95 GLY n 1 96 GLY n 1 97 ARG n 1 98 LEU n 1 99 ILE n 1 100 PRO n 1 101 ALA n 1 102 LEU n 1 103 LYS n 1 104 VAL n 1 105 ARG n 1 106 SER n 1 107 ASN n 1 108 GLN n 1 109 VAL n 1 110 ILE n 1 111 VAL n 1 112 ASN n 1 113 TYR n 1 114 ARG n 1 115 HIS n 1 116 HIS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FLHE, SEEA0014_18915' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28901 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Salmonella enterica' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 28901 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ST004 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTrc99a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code X5B9E9_SALAB _struct_ref.pdbx_db_accession X5B9E9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGEGAWQDSGMGVTLNYRGVSASSSPLSARQPVSGVMTLVAWRYELNGPTPAGLRVRLCSQSRCVELDGQSGTTHGFAHV PAVEPLRFVWEVPGGGRLIPALKVRSNQVIVNYR ; _struct_ref.pdbx_align_begin 17 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4QXL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession X5B9E9 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 114 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4QXL HIS A 115 ? UNP X5B9E9 ? ? 'EXPRESSION TAG' 115 1 1 4QXL HIS A 116 ? UNP X5B9E9 ? ? 'EXPRESSION TAG' 116 2 1 4QXL HIS A 117 ? UNP X5B9E9 ? ? 'EXPRESSION TAG' 117 3 1 4QXL HIS A 118 ? UNP X5B9E9 ? ? 'EXPRESSION TAG' 118 4 1 4QXL HIS A 119 ? UNP X5B9E9 ? ? 'EXPRESSION TAG' 119 5 1 4QXL HIS A 120 ? UNP X5B9E9 ? ? 'EXPRESSION TAG' 120 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4QXL _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.00 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 38.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '1.5 M sodium chloride, 10% ethanol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2012-06-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00506 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00506 _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.2 # _reflns.entry_id 4QXL _reflns.d_resolution_high 1.510 _reflns.d_resolution_low 50.0 _reflns.number_obs 15949 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_netI_over_sigmaI 17.3 _reflns.pdbx_chi_squared 1.687 _reflns.pdbx_redundancy 9.6 _reflns.percent_possible_obs 92.3 _reflns.B_iso_Wilson_estimate 11.89 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.510 1.540 ? ? ? 0.263 ? ? 0.690 7.70 ? 688 80.2 1 1 1.540 1.560 ? ? ? 0.213 ? ? 0.743 9.10 ? 803 98.4 2 1 1.560 1.590 ? ? ? 0.194 ? ? 0.783 9.50 ? 850 97.5 3 1 1.590 1.630 ? ? ? 0.180 ? ? 0.827 10.30 ? 782 97.1 4 1 1.630 1.660 ? ? ? 0.156 ? ? 1.021 9.70 ? 854 97.9 5 1 1.660 1.700 ? ? ? 0.140 ? ? 0.980 9.90 ? 828 98.1 6 1 1.700 1.740 ? ? ? 0.127 ? ? 1.177 9.70 ? 828 99.0 7 1 1.740 1.790 ? ? ? 0.115 ? ? 1.414 9.80 ? 847 98.9 8 1 1.790 1.840 ? ? ? 0.111 ? ? 1.494 9.90 ? 838 97.3 9 1 1.840 1.900 ? ? ? 0.104 ? ? 2.001 9.40 ? 734 87.7 10 1 1.900 1.970 ? ? ? 0.104 ? ? 2.351 6.60 ? 613 71.0 11 1 1.970 2.050 ? ? ? 0.077 ? ? 2.125 9.80 ? 847 99.9 12 1 2.050 2.140 ? ? ? 0.070 ? ? 2.325 9.80 ? 857 99.8 13 1 2.140 2.260 ? ? ? 0.070 ? ? 2.456 9.40 ? 605 70.8 14 1 2.260 2.400 ? ? ? 0.066 ? ? 2.385 9.50 ? 702 81.3 15 1 2.400 2.580 ? ? ? 0.063 ? ? 2.204 10.10 ? 872 99.8 16 1 2.580 2.840 ? ? ? 0.061 ? ? 2.474 10.40 ? 897 100.0 17 1 2.840 3.250 ? ? ? 0.055 ? ? 2.532 10.60 ? 870 100.0 18 1 3.250 4.100 ? ? ? 0.041 ? ? 2.067 8.70 ? 673 73.6 19 1 4.100 50.000 ? ? ? 0.040 ? ? 1.748 10.00 ? 961 97.9 20 1 # _refine.entry_id 4QXL _refine.ls_d_res_high 1.5120 _refine.ls_d_res_low 34.9060 _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 92.6100 _refine.ls_number_reflns_obs 15847 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2012 _refine.ls_R_factor_R_work 0.1999 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2255 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.05 _refine.ls_number_reflns_R_free 800 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 14.2500 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.1300 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8555 _refine.B_iso_max 47.210 _refine.B_iso_min 4.800 _refine.pdbx_overall_phase_error 20.5900 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 855 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 86 _refine_hist.number_atoms_total 941 _refine_hist.d_res_high 1.5120 _refine_hist.d_res_low 34.9060 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 876 0.007 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1192 1.217 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 132 0.081 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 156 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 314 11.345 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 1.512 1.6066 6 96.0 2542 . 0.1845 0.2392 . 145 . 2687 . . 'X-RAY DIFFRACTION' 1.6066 1.7306 6 98.0 2601 . 0.1833 0.2171 . 134 . 2735 . . 'X-RAY DIFFRACTION' 1.7306 1.9048 6 97.0 2464 . 0.1962 0.2156 . 135 . 2599 . . 'X-RAY DIFFRACTION' 1.9048 2.1803 6 92.0 2479 . 0.2023 0.2251 . 135 . 2614 . . 'X-RAY DIFFRACTION' 2.1803 2.7468 6 85.0 2320 . 0.2223 0.2293 . 124 . 2444 . . 'X-RAY DIFFRACTION' 2.7468 34.9156 6 91.0 2641 . 0.1954 0.2259 . 127 . 2768 . . 'X-RAY DIFFRACTION' # _struct.entry_id 4QXL _struct.title 'Crystal Structure of FLHE' _struct.pdbx_descriptor 'Flagellar protein flhE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4QXL _struct_keywords.pdbx_keywords 'MOTOR PROTEIN' _struct_keywords.text 'beta-sandwich, flagellar type III secretion system, periplasmic, secretion pore plug, MOTOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 59 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 64 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 59 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 64 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.053 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 99 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 99 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 100 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 100 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.63 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 4 ? GLY A 10 ? GLY A 4 GLY A 10 A 2 ARG A 97 ? ARG A 114 ? ARG A 97 ARG A 114 A 3 THR A 14 ? TYR A 17 ? THR A 14 TYR A 17 B 1 GLY A 4 ? GLY A 10 ? GLY A 4 GLY A 10 B 2 ARG A 97 ? ARG A 114 ? ARG A 97 ARG A 114 B 3 VAL A 36 ? LEU A 46 ? VAL A 36 LEU A 46 B 4 SER A 71 ? THR A 74 ? SER A 71 THR A 74 C 1 SER A 21 ? SER A 23 ? SER A 21 SER A 23 C 2 ARG A 87 ? GLU A 91 ? ARG A 87 GLU A 91 C 3 ARG A 55 ? CYS A 59 ? ARG A 55 CYS A 59 C 4 CYS A 64 ? GLU A 66 ? CYS A 64 GLU A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 6 ? N TRP A 6 O VAL A 111 ? O VAL A 111 A 2 3 O LEU A 98 ? O LEU A 98 N ASN A 16 ? N ASN A 16 B 1 2 N TRP A 6 ? N TRP A 6 O VAL A 111 ? O VAL A 111 B 2 3 O ARG A 114 ? O ARG A 114 N VAL A 36 ? N VAL A 36 B 3 4 N VAL A 40 ? N VAL A 40 O THR A 74 ? O THR A 74 C 1 2 N ALA A 22 ? N ALA A 22 O TRP A 90 ? O TRP A 90 C 2 3 O GLU A 91 ? O GLU A 91 N ARG A 55 ? N ARG A 55 C 3 4 N LEU A 58 ? N LEU A 58 O VAL A 65 ? O VAL A 65 # _atom_sites.entry_id 4QXL _atom_sites.fract_transf_matrix[1][1] 0.039331 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027207 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008971 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 HIS 115 115 115 HIS ALA A . n A 1 116 HIS 116 116 ? ? ? A . n A 1 117 HIS 117 117 ? ? ? A . n A 1 118 HIS 118 118 ? ? ? A . n A 1 119 HIS 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 1 HOH HOH A . B 2 HOH 2 202 2 HOH HOH A . B 2 HOH 3 203 3 HOH HOH A . B 2 HOH 4 204 4 HOH HOH A . B 2 HOH 5 205 5 HOH HOH A . B 2 HOH 6 206 6 HOH HOH A . B 2 HOH 7 207 7 HOH HOH A . B 2 HOH 8 208 8 HOH HOH A . B 2 HOH 9 209 9 HOH HOH A . B 2 HOH 10 210 10 HOH HOH A . B 2 HOH 11 211 11 HOH HOH A . B 2 HOH 12 212 12 HOH HOH A . B 2 HOH 13 213 13 HOH HOH A . B 2 HOH 14 214 14 HOH HOH A . B 2 HOH 15 215 15 HOH HOH A . B 2 HOH 16 216 16 HOH HOH A . B 2 HOH 17 217 17 HOH HOH A . B 2 HOH 18 218 18 HOH HOH A . B 2 HOH 19 219 19 HOH HOH A . B 2 HOH 20 220 20 HOH HOH A . B 2 HOH 21 221 21 HOH HOH A . B 2 HOH 22 222 22 HOH HOH A . B 2 HOH 23 223 23 HOH HOH A . B 2 HOH 24 224 24 HOH HOH A . B 2 HOH 25 225 25 HOH HOH A . B 2 HOH 26 226 26 HOH HOH A . B 2 HOH 27 227 27 HOH HOH A . B 2 HOH 28 228 28 HOH HOH A . B 2 HOH 29 229 29 HOH HOH A . B 2 HOH 30 230 30 HOH HOH A . B 2 HOH 31 231 31 HOH HOH A . B 2 HOH 32 232 32 HOH HOH A . B 2 HOH 33 233 33 HOH HOH A . B 2 HOH 34 234 34 HOH HOH A . B 2 HOH 35 235 35 HOH HOH A . B 2 HOH 36 236 36 HOH HOH A . B 2 HOH 37 237 37 HOH HOH A . B 2 HOH 38 238 38 HOH HOH A . B 2 HOH 39 239 39 HOH HOH A . B 2 HOH 40 240 40 HOH HOH A . B 2 HOH 41 241 41 HOH HOH A . B 2 HOH 42 242 42 HOH HOH A . B 2 HOH 43 243 43 HOH HOH A . B 2 HOH 44 244 44 HOH HOH A . B 2 HOH 45 245 45 HOH HOH A . B 2 HOH 46 246 46 HOH HOH A . B 2 HOH 47 247 47 HOH HOH A . B 2 HOH 48 248 48 HOH HOH A . B 2 HOH 49 249 49 HOH HOH A . B 2 HOH 50 250 50 HOH HOH A . B 2 HOH 51 251 51 HOH HOH A . B 2 HOH 52 252 52 HOH HOH A . B 2 HOH 53 253 55 HOH HOH A . B 2 HOH 54 254 57 HOH HOH A . B 2 HOH 55 255 58 HOH HOH A . B 2 HOH 56 256 59 HOH HOH A . B 2 HOH 57 257 60 HOH HOH A . B 2 HOH 58 258 61 HOH HOH A . B 2 HOH 59 259 63 HOH HOH A . B 2 HOH 60 260 64 HOH HOH A . B 2 HOH 61 261 65 HOH HOH A . B 2 HOH 62 262 66 HOH HOH A . B 2 HOH 63 263 68 HOH HOH A . B 2 HOH 64 264 69 HOH HOH A . B 2 HOH 65 265 70 HOH HOH A . B 2 HOH 66 266 73 HOH HOH A . B 2 HOH 67 267 74 HOH HOH A . B 2 HOH 68 268 77 HOH HOH A . B 2 HOH 69 269 78 HOH HOH A . B 2 HOH 70 270 79 HOH HOH A . B 2 HOH 71 271 80 HOH HOH A . B 2 HOH 72 272 86 HOH HOH A . B 2 HOH 73 273 87 HOH HOH A . B 2 HOH 74 274 88 HOH HOH A . B 2 HOH 75 275 89 HOH HOH A . B 2 HOH 76 276 90 HOH HOH A . B 2 HOH 77 277 91 HOH HOH A . B 2 HOH 78 278 93 HOH HOH A . B 2 HOH 79 279 94 HOH HOH A . B 2 HOH 80 280 95 HOH HOH A . B 2 HOH 81 281 107 HOH HOH A . B 2 HOH 82 282 108 HOH HOH A . B 2 HOH 83 283 110 HOH HOH A . B 2 HOH 84 284 117 HOH HOH A . B 2 HOH 85 285 120 HOH HOH A . B 2 HOH 86 286 121 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-01-14 2 'Structure model' 1 1 2015-03-25 3 'Structure model' 1 2 2017-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHENIX 1.8.1_1168 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 4 PDB_EXTRACT 3.14 'Dec. 10, 2013' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 BOS . ? ? ? ? 'data collection' ? ? ? 6 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 7 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 8 PHENIX . ? ? ? ? phasing ? ? ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 18 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 211 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 38 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -118.54 _pdbx_validate_torsion.psi -83.23 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 45 ? CG ? A GLU 45 CG 2 1 Y 1 A GLU 45 ? CD ? A GLU 45 CD 3 1 Y 1 A GLU 45 ? OE1 ? A GLU 45 OE1 4 1 Y 1 A GLU 45 ? OE2 ? A GLU 45 OE2 5 1 Y 1 A ASP 68 ? CG ? A ASP 68 CG 6 1 Y 1 A ASP 68 ? OD1 ? A ASP 68 OD1 7 1 Y 1 A ASP 68 ? OD2 ? A ASP 68 OD2 8 1 Y 1 A HIS 115 ? CG ? A HIS 115 CG 9 1 Y 1 A HIS 115 ? ND1 ? A HIS 115 ND1 10 1 Y 1 A HIS 115 ? CD2 ? A HIS 115 CD2 11 1 Y 1 A HIS 115 ? CE1 ? A HIS 115 CE1 12 1 Y 1 A HIS 115 ? NE2 ? A HIS 115 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 116 ? A HIS 116 2 1 Y 1 A HIS 117 ? A HIS 117 3 1 Y 1 A HIS 118 ? A HIS 118 4 1 Y 1 A HIS 119 ? A HIS 119 5 1 Y 1 A HIS 120 ? A HIS 120 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #