data_4R5S # _entry.id 4R5S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.360 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4R5S pdb_00004r5s 10.2210/pdb4r5s/pdb RCSB RCSB086934 ? ? WWPDB D_1000086934 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4R5S _pdbx_database_status.recvd_initial_deposition_date 2014-08-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhu, S.J.' 1 'Yun, C.H.' 2 # _citation.id primary _citation.title 'Development of covalent inhibitors that can overcome resistance to first-generation FGFR kinase inhibitors.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 111 _citation.page_first E4869 _citation.page_last E4877 _citation.year 2014 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 1091-6490 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25349422 _citation.pdbx_database_id_DOI 10.1073/pnas.1403438111 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tan, L.' 1 ? primary 'Wang, J.' 2 ? primary 'Tanizaki, J.' 3 ? primary 'Huang, Z.' 4 ? primary 'Aref, A.R.' 5 ? primary 'Rusan, M.' 6 ? primary 'Zhu, S.J.' 7 ? primary 'Zhang, Y.' 8 ? primary 'Ercan, D.' 9 ? primary 'Liao, R.G.' 10 ? primary 'Capelletti, M.' 11 ? primary 'Zhou, W.' 12 ? primary 'Hur, W.' 13 ? primary 'Kim, N.' 14 ? primary 'Sim, T.' 15 ? primary 'Gaudet, S.' 16 ? primary 'Barbie, D.A.' 17 ? primary 'Yeh, J.R.' 18 ? primary 'Yun, C.H.' 19 ? primary 'Hammerman, P.S.' 20 ? primary 'Mohammadi, M.' 21 ? primary 'Janne, P.A.' 22 ? primary 'Gray, N.S.' 23 ? # _cell.entry_id 4R5S _cell.length_a 147.92 _cell.length_b 147.92 _cell.length_c 147.92 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4R5S _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37676.484 1 2.7.10.1 L858R 'UNP RESIDUES 696-1022' ? 2 non-polymer syn ;N-[4-({[(2,6-dichloro-3,5-dimethoxyphenyl)carbamoyl](6-{[4-(4-methylpiperazin-1-yl)phenyl]amino}pyrimidin-4-yl)amino}methyl)phenyl]propanamide ; 693.623 1 ? ? ? ? 3 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDN PHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHV KITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGE RLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVV DADEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDN PHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHV KITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGE RLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVV DADEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 SER n 1 5 GLY n 1 6 GLU n 1 7 ALA n 1 8 PRO n 1 9 ASN n 1 10 GLN n 1 11 ALA n 1 12 LEU n 1 13 LEU n 1 14 ARG n 1 15 ILE n 1 16 LEU n 1 17 LYS n 1 18 GLU n 1 19 THR n 1 20 GLU n 1 21 PHE n 1 22 LYS n 1 23 LYS n 1 24 ILE n 1 25 LYS n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 ALA n 1 32 PHE n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 TYR n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 TRP n 1 41 ILE n 1 42 PRO n 1 43 GLU n 1 44 GLY n 1 45 GLU n 1 46 LYS n 1 47 VAL n 1 48 LYS n 1 49 ILE n 1 50 PRO n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 LYS n 1 55 GLU n 1 56 LEU n 1 57 ARG n 1 58 GLU n 1 59 ALA n 1 60 THR n 1 61 SER n 1 62 PRO n 1 63 LYS n 1 64 ALA n 1 65 ASN n 1 66 LYS n 1 67 GLU n 1 68 ILE n 1 69 LEU n 1 70 ASP n 1 71 GLU n 1 72 ALA n 1 73 TYR n 1 74 VAL n 1 75 MET n 1 76 ALA n 1 77 SER n 1 78 VAL n 1 79 ASP n 1 80 ASN n 1 81 PRO n 1 82 HIS n 1 83 VAL n 1 84 CYS n 1 85 ARG n 1 86 LEU n 1 87 LEU n 1 88 GLY n 1 89 ILE n 1 90 CYS n 1 91 LEU n 1 92 THR n 1 93 SER n 1 94 THR n 1 95 VAL n 1 96 GLN n 1 97 LEU n 1 98 ILE n 1 99 THR n 1 100 GLN n 1 101 LEU n 1 102 MET n 1 103 PRO n 1 104 PHE n 1 105 GLY n 1 106 CYS n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 TYR n 1 111 VAL n 1 112 ARG n 1 113 GLU n 1 114 HIS n 1 115 LYS n 1 116 ASP n 1 117 ASN n 1 118 ILE n 1 119 GLY n 1 120 SER n 1 121 GLN n 1 122 TYR n 1 123 LEU n 1 124 LEU n 1 125 ASN n 1 126 TRP n 1 127 CYS n 1 128 VAL n 1 129 GLN n 1 130 ILE n 1 131 ALA n 1 132 LYS n 1 133 GLY n 1 134 MET n 1 135 ASN n 1 136 TYR n 1 137 LEU n 1 138 GLU n 1 139 ASP n 1 140 ARG n 1 141 ARG n 1 142 LEU n 1 143 VAL n 1 144 HIS n 1 145 ARG n 1 146 ASP n 1 147 LEU n 1 148 ALA n 1 149 ALA n 1 150 ARG n 1 151 ASN n 1 152 VAL n 1 153 LEU n 1 154 VAL n 1 155 LYS n 1 156 THR n 1 157 PRO n 1 158 GLN n 1 159 HIS n 1 160 VAL n 1 161 LYS n 1 162 ILE n 1 163 THR n 1 164 ASP n 1 165 PHE n 1 166 GLY n 1 167 ARG n 1 168 ALA n 1 169 LYS n 1 170 LEU n 1 171 LEU n 1 172 GLY n 1 173 ALA n 1 174 GLU n 1 175 GLU n 1 176 LYS n 1 177 GLU n 1 178 TYR n 1 179 HIS n 1 180 ALA n 1 181 GLU n 1 182 GLY n 1 183 GLY n 1 184 LYS n 1 185 VAL n 1 186 PRO n 1 187 ILE n 1 188 LYS n 1 189 TRP n 1 190 MET n 1 191 ALA n 1 192 LEU n 1 193 GLU n 1 194 SER n 1 195 ILE n 1 196 LEU n 1 197 HIS n 1 198 ARG n 1 199 ILE n 1 200 TYR n 1 201 THR n 1 202 HIS n 1 203 GLN n 1 204 SER n 1 205 ASP n 1 206 VAL n 1 207 TRP n 1 208 SER n 1 209 TYR n 1 210 GLY n 1 211 VAL n 1 212 THR n 1 213 VAL n 1 214 TRP n 1 215 GLU n 1 216 LEU n 1 217 MET n 1 218 THR n 1 219 PHE n 1 220 GLY n 1 221 SER n 1 222 LYS n 1 223 PRO n 1 224 TYR n 1 225 ASP n 1 226 GLY n 1 227 ILE n 1 228 PRO n 1 229 ALA n 1 230 SER n 1 231 GLU n 1 232 ILE n 1 233 SER n 1 234 SER n 1 235 ILE n 1 236 LEU n 1 237 GLU n 1 238 LYS n 1 239 GLY n 1 240 GLU n 1 241 ARG n 1 242 LEU n 1 243 PRO n 1 244 GLN n 1 245 PRO n 1 246 PRO n 1 247 ILE n 1 248 CYS n 1 249 THR n 1 250 ILE n 1 251 ASP n 1 252 VAL n 1 253 TYR n 1 254 MET n 1 255 ILE n 1 256 MET n 1 257 VAL n 1 258 LYS n 1 259 CYS n 1 260 TRP n 1 261 MET n 1 262 ILE n 1 263 ASP n 1 264 ALA n 1 265 ASP n 1 266 SER n 1 267 ARG n 1 268 PRO n 1 269 LYS n 1 270 PHE n 1 271 ARG n 1 272 GLU n 1 273 LEU n 1 274 ILE n 1 275 ILE n 1 276 GLU n 1 277 PHE n 1 278 SER n 1 279 LYS n 1 280 MET n 1 281 ALA n 1 282 ARG n 1 283 ASP n 1 284 PRO n 1 285 GLN n 1 286 ARG n 1 287 TYR n 1 288 LEU n 1 289 VAL n 1 290 ILE n 1 291 GLN n 1 292 GLY n 1 293 ASP n 1 294 GLU n 1 295 ARG n 1 296 MET n 1 297 HIS n 1 298 LEU n 1 299 PRO n 1 300 SER n 1 301 PRO n 1 302 THR n 1 303 ASP n 1 304 SER n 1 305 ASN n 1 306 PHE n 1 307 TYR n 1 308 ARG n 1 309 ALA n 1 310 LEU n 1 311 MET n 1 312 ASP n 1 313 GLU n 1 314 GLU n 1 315 ASP n 1 316 MET n 1 317 ASP n 1 318 ASP n 1 319 VAL n 1 320 VAL n 1 321 ASP n 1 322 ALA n 1 323 ASP n 1 324 GLU n 1 325 TYR n 1 326 LEU n 1 327 ILE n 1 328 PRO n 1 329 GLN n 1 330 GLN n 1 331 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQG ; _struct_ref.pdbx_align_begin 696 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4R5S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 331 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 696 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 696 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4R5S GLY A 1 ? UNP P00533 ? ? 'expression tag' 692 1 1 4R5S SER A 2 ? UNP P00533 ? ? 'expression tag' 693 2 1 4R5S PRO A 3 ? UNP P00533 ? ? 'expression tag' 694 3 1 4R5S SER A 4 ? UNP P00533 ? ? 'expression tag' 695 4 1 4R5S ARG A 167 ? UNP P00533 LEU 858 'engineered mutation' 858 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FI3 non-polymer . ;N-[4-({[(2,6-dichloro-3,5-dimethoxyphenyl)carbamoyl](6-{[4-(4-methylpiperazin-1-yl)phenyl]amino}pyrimidin-4-yl)amino}methyl)phenyl]propanamide ; ? 'C34 H38 Cl2 N8 O4' 693.623 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4R5S _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.58 _exptl_crystal.density_percent_sol 65.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '40% PEG 400, 150mM NaCl, 0.1M HEPES (pH 8.0), 5mM TCEP, 0.1M NDSB-211, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2014-03-19 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97913 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97913 # _reflns.entry_id 4R5S _reflns.observed_criterion_sigma_I -3.3 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 3.00 _reflns.number_obs 267837 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_rejects _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 3.00 3.23 99.7 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 3.23 3.56 100.0 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 3.56 4.07 99.9 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 4.07 5.13 100.0 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 5.13 50.0 99.9 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 # _refine.entry_id 4R5S _refine.ls_number_reflns_obs 10942 _refine.ls_number_reflns_all 10958 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 46.775 _refine.ls_d_res_high 3.001 _refine.ls_percent_reflns_obs 99.85 _refine.ls_R_factor_obs 0.2035 _refine.ls_R_factor_all 0.2086 _refine.ls_R_factor_R_work 0.2017 _refine.ls_R_factor_R_free 0.2390 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.79 _refine.ls_number_reflns_R_free 524 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.49 _refine.pdbx_overall_phase_error 26.86 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2367 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 2437 _refine_hist.d_res_high 3.001 _refine_hist.d_res_low 46.775 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.013 ? ? 2469 ? 'X-RAY DIFFRACTION' f_angle_d 1.425 ? ? 3348 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 19.898 ? ? 957 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.069 ? ? 374 ? 'X-RAY DIFFRACTION' f_plane_restr 0.009 ? ? 419 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs 'X-RAY DIFFRACTION' 4 3.0006 3.3025 2564 0.2897 100.00 0.3267 . . 130 . . . . 'X-RAY DIFFRACTION' 4 3.3025 3.7802 2569 0.2294 100.00 0.2743 . . 143 . . . . 'X-RAY DIFFRACTION' 4 3.7802 4.7620 2611 0.1829 100.00 0.2304 . . 124 . . . . 'X-RAY DIFFRACTION' 4 4.7620 46.7811 2674 0.1878 100.00 0.2110 . . 127 . . . . # _struct.entry_id 4R5S _struct.title 'Crystal structure of EGFR 696-1022 L858R in complex with FIIN-3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4R5S _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'EGFR, L858R, Kinase, FIIN-3, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 17 ? THR A 19 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 2 SER A 61 ? SER A 77 ? SER A 752 SER A 768 1 ? 17 HELX_P HELX_P3 3 CYS A 106 ? HIS A 114 ? CYS A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 4 LYS A 115 ? ILE A 118 ? LYS A 806 ILE A 809 5 ? 4 HELX_P HELX_P5 5 GLY A 119 ? ARG A 140 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 6 ALA A 148 ? ARG A 150 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 7 ALA A 191 ? ARG A 198 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P8 8 THR A 201 ? THR A 218 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P9 9 PRO A 228 ? GLY A 239 ? PRO A 919 GLY A 930 1 ? 12 HELX_P HELX_P10 10 THR A 249 ? TRP A 260 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P11 11 LYS A 269 ? ALA A 281 ? LYS A 960 ALA A 972 1 ? 13 HELX_P HELX_P12 12 ASP A 283 ? LEU A 288 ? ASP A 974 LEU A 979 1 ? 6 HELX_P HELX_P13 13 GLY A 292 ? MET A 296 ? GLY A 983 MET A 987 5 ? 5 HELX_P HELX_P14 14 ASP A 321 ? TYR A 325 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 106 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id FI3 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CAV _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 797 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id FI3 _struct_conn.ptnr2_auth_seq_id 1101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.813 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 21 ? SER A 29 ? PHE A 712 SER A 720 A 2 GLY A 33 ? TRP A 40 ? GLY A 724 TRP A 731 A 3 ILE A 49 ? LEU A 56 ? ILE A 740 LEU A 747 A 4 GLN A 96 ? GLN A 100 ? GLN A 787 GLN A 791 A 5 LEU A 86 ? CYS A 90 ? LEU A 777 CYS A 781 B 1 LEU A 142 ? VAL A 143 ? LEU A 833 VAL A 834 B 2 LYS A 169 ? LEU A 170 ? LYS A 860 LEU A 861 C 1 VAL A 152 ? THR A 156 ? VAL A 843 THR A 847 C 2 HIS A 159 ? ILE A 162 ? HIS A 850 ILE A 853 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 27 ? N LEU A 718 O VAL A 35 ? O VAL A 726 A 2 3 N TYR A 36 ? N TYR A 727 O ILE A 53 ? O ILE A 744 A 3 4 N LYS A 54 ? N LYS A 745 O LEU A 97 ? O LEU A 788 A 4 5 O ILE A 98 ? O ILE A 789 N LEU A 87 ? N LEU A 778 B 1 2 N VAL A 143 ? N VAL A 834 O LYS A 169 ? O LYS A 860 C 1 2 N LEU A 153 ? N LEU A 844 O LYS A 161 ? O LYS A 852 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FI3 _struct_site.pdbx_auth_seq_id 1101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'BINDING SITE FOR RESIDUE FI3 A 1101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 ALA A 52 ? ALA A 743 . ? 1_555 ? 2 AC1 13 LYS A 54 ? LYS A 745 . ? 1_555 ? 3 AC1 13 GLU A 71 ? GLU A 762 . ? 1_555 ? 4 AC1 13 LEU A 97 ? LEU A 788 . ? 1_555 ? 5 AC1 13 GLN A 100 ? GLN A 791 . ? 1_555 ? 6 AC1 13 LEU A 101 ? LEU A 792 . ? 1_555 ? 7 AC1 13 MET A 102 ? MET A 793 . ? 1_555 ? 8 AC1 13 GLY A 105 ? GLY A 796 . ? 1_555 ? 9 AC1 13 CYS A 106 ? CYS A 797 . ? 1_555 ? 10 AC1 13 ASP A 109 ? ASP A 800 . ? 1_555 ? 11 AC1 13 THR A 163 ? THR A 854 . ? 1_555 ? 12 AC1 13 ASP A 164 ? ASP A 855 . ? 1_555 ? 13 AC1 13 HOH C . ? HOH A 1212 . ? 1_555 ? # _database_PDB_matrix.entry_id 4R5S _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4R5S _atom_sites.fract_transf_matrix[1][1] 0.006761 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006761 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006761 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 692 ? ? ? A . n A 1 2 SER 2 693 ? ? ? A . n A 1 3 PRO 3 694 ? ? ? A . n A 1 4 SER 4 695 ? ? ? A . n A 1 5 GLY 5 696 ? ? ? A . n A 1 6 GLU 6 697 697 GLU GLU A . n A 1 7 ALA 7 698 698 ALA ALA A . n A 1 8 PRO 8 699 699 PRO PRO A . n A 1 9 ASN 9 700 700 ASN ASN A . n A 1 10 GLN 10 701 701 GLN GLN A . n A 1 11 ALA 11 702 702 ALA ALA A . n A 1 12 LEU 12 703 703 LEU LEU A . n A 1 13 LEU 13 704 704 LEU LEU A . n A 1 14 ARG 14 705 705 ARG ARG A . n A 1 15 ILE 15 706 706 ILE ILE A . n A 1 16 LEU 16 707 707 LEU LEU A . n A 1 17 LYS 17 708 708 LYS LYS A . n A 1 18 GLU 18 709 709 GLU GLU A . n A 1 19 THR 19 710 710 THR THR A . n A 1 20 GLU 20 711 711 GLU GLU A . n A 1 21 PHE 21 712 712 PHE PHE A . n A 1 22 LYS 22 713 713 LYS LYS A . n A 1 23 LYS 23 714 714 LYS LYS A . n A 1 24 ILE 24 715 715 ILE ILE A . n A 1 25 LYS 25 716 716 LYS LYS A . n A 1 26 VAL 26 717 717 VAL VAL A . n A 1 27 LEU 27 718 718 LEU LEU A . n A 1 28 GLY 28 719 719 GLY GLY A . n A 1 29 SER 29 720 720 SER SER A . n A 1 30 GLY 30 721 721 GLY GLY A . n A 1 31 ALA 31 722 722 ALA ALA A . n A 1 32 PHE 32 723 723 PHE PHE A . n A 1 33 GLY 33 724 724 GLY GLY A . n A 1 34 THR 34 725 725 THR THR A . n A 1 35 VAL 35 726 726 VAL VAL A . n A 1 36 TYR 36 727 727 TYR TYR A . n A 1 37 LYS 37 728 728 LYS LYS A . n A 1 38 GLY 38 729 729 GLY GLY A . n A 1 39 LEU 39 730 730 LEU LEU A . n A 1 40 TRP 40 731 731 TRP TRP A . n A 1 41 ILE 41 732 732 ILE ILE A . n A 1 42 PRO 42 733 733 PRO PRO A . n A 1 43 GLU 43 734 734 GLU GLU A . n A 1 44 GLY 44 735 735 GLY GLY A . n A 1 45 GLU 45 736 736 GLU GLU A . n A 1 46 LYS 46 737 737 LYS LYS A . n A 1 47 VAL 47 738 738 VAL VAL A . n A 1 48 LYS 48 739 739 LYS LYS A . n A 1 49 ILE 49 740 740 ILE ILE A . n A 1 50 PRO 50 741 741 PRO PRO A . n A 1 51 VAL 51 742 742 VAL VAL A . n A 1 52 ALA 52 743 743 ALA ALA A . n A 1 53 ILE 53 744 744 ILE ILE A . n A 1 54 LYS 54 745 745 LYS LYS A . n A 1 55 GLU 55 746 746 GLU GLU A . n A 1 56 LEU 56 747 747 LEU LEU A . n A 1 57 ARG 57 748 748 ARG ARG A . n A 1 58 GLU 58 749 749 GLU GLU A . n A 1 59 ALA 59 750 750 ALA ALA A . n A 1 60 THR 60 751 751 THR THR A . n A 1 61 SER 61 752 752 SER SER A . n A 1 62 PRO 62 753 753 PRO PRO A . n A 1 63 LYS 63 754 754 LYS LYS A . n A 1 64 ALA 64 755 755 ALA ALA A . n A 1 65 ASN 65 756 756 ASN ASN A . n A 1 66 LYS 66 757 757 LYS LYS A . n A 1 67 GLU 67 758 758 GLU GLU A . n A 1 68 ILE 68 759 759 ILE ILE A . n A 1 69 LEU 69 760 760 LEU LEU A . n A 1 70 ASP 70 761 761 ASP ASP A . n A 1 71 GLU 71 762 762 GLU GLU A . n A 1 72 ALA 72 763 763 ALA ALA A . n A 1 73 TYR 73 764 764 TYR TYR A . n A 1 74 VAL 74 765 765 VAL VAL A . n A 1 75 MET 75 766 766 MET MET A . n A 1 76 ALA 76 767 767 ALA ALA A . n A 1 77 SER 77 768 768 SER SER A . n A 1 78 VAL 78 769 769 VAL VAL A . n A 1 79 ASP 79 770 770 ASP ASP A . n A 1 80 ASN 80 771 771 ASN ASN A . n A 1 81 PRO 81 772 772 PRO PRO A . n A 1 82 HIS 82 773 773 HIS HIS A . n A 1 83 VAL 83 774 774 VAL VAL A . n A 1 84 CYS 84 775 775 CYS CYS A . n A 1 85 ARG 85 776 776 ARG ARG A . n A 1 86 LEU 86 777 777 LEU LEU A . n A 1 87 LEU 87 778 778 LEU LEU A . n A 1 88 GLY 88 779 779 GLY GLY A . n A 1 89 ILE 89 780 780 ILE ILE A . n A 1 90 CYS 90 781 781 CYS CYS A . n A 1 91 LEU 91 782 782 LEU LEU A . n A 1 92 THR 92 783 783 THR THR A . n A 1 93 SER 93 784 784 SER SER A . n A 1 94 THR 94 785 785 THR THR A . n A 1 95 VAL 95 786 786 VAL VAL A . n A 1 96 GLN 96 787 787 GLN GLN A . n A 1 97 LEU 97 788 788 LEU LEU A . n A 1 98 ILE 98 789 789 ILE ILE A . n A 1 99 THR 99 790 790 THR THR A . n A 1 100 GLN 100 791 791 GLN GLN A . n A 1 101 LEU 101 792 792 LEU LEU A . n A 1 102 MET 102 793 793 MET MET A . n A 1 103 PRO 103 794 794 PRO PRO A . n A 1 104 PHE 104 795 795 PHE PHE A . n A 1 105 GLY 105 796 796 GLY GLY A . n A 1 106 CYS 106 797 797 CYS DRG A . n A 1 107 LEU 107 798 798 LEU LEU A . n A 1 108 LEU 108 799 799 LEU LEU A . n A 1 109 ASP 109 800 800 ASP ASP A . n A 1 110 TYR 110 801 801 TYR TYR A . n A 1 111 VAL 111 802 802 VAL VAL A . n A 1 112 ARG 112 803 803 ARG ARG A . n A 1 113 GLU 113 804 804 GLU GLU A . n A 1 114 HIS 114 805 805 HIS HIS A . n A 1 115 LYS 115 806 806 LYS LYS A . n A 1 116 ASP 116 807 807 ASP ASP A . n A 1 117 ASN 117 808 808 ASN ASN A . n A 1 118 ILE 118 809 809 ILE ILE A . n A 1 119 GLY 119 810 810 GLY GLY A . n A 1 120 SER 120 811 811 SER SER A . n A 1 121 GLN 121 812 812 GLN GLN A . n A 1 122 TYR 122 813 813 TYR TYR A . n A 1 123 LEU 123 814 814 LEU LEU A . n A 1 124 LEU 124 815 815 LEU LEU A . n A 1 125 ASN 125 816 816 ASN ASN A . n A 1 126 TRP 126 817 817 TRP TRP A . n A 1 127 CYS 127 818 818 CYS CYS A . n A 1 128 VAL 128 819 819 VAL VAL A . n A 1 129 GLN 129 820 820 GLN GLN A . n A 1 130 ILE 130 821 821 ILE ILE A . n A 1 131 ALA 131 822 822 ALA ALA A . n A 1 132 LYS 132 823 823 LYS LYS A . n A 1 133 GLY 133 824 824 GLY GLY A . n A 1 134 MET 134 825 825 MET MET A . n A 1 135 ASN 135 826 826 ASN ASN A . n A 1 136 TYR 136 827 827 TYR TYR A . n A 1 137 LEU 137 828 828 LEU LEU A . n A 1 138 GLU 138 829 829 GLU GLU A . n A 1 139 ASP 139 830 830 ASP ASP A . n A 1 140 ARG 140 831 831 ARG ARG A . n A 1 141 ARG 141 832 832 ARG ARG A . n A 1 142 LEU 142 833 833 LEU LEU A . n A 1 143 VAL 143 834 834 VAL VAL A . n A 1 144 HIS 144 835 835 HIS HIS A . n A 1 145 ARG 145 836 836 ARG ARG A . n A 1 146 ASP 146 837 837 ASP ASP A . n A 1 147 LEU 147 838 838 LEU LEU A . n A 1 148 ALA 148 839 839 ALA ALA A . n A 1 149 ALA 149 840 840 ALA ALA A . n A 1 150 ARG 150 841 841 ARG ARG A . n A 1 151 ASN 151 842 842 ASN ASN A . n A 1 152 VAL 152 843 843 VAL VAL A . n A 1 153 LEU 153 844 844 LEU LEU A . n A 1 154 VAL 154 845 845 VAL VAL A . n A 1 155 LYS 155 846 846 LYS LYS A . n A 1 156 THR 156 847 847 THR THR A . n A 1 157 PRO 157 848 848 PRO PRO A . n A 1 158 GLN 158 849 849 GLN GLN A . n A 1 159 HIS 159 850 850 HIS HIS A . n A 1 160 VAL 160 851 851 VAL VAL A . n A 1 161 LYS 161 852 852 LYS LYS A . n A 1 162 ILE 162 853 853 ILE ILE A . n A 1 163 THR 163 854 854 THR THR A . n A 1 164 ASP 164 855 855 ASP ASP A . n A 1 165 PHE 165 856 856 PHE PHE A . n A 1 166 GLY 166 857 857 GLY GLY A . n A 1 167 ARG 167 858 858 ARG ARG A . n A 1 168 ALA 168 859 859 ALA ALA A . n A 1 169 LYS 169 860 860 LYS LYS A . n A 1 170 LEU 170 861 861 LEU LEU A . n A 1 171 LEU 171 862 862 LEU LEU A . n A 1 172 GLY 172 863 863 GLY GLY A . n A 1 173 ALA 173 864 864 ALA ALA A . n A 1 174 GLU 174 865 865 GLU GLU A . n A 1 175 GLU 175 866 866 GLU GLU A . n A 1 176 LYS 176 867 ? ? ? A . n A 1 177 GLU 177 868 ? ? ? A . n A 1 178 TYR 178 869 ? ? ? A . n A 1 179 HIS 179 870 ? ? ? A . n A 1 180 ALA 180 871 ? ? ? A . n A 1 181 GLU 181 872 ? ? ? A . n A 1 182 GLY 182 873 ? ? ? A . n A 1 183 GLY 183 874 ? ? ? A . n A 1 184 LYS 184 875 ? ? ? A . n A 1 185 VAL 185 876 876 VAL VAL A . n A 1 186 PRO 186 877 877 PRO PRO A . n A 1 187 ILE 187 878 878 ILE ILE A . n A 1 188 LYS 188 879 879 LYS LYS A . n A 1 189 TRP 189 880 880 TRP TRP A . n A 1 190 MET 190 881 881 MET MET A . n A 1 191 ALA 191 882 882 ALA ALA A . n A 1 192 LEU 192 883 883 LEU LEU A . n A 1 193 GLU 193 884 884 GLU GLU A . n A 1 194 SER 194 885 885 SER SER A . n A 1 195 ILE 195 886 886 ILE ILE A . n A 1 196 LEU 196 887 887 LEU LEU A . n A 1 197 HIS 197 888 888 HIS HIS A . n A 1 198 ARG 198 889 889 ARG ARG A . n A 1 199 ILE 199 890 890 ILE ILE A . n A 1 200 TYR 200 891 891 TYR TYR A . n A 1 201 THR 201 892 892 THR THR A . n A 1 202 HIS 202 893 893 HIS HIS A . n A 1 203 GLN 203 894 894 GLN GLN A . n A 1 204 SER 204 895 895 SER SER A . n A 1 205 ASP 205 896 896 ASP ASP A . n A 1 206 VAL 206 897 897 VAL VAL A . n A 1 207 TRP 207 898 898 TRP TRP A . n A 1 208 SER 208 899 899 SER SER A . n A 1 209 TYR 209 900 900 TYR TYR A . n A 1 210 GLY 210 901 901 GLY GLY A . n A 1 211 VAL 211 902 902 VAL VAL A . n A 1 212 THR 212 903 903 THR THR A . n A 1 213 VAL 213 904 904 VAL VAL A . n A 1 214 TRP 214 905 905 TRP TRP A . n A 1 215 GLU 215 906 906 GLU GLU A . n A 1 216 LEU 216 907 907 LEU LEU A . n A 1 217 MET 217 908 908 MET MET A . n A 1 218 THR 218 909 909 THR THR A . n A 1 219 PHE 219 910 910 PHE PHE A . n A 1 220 GLY 220 911 911 GLY GLY A . n A 1 221 SER 221 912 912 SER SER A . n A 1 222 LYS 222 913 913 LYS LYS A . n A 1 223 PRO 223 914 914 PRO PRO A . n A 1 224 TYR 224 915 915 TYR TYR A . n A 1 225 ASP 225 916 916 ASP ASP A . n A 1 226 GLY 226 917 917 GLY GLY A . n A 1 227 ILE 227 918 918 ILE ILE A . n A 1 228 PRO 228 919 919 PRO PRO A . n A 1 229 ALA 229 920 920 ALA ALA A . n A 1 230 SER 230 921 921 SER SER A . n A 1 231 GLU 231 922 922 GLU GLU A . n A 1 232 ILE 232 923 923 ILE ILE A . n A 1 233 SER 233 924 924 SER SER A . n A 1 234 SER 234 925 925 SER SER A . n A 1 235 ILE 235 926 926 ILE ILE A . n A 1 236 LEU 236 927 927 LEU LEU A . n A 1 237 GLU 237 928 928 GLU GLU A . n A 1 238 LYS 238 929 929 LYS LYS A . n A 1 239 GLY 239 930 930 GLY GLY A . n A 1 240 GLU 240 931 931 GLU GLU A . n A 1 241 ARG 241 932 932 ARG ARG A . n A 1 242 LEU 242 933 933 LEU LEU A . n A 1 243 PRO 243 934 934 PRO PRO A . n A 1 244 GLN 244 935 935 GLN GLN A . n A 1 245 PRO 245 936 936 PRO PRO A . n A 1 246 PRO 246 937 937 PRO PRO A . n A 1 247 ILE 247 938 938 ILE ILE A . n A 1 248 CYS 248 939 939 CYS CYS A . n A 1 249 THR 249 940 940 THR THR A . n A 1 250 ILE 250 941 941 ILE ILE A . n A 1 251 ASP 251 942 942 ASP ASP A . n A 1 252 VAL 252 943 943 VAL VAL A . n A 1 253 TYR 253 944 944 TYR TYR A . n A 1 254 MET 254 945 945 MET MET A . n A 1 255 ILE 255 946 946 ILE ILE A . n A 1 256 MET 256 947 947 MET MET A . n A 1 257 VAL 257 948 948 VAL VAL A . n A 1 258 LYS 258 949 949 LYS LYS A . n A 1 259 CYS 259 950 950 CYS CYS A . n A 1 260 TRP 260 951 951 TRP TRP A . n A 1 261 MET 261 952 952 MET MET A . n A 1 262 ILE 262 953 953 ILE ILE A . n A 1 263 ASP 263 954 954 ASP ASP A . n A 1 264 ALA 264 955 955 ALA ALA A . n A 1 265 ASP 265 956 956 ASP ASP A . n A 1 266 SER 266 957 957 SER SER A . n A 1 267 ARG 267 958 958 ARG ARG A . n A 1 268 PRO 268 959 959 PRO PRO A . n A 1 269 LYS 269 960 960 LYS LYS A . n A 1 270 PHE 270 961 961 PHE PHE A . n A 1 271 ARG 271 962 962 ARG ARG A . n A 1 272 GLU 272 963 963 GLU GLU A . n A 1 273 LEU 273 964 964 LEU LEU A . n A 1 274 ILE 274 965 965 ILE ILE A . n A 1 275 ILE 275 966 966 ILE ILE A . n A 1 276 GLU 276 967 967 GLU GLU A . n A 1 277 PHE 277 968 968 PHE PHE A . n A 1 278 SER 278 969 969 SER SER A . n A 1 279 LYS 279 970 970 LYS LYS A . n A 1 280 MET 280 971 971 MET MET A . n A 1 281 ALA 281 972 972 ALA ALA A . n A 1 282 ARG 282 973 973 ARG ARG A . n A 1 283 ASP 283 974 974 ASP ASP A . n A 1 284 PRO 284 975 975 PRO PRO A . n A 1 285 GLN 285 976 976 GLN GLN A . n A 1 286 ARG 286 977 977 ARG ARG A . n A 1 287 TYR 287 978 978 TYR TYR A . n A 1 288 LEU 288 979 979 LEU LEU A . n A 1 289 VAL 289 980 980 VAL VAL A . n A 1 290 ILE 290 981 981 ILE ILE A . n A 1 291 GLN 291 982 982 GLN GLN A . n A 1 292 GLY 292 983 983 GLY GLY A . n A 1 293 ASP 293 984 984 ASP ASP A . n A 1 294 GLU 294 985 985 GLU GLU A . n A 1 295 ARG 295 986 986 ARG ARG A . n A 1 296 MET 296 987 987 MET MET A . n A 1 297 HIS 297 988 988 HIS HIS A . n A 1 298 LEU 298 989 989 LEU LEU A . n A 1 299 PRO 299 990 990 PRO PRO A . n A 1 300 SER 300 991 ? ? ? A . n A 1 301 PRO 301 992 ? ? ? A . n A 1 302 THR 302 993 ? ? ? A . n A 1 303 ASP 303 994 ? ? ? A . n A 1 304 SER 304 995 ? ? ? A . n A 1 305 ASN 305 996 ? ? ? A . n A 1 306 PHE 306 997 ? ? ? A . n A 1 307 TYR 307 998 ? ? ? A . n A 1 308 ARG 308 999 ? ? ? A . n A 1 309 ALA 309 1000 ? ? ? A . n A 1 310 LEU 310 1001 ? ? ? A . n A 1 311 MET 311 1002 ? ? ? A . n A 1 312 ASP 312 1003 ? ? ? A . n A 1 313 GLU 313 1004 ? ? ? A . n A 1 314 GLU 314 1005 1005 GLU GLU A . n A 1 315 ASP 315 1006 1006 ASP ASP A . n A 1 316 MET 316 1007 1007 MET MET A . n A 1 317 ASP 317 1008 1008 ASP ASP A . n A 1 318 ASP 318 1009 1009 ASP ASP A . n A 1 319 VAL 319 1010 1010 VAL VAL A . n A 1 320 VAL 320 1011 1011 VAL VAL A . n A 1 321 ASP 321 1012 1012 ASP ASP A . n A 1 322 ALA 322 1013 1013 ALA ALA A . n A 1 323 ASP 323 1014 1014 ASP ASP A . n A 1 324 GLU 324 1015 1015 GLU GLU A . n A 1 325 TYR 325 1016 1016 TYR TYR A . n A 1 326 LEU 326 1017 1017 LEU LEU A . n A 1 327 ILE 327 1018 1018 ILE ILE A . n A 1 328 PRO 328 1019 ? ? ? A . n A 1 329 GLN 329 1020 ? ? ? A . n A 1 330 GLN 330 1021 ? ? ? A . n A 1 331 GLY 331 1022 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FI3 1 1101 797 FI3 DRG A . C 3 HOH 1 1201 1 HOH HOH A . C 3 HOH 2 1202 2 HOH HOH A . C 3 HOH 3 1203 4 HOH HOH A . C 3 HOH 4 1204 5 HOH HOH A . C 3 HOH 5 1205 6 HOH HOH A . C 3 HOH 6 1206 7 HOH HOH A . C 3 HOH 7 1207 8 HOH HOH A . C 3 HOH 8 1208 9 HOH HOH A . C 3 HOH 9 1209 10 HOH HOH A . C 3 HOH 10 1210 11 HOH HOH A . C 3 HOH 11 1211 12 HOH HOH A . C 3 HOH 12 1212 13 HOH HOH A . C 3 HOH 13 1213 14 HOH HOH A . C 3 HOH 14 1214 15 HOH HOH A . C 3 HOH 15 1215 16 HOH HOH A . C 3 HOH 16 1216 17 HOH HOH A . C 3 HOH 17 1217 18 HOH HOH A . C 3 HOH 18 1218 19 HOH HOH A . C 3 HOH 19 1219 20 HOH HOH A . C 3 HOH 20 1220 21 HOH HOH A . C 3 HOH 21 1221 22 HOH HOH A . C 3 HOH 22 1222 23 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-11-12 2 'Structure model' 1 1 2022-08-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' struct_conn 4 2 'Structure model' struct_ref_seq_dif 5 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_database_2.pdbx_DOI' 5 2 'Structure model' '_database_2.pdbx_database_accession' 6 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 2 'Structure model' '_struct_ref_seq_dif.details' 8 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 9 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 10 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHENIX 'model building' '(phenix.refine: 1.9_1692)' ? 2 PHENIX refinement '(phenix.refine: 1.9_1692)' ? 3 HKL-3000 'data reduction' . ? 4 HKL-3000 'data scaling' . ? 5 PHENIX phasing 1.9_1692 ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 820 ? ? -37.03 -36.23 2 1 ARG A 836 ? ? 78.34 -4.70 3 1 ASP A 837 ? ? -155.58 66.01 4 1 ILE A 878 ? ? 71.82 -57.07 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 709 ? CD ? A GLU 18 CD 2 1 Y 0 A GLU 734 ? CD ? A GLU 43 CD 3 1 Y 1 A GLU 736 ? CG ? A GLU 45 CG 4 1 Y 1 A GLU 736 ? CD ? A GLU 45 CD 5 1 Y 1 A GLU 736 ? OE1 ? A GLU 45 OE1 6 1 Y 1 A GLU 736 ? OE2 ? A GLU 45 OE2 7 1 Y 1 A GLU 749 ? CG ? A GLU 58 CG 8 1 Y 1 A GLU 749 ? CD ? A GLU 58 CD 9 1 Y 1 A GLU 749 ? OE1 ? A GLU 58 OE1 10 1 Y 1 A GLU 749 ? OE2 ? A GLU 58 OE2 11 1 Y 0 A GLU 804 ? CD ? A GLU 113 CD 12 1 Y 0 A ARG 832 ? CZ ? A ARG 141 CZ 13 1 Y 1 A LYS 860 ? CG ? A LYS 169 CG 14 1 Y 1 A LYS 860 ? CD ? A LYS 169 CD 15 1 Y 1 A LYS 860 ? CE ? A LYS 169 CE 16 1 Y 1 A LYS 860 ? NZ ? A LYS 169 NZ 17 1 Y 0 A GLU 922 ? CD ? A GLU 231 CD 18 1 Y 0 A ASP 956 ? CG ? A ASP 265 CG 19 1 Y 0 A GLU 985 ? CD ? A GLU 294 CD 20 1 Y 1 A ARG 986 ? CG ? A ARG 295 CG 21 1 Y 1 A ARG 986 ? CD ? A ARG 295 CD 22 1 Y 1 A ARG 986 ? NE ? A ARG 295 NE 23 1 Y 1 A ARG 986 ? CZ ? A ARG 295 CZ 24 1 Y 1 A ARG 986 ? NH1 ? A ARG 295 NH1 25 1 Y 1 A ARG 986 ? NH2 ? A ARG 295 NH2 26 1 Y 1 A HIS 988 ? CG ? A HIS 297 CG 27 1 Y 1 A HIS 988 ? ND1 ? A HIS 297 ND1 28 1 Y 1 A HIS 988 ? CD2 ? A HIS 297 CD2 29 1 Y 1 A HIS 988 ? CE1 ? A HIS 297 CE1 30 1 Y 1 A HIS 988 ? NE2 ? A HIS 297 NE2 31 1 Y 1 A GLU 1005 ? CG ? A GLU 314 CG 32 1 Y 1 A GLU 1005 ? CD ? A GLU 314 CD 33 1 Y 1 A GLU 1005 ? OE1 ? A GLU 314 OE1 34 1 Y 1 A GLU 1005 ? OE2 ? A GLU 314 OE2 35 1 Y 1 A MET 1007 ? CG ? A MET 316 CG 36 1 Y 1 A MET 1007 ? SD ? A MET 316 SD 37 1 Y 1 A MET 1007 ? CE ? A MET 316 CE 38 1 Y 1 A ASP 1009 ? CG ? A ASP 318 CG 39 1 Y 1 A ASP 1009 ? OD1 ? A ASP 318 OD1 40 1 Y 1 A ASP 1009 ? OD2 ? A ASP 318 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 692 ? A GLY 1 2 1 Y 1 A SER 693 ? A SER 2 3 1 Y 1 A PRO 694 ? A PRO 3 4 1 Y 1 A SER 695 ? A SER 4 5 1 Y 1 A GLY 696 ? A GLY 5 6 1 Y 1 A LYS 867 ? A LYS 176 7 1 Y 1 A GLU 868 ? A GLU 177 8 1 Y 1 A TYR 869 ? A TYR 178 9 1 Y 1 A HIS 870 ? A HIS 179 10 1 Y 1 A ALA 871 ? A ALA 180 11 1 Y 1 A GLU 872 ? A GLU 181 12 1 Y 1 A GLY 873 ? A GLY 182 13 1 Y 1 A GLY 874 ? A GLY 183 14 1 Y 1 A LYS 875 ? A LYS 184 15 1 Y 1 A SER 991 ? A SER 300 16 1 Y 1 A PRO 992 ? A PRO 301 17 1 Y 1 A THR 993 ? A THR 302 18 1 Y 1 A ASP 994 ? A ASP 303 19 1 Y 1 A SER 995 ? A SER 304 20 1 Y 1 A ASN 996 ? A ASN 305 21 1 Y 1 A PHE 997 ? A PHE 306 22 1 Y 1 A TYR 998 ? A TYR 307 23 1 Y 1 A ARG 999 ? A ARG 308 24 1 Y 1 A ALA 1000 ? A ALA 309 25 1 Y 1 A LEU 1001 ? A LEU 310 26 1 Y 1 A MET 1002 ? A MET 311 27 1 Y 1 A ASP 1003 ? A ASP 312 28 1 Y 1 A GLU 1004 ? A GLU 313 29 1 Y 1 A PRO 1019 ? A PRO 328 30 1 Y 1 A GLN 1020 ? A GLN 329 31 1 Y 1 A GLN 1021 ? A GLN 330 32 1 Y 1 A GLY 1022 ? A GLY 331 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-[4-({[(2,6-dichloro-3,5-dimethoxyphenyl)carbamoyl](6-{[4-(4-methylpiperazin-1-yl)phenyl]amino}pyrimidin-4-yl)amino}methyl)phenyl]propanamide ; FI3 3 water HOH #