data_4RBT # _entry.id 4RBT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4RBT RCSB RCSB087150 WWPDB D_1000087150 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4RBU 'Different pore mutant' unspecified PDB 4RBV 'Different pore mutant' unspecified # _pdbx_database_status.entry_id 4RBT _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-09-12 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chun, S.' 1 'Sawaya, M.R.' 2 'Yeates, T.O.' 3 # _citation.id primary _citation.title 'Selective molecular transport through the protein shell of a bacterial microcompartment organelle.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 112 _citation.page_first 2990 _citation.page_last 2995 _citation.year 2015 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25713376 _citation.pdbx_database_id_DOI 10.1073/pnas.1423672112 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chowdhury, C.' 1 primary 'Chun, S.' 2 primary 'Pang, A.' 3 primary 'Sawaya, M.R.' 4 primary 'Sinha, S.' 5 primary 'Yeates, T.O.' 6 primary 'Bobik, T.A.' 7 # _cell.length_a 116.820 _cell.length_b 116.820 _cell.length_c 64.080 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4RBT _cell.pdbx_unique_axis ? _cell.Z_PDB 36 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 6 2 2' _symmetry.entry_id 4RBT _symmetry.Int_Tables_number 177 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Propanediol utilization protein PduA' 10401.016 3 ? 'K26A, S40L' 'UNP residues 2-94' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHQQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGLGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAV HVIPRPHTDVEKILPKGISQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHQQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGLGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAV HVIPRPHTDVEKILPKGISQ ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLN n 1 9 GLN n 1 10 GLU n 1 11 ALA n 1 12 LEU n 1 13 GLY n 1 14 MET n 1 15 VAL n 1 16 GLU n 1 17 THR n 1 18 LYS n 1 19 GLY n 1 20 LEU n 1 21 THR n 1 22 ALA n 1 23 ALA n 1 24 ILE n 1 25 GLU n 1 26 ALA n 1 27 ALA n 1 28 ASP n 1 29 ALA n 1 30 MET n 1 31 VAL n 1 32 ALA n 1 33 SER n 1 34 ALA n 1 35 ASN n 1 36 VAL n 1 37 MET n 1 38 LEU n 1 39 VAL n 1 40 GLY n 1 41 TYR n 1 42 GLU n 1 43 LYS n 1 44 ILE n 1 45 GLY n 1 46 LEU n 1 47 GLY n 1 48 LEU n 1 49 VAL n 1 50 THR n 1 51 VAL n 1 52 ILE n 1 53 VAL n 1 54 ARG n 1 55 GLY n 1 56 ASP n 1 57 VAL n 1 58 GLY n 1 59 ALA n 1 60 VAL n 1 61 LYS n 1 62 ALA n 1 63 ALA n 1 64 THR n 1 65 ASP n 1 66 ALA n 1 67 GLY n 1 68 ALA n 1 69 ALA n 1 70 ALA n 1 71 ALA n 1 72 ARG n 1 73 ASN n 1 74 VAL n 1 75 GLY n 1 76 GLU n 1 77 VAL n 1 78 LYS n 1 79 ALA n 1 80 VAL n 1 81 HIS n 1 82 VAL n 1 83 ILE n 1 84 PRO n 1 85 ARG n 1 86 PRO n 1 87 HIS n 1 88 THR n 1 89 ASP n 1 90 VAL n 1 91 GLU n 1 92 LYS n 1 93 ILE n 1 94 LEU n 1 95 PRO n 1 96 LYS n 1 97 GLY n 1 98 ILE n 1 99 SER n 1 100 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PduA, STM2038' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain LT2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica subsp. enterica serovar Typhimurium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 99287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 CodonPlus(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDUA_SALTY _struct_ref.pdbx_db_accession P0A1C7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QQEALGMVETKGLTAAIEAADAMVKSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPH TDVEKILPKGISQ ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4RBT A 8 ? 100 ? P0A1C7 2 ? 94 ? 2 94 2 1 4RBT B 8 ? 100 ? P0A1C7 2 ? 94 ? 2 94 3 1 4RBT C 8 ? 100 ? P0A1C7 2 ? 94 ? 2 94 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4RBT MET A 1 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -5 1 1 4RBT HIS A 2 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -4 2 1 4RBT HIS A 3 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -3 3 1 4RBT HIS A 4 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -2 4 1 4RBT HIS A 5 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -1 5 1 4RBT HIS A 6 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' 0 6 1 4RBT HIS A 7 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' 1 7 1 4RBT ALA A 32 ? UNP P0A1C7 LYS 26 'ENGINEERED MUTATION' 26 8 1 4RBT LEU A 46 ? UNP P0A1C7 SER 40 'ENGINEERED MUTATION' 40 9 2 4RBT MET B 1 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -5 10 2 4RBT HIS B 2 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -4 11 2 4RBT HIS B 3 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -3 12 2 4RBT HIS B 4 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -2 13 2 4RBT HIS B 5 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -1 14 2 4RBT HIS B 6 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' 0 15 2 4RBT HIS B 7 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' 1 16 2 4RBT ALA B 32 ? UNP P0A1C7 LYS 26 'ENGINEERED MUTATION' 26 17 2 4RBT LEU B 46 ? UNP P0A1C7 SER 40 'ENGINEERED MUTATION' 40 18 3 4RBT MET C 1 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -5 19 3 4RBT HIS C 2 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -4 20 3 4RBT HIS C 3 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -3 21 3 4RBT HIS C 4 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -2 22 3 4RBT HIS C 5 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' -1 23 3 4RBT HIS C 6 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' 0 24 3 4RBT HIS C 7 ? UNP P0A1C7 ? ? 'EXPRESSION TAG' 1 25 3 4RBT ALA C 32 ? UNP P0A1C7 LYS 26 'ENGINEERED MUTATION' 26 26 3 4RBT LEU C 46 ? UNP P0A1C7 SER 40 'ENGINEERED MUTATION' 40 27 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4RBT _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 39.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details '0.1M MES sodium salt pH 6.5, 2.0M Ammonium sulfate, 5% w/v PEG 400, vapor diffusion, hanging drop, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.pdbx_collection_date 2014-04-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.pdbx_wavelength_list 0.97920 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 24-ID-C # _reflns.entry_id 4RBT _reflns.d_resolution_high 2.300 _reflns.number_obs 11772 _reflns.pdbx_Rmerge_I_obs 0.102 _reflns.pdbx_netI_over_sigmaI 15.560 _reflns.pdbx_chi_squared 0.983 _reflns.percent_possible_obs 98.600 _reflns.B_iso_Wilson_estimate 50.920 _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 54.134 _reflns.number_all 11772 _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.300 2.360 4542 ? 801 0.014 1.080 ? ? ? ? ? 94.200 1 1 2.360 2.420 5977 ? 831 0.014 1.540 ? ? ? ? ? 98.700 2 1 2.420 2.500 7033 ? 814 0.014 2.320 ? ? ? ? ? 99.600 3 1 2.500 2.570 8310 ? 789 0.014 3.050 ? ? ? ? ? 99.700 4 1 2.570 2.660 10601 ? 775 0.014 3.950 ? ? ? ? ? 99.900 5 1 2.660 2.750 12065 ? 736 0.014 5.700 ? ? ? ? ? 99.500 6 1 2.750 2.850 11934 ? 723 0.014 7.050 ? ? ? ? ? 99.400 7 1 2.850 2.970 11145 ? 690 0.014 8.040 ? ? ? ? ? 99.300 8 1 2.970 3.100 10055 ? 666 0.014 10.600 ? ? ? ? ? 99.100 9 1 3.100 3.250 10594 ? 640 0.014 13.380 ? ? ? ? ? 99.400 10 1 3.250 3.430 10008 ? 611 0.014 17.810 ? ? ? ? ? 99.300 11 1 3.430 3.640 9140 ? 571 0.014 22.990 ? ? ? ? ? 99.000 12 1 3.640 3.890 8240 ? 552 0.014 26.680 ? ? ? ? ? 99.100 13 1 3.890 4.200 8504 ? 512 0.014 32.210 ? ? ? ? ? 99.000 14 1 4.200 4.600 7676 ? 475 0.014 39.720 ? ? ? ? ? 97.500 15 1 4.600 5.140 6503 ? 430 0.014 42.540 ? ? ? ? ? 98.900 16 1 5.140 5.940 6317 ? 389 0.014 39.820 ? ? ? ? ? 97.700 17 1 5.940 7.270 4962 ? 332 0.014 40.660 ? ? ? ? ? 97.400 18 1 7.270 10.290 3989 ? 269 0.014 52.210 ? ? ? ? ? 97.100 19 1 # _refine.entry_id 4RBT _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 54.134 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.5800 _refine.ls_number_reflns_obs 11771 _refine.ls_number_reflns_all 11771 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all 0.2328 _refine.ls_R_factor_obs 0.2328 _refine.ls_R_factor_R_work 0.2289 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2679 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_number_reflns_R_free 1178 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 80.2600 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 6.2816 _refine.aniso_B[2][2] 6.2816 _refine.aniso_B[3][3] -12.5631 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9444 _refine.correlation_coeff_Fo_to_Fc_free 0.9288 _refine.overall_SU_R_Cruickshank_DPI 0.3190 _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 3NGK _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 164.730 _refine.B_iso_min 39.420 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 4RBT _refine_analyze.Luzzati_coordinate_error_obs 0.624 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1738 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1747 _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 54.134 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id t_dihedral_angle_d 608 ? ? 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes 31 ? ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes 263 ? ? 5.000 HARMONIC 'X-RAY DIFFRACTION' t_it 1751 ? ? 20.000 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? ? ? ? 'X-RAY DIFFRACTION' t_improper_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_pseud_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion 254 ? ? 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_sum_occupancies ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_distance ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_ideal_dist_contact 1945 ? ? 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_bond_d 1751 0.010 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 2380 1.280 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion ? 2.740 ? ? ? 'X-RAY DIFFRACTION' t_other_torsion ? 20.480 ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.3000 _refine_ls_shell.d_res_low 2.5200 _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.percent_reflns_obs 98.5800 _refine_ls_shell.number_reflns_R_work 2425 _refine_ls_shell.R_factor_all 0.2420 _refine_ls_shell.R_factor_R_work 0.2356 _refine_ls_shell.R_factor_R_free 0.3006 _refine_ls_shell.percent_reflns_R_free 10.0200 _refine_ls_shell.number_reflns_R_free 270 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2695 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4RBT _struct.title 'PduA K26A S40L mutant, from Salmonella enterica serovar Typhimurium LT2' _struct.pdbx_descriptor 'Propanediol utilization protein PduA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4RBT _struct_keywords.text 'Bacterial Microcompartment shell protein, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 19 ? ALA A 34 ? GLY A 13 ALA A 28 1 ? 16 HELX_P HELX_P2 2 VAL A 57 ? ARG A 72 ? VAL A 51 ARG A 66 1 ? 16 HELX_P HELX_P3 3 GLY B 19 ? ALA B 34 ? GLY B 13 ALA B 28 1 ? 16 HELX_P HELX_P4 4 ASP B 56 ? ARG B 72 ? ASP B 50 ARG B 66 1 ? 17 HELX_P HELX_P5 5 GLY C 19 ? ALA C 32 ? GLY C 13 ALA C 26 1 ? 14 HELX_P HELX_P6 6 ASP C 56 ? ARG C 72 ? ASP C 50 ARG C 66 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 37 ? GLY A 45 ? MET A 31 GLY A 39 A 2 LEU A 48 ? ASP A 56 ? LEU A 42 ASP A 50 A 3 GLU A 10 ? LYS A 18 ? GLU A 4 LYS A 12 A 4 GLU A 76 ? ARG A 85 ? GLU A 70 ARG A 79 B 1 MET B 37 ? GLY B 45 ? MET B 31 GLY B 39 B 2 LEU B 48 ? GLY B 55 ? LEU B 42 GLY B 49 B 3 ALA B 11 ? LYS B 18 ? ALA B 5 LYS B 12 B 4 GLU B 76 ? ILE B 83 ? GLU B 70 ILE B 77 C 1 VAL C 36 ? GLY C 45 ? VAL C 30 GLY C 39 C 2 LEU C 48 ? GLY C 55 ? LEU C 42 GLY C 49 C 3 ALA C 11 ? LYS C 18 ? ALA C 5 LYS C 12 C 4 GLU C 76 ? PRO C 84 ? GLU C 70 PRO C 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 37 ? N MET A 31 O ARG A 54 ? O ARG A 48 A 2 3 O VAL A 49 ? O VAL A 43 N THR A 17 ? N THR A 11 A 3 4 N GLU A 10 ? N GLU A 4 O ARG A 85 ? O ARG A 79 B 1 2 N MET B 37 ? N MET B 31 O ARG B 54 ? O ARG B 48 B 2 3 O VAL B 49 ? O VAL B 43 N THR B 17 ? N THR B 11 B 3 4 N LEU B 12 ? N LEU B 6 O ILE B 83 ? O ILE B 77 C 1 2 N MET C 37 ? N MET C 31 O ARG C 54 ? O ARG C 48 C 2 3 O VAL C 49 ? O VAL C 43 N THR C 17 ? N THR C 11 C 3 4 N LEU C 12 ? N LEU C 6 O ILE C 83 ? O ILE C 77 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ARG A 54 ? ARG A 48 . ? 1_555 ? 2 AC1 5 THR A 88 ? THR A 82 . ? 1_555 ? 3 AC1 5 ASP A 89 ? ASP A 83 . ? 1_555 ? 4 AC1 5 VAL A 90 ? VAL A 84 . ? 1_555 ? 5 AC1 5 GLU A 91 ? GLU A 85 . ? 1_555 ? # _atom_sites.entry_id 4RBT _atom_sites.fract_transf_matrix[1][1] 0.008560 _atom_sites.fract_transf_matrix[1][2] 0.004942 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009884 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015605 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 HIS 2 -4 ? ? ? A . n A 1 3 HIS 3 -3 ? ? ? A . n A 1 4 HIS 4 -2 ? ? ? A . n A 1 5 HIS 5 -1 ? ? ? A . n A 1 6 HIS 6 0 ? ? ? A . n A 1 7 HIS 7 1 ? ? ? A . n A 1 8 GLN 8 2 2 GLN GLN A . n A 1 9 GLN 9 3 3 GLN GLN A . n A 1 10 GLU 10 4 4 GLU GLU A . n A 1 11 ALA 11 5 5 ALA ALA A . n A 1 12 LEU 12 6 6 LEU LEU A . n A 1 13 GLY 13 7 7 GLY GLY A . n A 1 14 MET 14 8 8 MET MET A . n A 1 15 VAL 15 9 9 VAL VAL A . n A 1 16 GLU 16 10 10 GLU GLU A . n A 1 17 THR 17 11 11 THR THR A . n A 1 18 LYS 18 12 12 LYS LYS A . n A 1 19 GLY 19 13 13 GLY GLY A . n A 1 20 LEU 20 14 14 LEU LEU A . n A 1 21 THR 21 15 15 THR THR A . n A 1 22 ALA 22 16 16 ALA ALA A . n A 1 23 ALA 23 17 17 ALA ALA A . n A 1 24 ILE 24 18 18 ILE ILE A . n A 1 25 GLU 25 19 19 GLU GLU A . n A 1 26 ALA 26 20 20 ALA ALA A . n A 1 27 ALA 27 21 21 ALA ALA A . n A 1 28 ASP 28 22 22 ASP ASP A . n A 1 29 ALA 29 23 23 ALA ALA A . n A 1 30 MET 30 24 24 MET MET A . n A 1 31 VAL 31 25 25 VAL VAL A . n A 1 32 ALA 32 26 26 ALA ALA A . n A 1 33 SER 33 27 27 SER SER A . n A 1 34 ALA 34 28 28 ALA ALA A . n A 1 35 ASN 35 29 29 ASN ASN A . n A 1 36 VAL 36 30 30 VAL VAL A . n A 1 37 MET 37 31 31 MET MET A . n A 1 38 LEU 38 32 32 LEU LEU A . n A 1 39 VAL 39 33 33 VAL VAL A . n A 1 40 GLY 40 34 34 GLY GLY A . n A 1 41 TYR 41 35 35 TYR TYR A . n A 1 42 GLU 42 36 36 GLU GLU A . n A 1 43 LYS 43 37 37 LYS LYS A . n A 1 44 ILE 44 38 38 ILE ILE A . n A 1 45 GLY 45 39 39 GLY GLY A . n A 1 46 LEU 46 40 40 LEU LEU A . n A 1 47 GLY 47 41 41 GLY GLY A . n A 1 48 LEU 48 42 42 LEU LEU A . n A 1 49 VAL 49 43 43 VAL VAL A . n A 1 50 THR 50 44 44 THR THR A . n A 1 51 VAL 51 45 45 VAL VAL A . n A 1 52 ILE 52 46 46 ILE ILE A . n A 1 53 VAL 53 47 47 VAL VAL A . n A 1 54 ARG 54 48 48 ARG ARG A . n A 1 55 GLY 55 49 49 GLY GLY A . n A 1 56 ASP 56 50 50 ASP ASP A . n A 1 57 VAL 57 51 51 VAL VAL A . n A 1 58 GLY 58 52 52 GLY GLY A . n A 1 59 ALA 59 53 53 ALA ALA A . n A 1 60 VAL 60 54 54 VAL VAL A . n A 1 61 LYS 61 55 55 LYS LYS A . n A 1 62 ALA 62 56 56 ALA ALA A . n A 1 63 ALA 63 57 57 ALA ALA A . n A 1 64 THR 64 58 58 THR THR A . n A 1 65 ASP 65 59 59 ASP ASP A . n A 1 66 ALA 66 60 60 ALA ALA A . n A 1 67 GLY 67 61 61 GLY GLY A . n A 1 68 ALA 68 62 62 ALA ALA A . n A 1 69 ALA 69 63 63 ALA ALA A . n A 1 70 ALA 70 64 64 ALA ALA A . n A 1 71 ALA 71 65 65 ALA ALA A . n A 1 72 ARG 72 66 66 ARG ARG A . n A 1 73 ASN 73 67 67 ASN ASN A . n A 1 74 VAL 74 68 68 VAL VAL A . n A 1 75 GLY 75 69 69 GLY GLY A . n A 1 76 GLU 76 70 70 GLU GLU A . n A 1 77 VAL 77 71 71 VAL VAL A . n A 1 78 LYS 78 72 72 LYS LYS A . n A 1 79 ALA 79 73 73 ALA ALA A . n A 1 80 VAL 80 74 74 VAL VAL A . n A 1 81 HIS 81 75 75 HIS HIS A . n A 1 82 VAL 82 76 76 VAL VAL A . n A 1 83 ILE 83 77 77 ILE ILE A . n A 1 84 PRO 84 78 78 PRO PRO A . n A 1 85 ARG 85 79 79 ARG ARG A . n A 1 86 PRO 86 80 80 PRO PRO A . n A 1 87 HIS 87 81 81 HIS HIS A . n A 1 88 THR 88 82 82 THR THR A . n A 1 89 ASP 89 83 83 ASP ASP A . n A 1 90 VAL 90 84 84 VAL VAL A . n A 1 91 GLU 91 85 85 GLU GLU A . n A 1 92 LYS 92 86 86 LYS LYS A . n A 1 93 ILE 93 87 87 ILE ILE A . n A 1 94 LEU 94 88 88 LEU LEU A . n A 1 95 PRO 95 89 89 PRO PRO A . n A 1 96 LYS 96 90 90 LYS LYS A . n A 1 97 GLY 97 91 ? ? ? A . n A 1 98 ILE 98 92 ? ? ? A . n A 1 99 SER 99 93 ? ? ? A . n A 1 100 GLN 100 94 ? ? ? A . n B 1 1 MET 1 -5 ? ? ? B . n B 1 2 HIS 2 -4 ? ? ? B . n B 1 3 HIS 3 -3 ? ? ? B . n B 1 4 HIS 4 -2 ? ? ? B . n B 1 5 HIS 5 -1 ? ? ? B . n B 1 6 HIS 6 0 ? ? ? B . n B 1 7 HIS 7 1 ? ? ? B . n B 1 8 GLN 8 2 ? ? ? B . n B 1 9 GLN 9 3 ? ? ? B . n B 1 10 GLU 10 4 4 GLU GLU B . n B 1 11 ALA 11 5 5 ALA ALA B . n B 1 12 LEU 12 6 6 LEU LEU B . n B 1 13 GLY 13 7 7 GLY GLY B . n B 1 14 MET 14 8 8 MET MET B . n B 1 15 VAL 15 9 9 VAL VAL B . n B 1 16 GLU 16 10 10 GLU GLU B . n B 1 17 THR 17 11 11 THR THR B . n B 1 18 LYS 18 12 12 LYS LYS B . n B 1 19 GLY 19 13 13 GLY GLY B . n B 1 20 LEU 20 14 14 LEU LEU B . n B 1 21 THR 21 15 15 THR THR B . n B 1 22 ALA 22 16 16 ALA ALA B . n B 1 23 ALA 23 17 17 ALA ALA B . n B 1 24 ILE 24 18 18 ILE ILE B . n B 1 25 GLU 25 19 19 GLU GLU B . n B 1 26 ALA 26 20 20 ALA ALA B . n B 1 27 ALA 27 21 21 ALA ALA B . n B 1 28 ASP 28 22 22 ASP ASP B . n B 1 29 ALA 29 23 23 ALA ALA B . n B 1 30 MET 30 24 24 MET MET B . n B 1 31 VAL 31 25 25 VAL VAL B . n B 1 32 ALA 32 26 26 ALA ALA B . n B 1 33 SER 33 27 27 SER SER B . n B 1 34 ALA 34 28 28 ALA ALA B . n B 1 35 ASN 35 29 29 ASN ASN B . n B 1 36 VAL 36 30 30 VAL VAL B . n B 1 37 MET 37 31 31 MET MET B . n B 1 38 LEU 38 32 32 LEU LEU B . n B 1 39 VAL 39 33 33 VAL VAL B . n B 1 40 GLY 40 34 34 GLY GLY B . n B 1 41 TYR 41 35 35 TYR TYR B . n B 1 42 GLU 42 36 36 GLU GLU B . n B 1 43 LYS 43 37 37 LYS LYS B . n B 1 44 ILE 44 38 38 ILE ILE B . n B 1 45 GLY 45 39 39 GLY GLY B . n B 1 46 LEU 46 40 40 LEU LEU B . n B 1 47 GLY 47 41 41 GLY GLY B . n B 1 48 LEU 48 42 42 LEU LEU B . n B 1 49 VAL 49 43 43 VAL VAL B . n B 1 50 THR 50 44 44 THR THR B . n B 1 51 VAL 51 45 45 VAL VAL B . n B 1 52 ILE 52 46 46 ILE ILE B . n B 1 53 VAL 53 47 47 VAL VAL B . n B 1 54 ARG 54 48 48 ARG ARG B . n B 1 55 GLY 55 49 49 GLY GLY B . n B 1 56 ASP 56 50 50 ASP ASP B . n B 1 57 VAL 57 51 51 VAL VAL B . n B 1 58 GLY 58 52 52 GLY GLY B . n B 1 59 ALA 59 53 53 ALA ALA B . n B 1 60 VAL 60 54 54 VAL VAL B . n B 1 61 LYS 61 55 55 LYS LYS B . n B 1 62 ALA 62 56 56 ALA ALA B . n B 1 63 ALA 63 57 57 ALA ALA B . n B 1 64 THR 64 58 58 THR THR B . n B 1 65 ASP 65 59 59 ASP ASP B . n B 1 66 ALA 66 60 60 ALA ALA B . n B 1 67 GLY 67 61 61 GLY GLY B . n B 1 68 ALA 68 62 62 ALA ALA B . n B 1 69 ALA 69 63 63 ALA ALA B . n B 1 70 ALA 70 64 64 ALA ALA B . n B 1 71 ALA 71 65 65 ALA ALA B . n B 1 72 ARG 72 66 66 ARG ARG B . n B 1 73 ASN 73 67 67 ASN ASN B . n B 1 74 VAL 74 68 68 VAL VAL B . n B 1 75 GLY 75 69 69 GLY GLY B . n B 1 76 GLU 76 70 70 GLU GLU B . n B 1 77 VAL 77 71 71 VAL VAL B . n B 1 78 LYS 78 72 72 LYS LYS B . n B 1 79 ALA 79 73 73 ALA ALA B . n B 1 80 VAL 80 74 74 VAL VAL B . n B 1 81 HIS 81 75 75 HIS HIS B . n B 1 82 VAL 82 76 76 VAL VAL B . n B 1 83 ILE 83 77 77 ILE ILE B . n B 1 84 PRO 84 78 78 PRO PRO B . n B 1 85 ARG 85 79 79 ARG ARG B . n B 1 86 PRO 86 80 80 PRO PRO B . n B 1 87 HIS 87 81 ? ? ? B . n B 1 88 THR 88 82 ? ? ? B . n B 1 89 ASP 89 83 ? ? ? B . n B 1 90 VAL 90 84 ? ? ? B . n B 1 91 GLU 91 85 85 GLU GLU B . n B 1 92 LYS 92 86 86 LYS LYS B . n B 1 93 ILE 93 87 87 ILE ILE B . n B 1 94 LEU 94 88 88 LEU LEU B . n B 1 95 PRO 95 89 89 PRO PRO B . n B 1 96 LYS 96 90 ? ? ? B . n B 1 97 GLY 97 91 ? ? ? B . n B 1 98 ILE 98 92 ? ? ? B . n B 1 99 SER 99 93 ? ? ? B . n B 1 100 GLN 100 94 ? ? ? B . n C 1 1 MET 1 -5 ? ? ? C . n C 1 2 HIS 2 -4 ? ? ? C . n C 1 3 HIS 3 -3 ? ? ? C . n C 1 4 HIS 4 -2 ? ? ? C . n C 1 5 HIS 5 -1 ? ? ? C . n C 1 6 HIS 6 0 ? ? ? C . n C 1 7 HIS 7 1 ? ? ? C . n C 1 8 GLN 8 2 ? ? ? C . n C 1 9 GLN 9 3 ? ? ? C . n C 1 10 GLU 10 4 4 GLU GLU C . n C 1 11 ALA 11 5 5 ALA ALA C . n C 1 12 LEU 12 6 6 LEU LEU C . n C 1 13 GLY 13 7 7 GLY GLY C . n C 1 14 MET 14 8 8 MET MET C . n C 1 15 VAL 15 9 9 VAL VAL C . n C 1 16 GLU 16 10 10 GLU GLU C . n C 1 17 THR 17 11 11 THR THR C . n C 1 18 LYS 18 12 12 LYS LYS C . n C 1 19 GLY 19 13 13 GLY GLY C . n C 1 20 LEU 20 14 14 LEU LEU C . n C 1 21 THR 21 15 15 THR THR C . n C 1 22 ALA 22 16 16 ALA ALA C . n C 1 23 ALA 23 17 17 ALA ALA C . n C 1 24 ILE 24 18 18 ILE ILE C . n C 1 25 GLU 25 19 19 GLU GLU C . n C 1 26 ALA 26 20 20 ALA ALA C . n C 1 27 ALA 27 21 21 ALA ALA C . n C 1 28 ASP 28 22 22 ASP ASP C . n C 1 29 ALA 29 23 23 ALA ALA C . n C 1 30 MET 30 24 24 MET MET C . n C 1 31 VAL 31 25 25 VAL VAL C . n C 1 32 ALA 32 26 26 ALA ALA C . n C 1 33 SER 33 27 27 SER SER C . n C 1 34 ALA 34 28 28 ALA ALA C . n C 1 35 ASN 35 29 29 ASN ASN C . n C 1 36 VAL 36 30 30 VAL VAL C . n C 1 37 MET 37 31 31 MET MET C . n C 1 38 LEU 38 32 32 LEU LEU C . n C 1 39 VAL 39 33 33 VAL VAL C . n C 1 40 GLY 40 34 34 GLY GLY C . n C 1 41 TYR 41 35 35 TYR TYR C . n C 1 42 GLU 42 36 36 GLU GLU C . n C 1 43 LYS 43 37 37 LYS LYS C . n C 1 44 ILE 44 38 38 ILE ILE C . n C 1 45 GLY 45 39 39 GLY GLY C . n C 1 46 LEU 46 40 40 LEU LEU C . n C 1 47 GLY 47 41 41 GLY GLY C . n C 1 48 LEU 48 42 42 LEU LEU C . n C 1 49 VAL 49 43 43 VAL VAL C . n C 1 50 THR 50 44 44 THR THR C . n C 1 51 VAL 51 45 45 VAL VAL C . n C 1 52 ILE 52 46 46 ILE ILE C . n C 1 53 VAL 53 47 47 VAL VAL C . n C 1 54 ARG 54 48 48 ARG ARG C . n C 1 55 GLY 55 49 49 GLY GLY C . n C 1 56 ASP 56 50 50 ASP ASP C . n C 1 57 VAL 57 51 51 VAL VAL C . n C 1 58 GLY 58 52 52 GLY GLY C . n C 1 59 ALA 59 53 53 ALA ALA C . n C 1 60 VAL 60 54 54 VAL VAL C . n C 1 61 LYS 61 55 55 LYS LYS C . n C 1 62 ALA 62 56 56 ALA ALA C . n C 1 63 ALA 63 57 57 ALA ALA C . n C 1 64 THR 64 58 58 THR THR C . n C 1 65 ASP 65 59 59 ASP ASP C . n C 1 66 ALA 66 60 60 ALA ALA C . n C 1 67 GLY 67 61 61 GLY GLY C . n C 1 68 ALA 68 62 62 ALA ALA C . n C 1 69 ALA 69 63 63 ALA ALA C . n C 1 70 ALA 70 64 64 ALA ALA C . n C 1 71 ALA 71 65 65 ALA ALA C . n C 1 72 ARG 72 66 66 ARG ARG C . n C 1 73 ASN 73 67 67 ASN ASN C . n C 1 74 VAL 74 68 68 VAL VAL C . n C 1 75 GLY 75 69 69 GLY GLY C . n C 1 76 GLU 76 70 70 GLU GLU C . n C 1 77 VAL 77 71 71 VAL VAL C . n C 1 78 LYS 78 72 72 LYS LYS C . n C 1 79 ALA 79 73 73 ALA ALA C . n C 1 80 VAL 80 74 74 VAL VAL C . n C 1 81 HIS 81 75 75 HIS HIS C . n C 1 82 VAL 82 76 76 VAL VAL C . n C 1 83 ILE 83 77 77 ILE ILE C . n C 1 84 PRO 84 78 78 PRO PRO C . n C 1 85 ARG 85 79 79 ARG ARG C . n C 1 86 PRO 86 80 ? ? ? C . n C 1 87 HIS 87 81 ? ? ? C . n C 1 88 THR 88 82 ? ? ? C . n C 1 89 ASP 89 83 ? ? ? C . n C 1 90 VAL 90 84 84 VAL VAL C . n C 1 91 GLU 91 85 85 GLU GLU C . n C 1 92 LYS 92 86 86 LYS LYS C . n C 1 93 ILE 93 87 87 ILE ILE C . n C 1 94 LEU 94 88 88 LEU LEU C . n C 1 95 PRO 95 89 89 PRO PRO C . n C 1 96 LYS 96 90 ? ? ? C . n C 1 97 GLY 97 91 ? ? ? C . n C 1 98 ILE 98 92 ? ? ? C . n C 1 99 SER 99 93 ? ? ? C . n C 1 100 GLN 100 94 ? ? ? C . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA hexameric 6 2 author_and_software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,3 A,B,D,E 2 1,4,5,6,7,8 C,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9250 ? 1 MORE -112 ? 1 'SSA (A^2)' 19500 ? 2 'ABSA (A^2)' 8980 ? 2 MORE -79 ? 2 'SSA (A^2)' 18800 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 116.8200000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 58.4100000000 -0.8660254038 -0.5000000000 0.0000000000 101.1690876701 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 6 'crystal symmetry operation' 4_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 7 'crystal symmetry operation' 5_555 y,-x+y,z 0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 8 'crystal symmetry operation' 6_555 x-y,x,z 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-02-18 2 'Structure model' 1 1 2015-03-11 3 'Structure model' 1 2 2015-03-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 47.2937 14.6418 17.0829 -0.5643 -0.5702 0.6079 0.0185 0.0262 -0.0043 7.3289 5.8640 0.9291 -1.5698 1.0515 -1.3952 0.0034 0.1838 -0.1873 0.0225 -0.9287 0.2953 0.0488 0.0930 -0.0032 'X-RAY DIFFRACTION' 2 ? refined 36.9044 32.8559 17.2230 -0.5310 -0.5689 0.6079 0.0058 0.0726 0.0028 6.9110 7.9966 0.1294 0.7559 0.0394 -1.1276 0.0968 0.0400 -0.1367 0.0898 -0.0372 0.4591 0.1734 -0.0166 0.0144 'X-RAY DIFFRACTION' 3 ? refined 19.1558 9.6230 15.1227 -0.3734 -0.3809 0.5822 0.0378 0.0410 0.0202 6.1721 6.1183 0.0000 0.9497 -0.0697 0.3920 0.0739 -0.0854 0.0116 0.1862 0.2893 -0.3395 0.1280 0.0813 -0.0628 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 2 A 90 '{ A|* }' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 B 4 B 89 '{ B|* }' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 C 4 C 89 '{ C|* }' ? ? ? ? ? # _pdbx_phasing_MR.entry_id 4RBT _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation ? _pdbx_phasing_MR.d_res_low_rotation ? _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 2 PHASER 2.5.6 'Mon Feb 10 17:06:44 2014' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 BUSTER-TNT . ? program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement http://www.globalphasing.com/buster/ ? ? 4 PDB_EXTRACT 3.15 'July. 29, 2014' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 BUSTER 2.10.0 ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 3 ? ? -136.41 -57.67 2 1 HIS A 81 ? ? 91.33 -12.50 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 2 ? CG ? A GLN 8 CG 2 1 Y 1 A GLN 2 ? CD ? A GLN 8 CD 3 1 Y 1 A GLN 2 ? OE1 ? A GLN 8 OE1 4 1 Y 1 A GLN 2 ? NE2 ? A GLN 8 NE2 5 1 Y 1 A HIS 81 ? CG ? A HIS 87 CG 6 1 Y 1 A HIS 81 ? ND1 ? A HIS 87 ND1 7 1 Y 1 A HIS 81 ? CD2 ? A HIS 87 CD2 8 1 Y 1 A HIS 81 ? CE1 ? A HIS 87 CE1 9 1 Y 1 A HIS 81 ? NE2 ? A HIS 87 NE2 10 1 Y 1 A LYS 86 ? CG ? A LYS 92 CG 11 1 Y 1 A LYS 86 ? CD ? A LYS 92 CD 12 1 Y 1 A LYS 86 ? CE ? A LYS 92 CE 13 1 Y 1 A LYS 86 ? NZ ? A LYS 92 NZ 14 1 Y 1 A LYS 90 ? CG ? A LYS 96 CG 15 1 Y 1 A LYS 90 ? CD ? A LYS 96 CD 16 1 Y 1 A LYS 90 ? CE ? A LYS 96 CE 17 1 Y 1 A LYS 90 ? NZ ? A LYS 96 NZ 18 1 Y 1 B GLU 4 ? CG ? B GLU 10 CG 19 1 Y 1 B GLU 4 ? CD ? B GLU 10 CD 20 1 Y 1 B GLU 4 ? OE1 ? B GLU 10 OE1 21 1 Y 1 B GLU 4 ? OE2 ? B GLU 10 OE2 22 1 Y 1 B GLU 85 ? CG ? B GLU 91 CG 23 1 Y 1 B GLU 85 ? CD ? B GLU 91 CD 24 1 Y 1 B GLU 85 ? OE1 ? B GLU 91 OE1 25 1 Y 1 B GLU 85 ? OE2 ? B GLU 91 OE2 26 1 Y 1 B LYS 86 ? CG ? B LYS 92 CG 27 1 Y 1 B LYS 86 ? CD ? B LYS 92 CD 28 1 Y 1 B LYS 86 ? CE ? B LYS 92 CE 29 1 Y 1 B LYS 86 ? NZ ? B LYS 92 NZ 30 1 Y 1 C ASN 29 ? CG ? C ASN 35 CG 31 1 Y 1 C ASN 29 ? OD1 ? C ASN 35 OD1 32 1 Y 1 C ASN 29 ? ND2 ? C ASN 35 ND2 33 1 Y 1 C GLU 85 ? CG ? C GLU 91 CG 34 1 Y 1 C GLU 85 ? CD ? C GLU 91 CD 35 1 Y 1 C GLU 85 ? OE1 ? C GLU 91 OE1 36 1 Y 1 C GLU 85 ? OE2 ? C GLU 91 OE2 37 1 Y 1 C LYS 86 ? CG ? C LYS 92 CG 38 1 Y 1 C LYS 86 ? CD ? C LYS 92 CD 39 1 Y 1 C LYS 86 ? CE ? C LYS 92 CE 40 1 Y 1 C LYS 86 ? NZ ? C LYS 92 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A HIS -4 ? A HIS 2 3 1 Y 1 A HIS -3 ? A HIS 3 4 1 Y 1 A HIS -2 ? A HIS 4 5 1 Y 1 A HIS -1 ? A HIS 5 6 1 Y 1 A HIS 0 ? A HIS 6 7 1 Y 1 A HIS 1 ? A HIS 7 8 1 Y 1 A GLY 91 ? A GLY 97 9 1 Y 1 A ILE 92 ? A ILE 98 10 1 Y 1 A SER 93 ? A SER 99 11 1 Y 1 A GLN 94 ? A GLN 100 12 1 Y 1 B MET -5 ? B MET 1 13 1 Y 1 B HIS -4 ? B HIS 2 14 1 Y 1 B HIS -3 ? B HIS 3 15 1 Y 1 B HIS -2 ? B HIS 4 16 1 Y 1 B HIS -1 ? B HIS 5 17 1 Y 1 B HIS 0 ? B HIS 6 18 1 Y 1 B HIS 1 ? B HIS 7 19 1 Y 1 B GLN 2 ? B GLN 8 20 1 Y 1 B GLN 3 ? B GLN 9 21 1 Y 1 B HIS 81 ? B HIS 87 22 1 Y 1 B THR 82 ? B THR 88 23 1 Y 1 B ASP 83 ? B ASP 89 24 1 Y 1 B VAL 84 ? B VAL 90 25 1 Y 1 B LYS 90 ? B LYS 96 26 1 Y 1 B GLY 91 ? B GLY 97 27 1 Y 1 B ILE 92 ? B ILE 98 28 1 Y 1 B SER 93 ? B SER 99 29 1 Y 1 B GLN 94 ? B GLN 100 30 1 Y 1 C MET -5 ? C MET 1 31 1 Y 1 C HIS -4 ? C HIS 2 32 1 Y 1 C HIS -3 ? C HIS 3 33 1 Y 1 C HIS -2 ? C HIS 4 34 1 Y 1 C HIS -1 ? C HIS 5 35 1 Y 1 C HIS 0 ? C HIS 6 36 1 Y 1 C HIS 1 ? C HIS 7 37 1 Y 1 C GLN 2 ? C GLN 8 38 1 Y 1 C GLN 3 ? C GLN 9 39 1 Y 1 C PRO 80 ? C PRO 86 40 1 Y 1 C HIS 81 ? C HIS 87 41 1 Y 1 C THR 82 ? C THR 88 42 1 Y 1 C ASP 83 ? C ASP 89 43 1 Y 1 C LYS 90 ? C LYS 96 44 1 Y 1 C GLY 91 ? C GLY 97 45 1 Y 1 C ILE 92 ? C ILE 98 46 1 Y 1 C SER 93 ? C SER 99 47 1 Y 1 C GLN 94 ? C GLN 100 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 SO4 1 101 5 SO4 SO4 A . E 3 HOH 1 201 4 HOH HOH A . E 3 HOH 2 202 5 HOH HOH A . F 3 HOH 1 101 3 HOH HOH C . F 3 HOH 2 102 7 HOH HOH C . #