data_4TKP # _entry.id 4TKP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4TKP WWPDB D_1000201562 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TKP _pdbx_database_status.recvd_initial_deposition_date 2014-05-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Johnson, R.' 1 ? 'Taylor, A.B.' 2 ? 'Hart, P.J.' 3 ? 'Ivanov, D.N.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-1247 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Activation of the Ubc13-Ub adduct by the RING domain of the TRIM5alpha retroviral restriction factor offers insight into the mechanism of molecular pattern recognition by TRIM proteins ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yudina, Z.' 1 primary 'Johnson, R.' 2 primary 'Roa, A.' 3 primary 'Biris, N.' 4 primary 'Tsiperson, V.' 5 primary 'Taylor, A.B.' 6 primary 'Hart, P.J.' 7 primary 'Demeler, B.' 8 primary 'Diaz-Griffero, F.' 9 primary 'Ivanov, D.N.' 10 # _cell.entry_id 4TKP _cell.length_a 78.170 _cell.length_b 78.170 _cell.length_c 82.562 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TKP _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin-conjugating enzyme E2 N' 17184.729 1 6.3.2.19 ? ? ? 2 polymer man 'Tripartite motif-containing protein 5' 10361.955 1 6.3.2.- ? 'UNP residues 2-92' ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 5 water nat water 18.015 49 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Bendless-like ubiquitin-conjugating enzyme,Ubc13,UbcH13,Ubiquitin carrier protein N,Ubiquitin-protein ligase N' 2 TRIM5alpha # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GTAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPN VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI ; ;GTAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPN VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI ; A ? 2 'polypeptide(L)' no no ;GSASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVE KLREVKLSPEEGQ ; ;GSASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVE KLREVKLSPEEGQ ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 ALA n 1 4 GLY n 1 5 LEU n 1 6 PRO n 1 7 ARG n 1 8 ARG n 1 9 ILE n 1 10 ILE n 1 11 LYS n 1 12 GLU n 1 13 THR n 1 14 GLN n 1 15 ARG n 1 16 LEU n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 PRO n 1 21 VAL n 1 22 PRO n 1 23 GLY n 1 24 ILE n 1 25 LYS n 1 26 ALA n 1 27 GLU n 1 28 PRO n 1 29 ASP n 1 30 GLU n 1 31 SER n 1 32 ASN n 1 33 ALA n 1 34 ARG n 1 35 TYR n 1 36 PHE n 1 37 HIS n 1 38 VAL n 1 39 VAL n 1 40 ILE n 1 41 ALA n 1 42 GLY n 1 43 PRO n 1 44 GLN n 1 45 ASP n 1 46 SER n 1 47 PRO n 1 48 PHE n 1 49 GLU n 1 50 GLY n 1 51 GLY n 1 52 THR n 1 53 PHE n 1 54 LYS n 1 55 LEU n 1 56 GLU n 1 57 LEU n 1 58 PHE n 1 59 LEU n 1 60 PRO n 1 61 GLU n 1 62 GLU n 1 63 TYR n 1 64 PRO n 1 65 MET n 1 66 ALA n 1 67 ALA n 1 68 PRO n 1 69 LYS n 1 70 VAL n 1 71 ARG n 1 72 PHE n 1 73 MET n 1 74 THR n 1 75 LYS n 1 76 ILE n 1 77 TYR n 1 78 HIS n 1 79 PRO n 1 80 ASN n 1 81 VAL n 1 82 ASP n 1 83 LYS n 1 84 LEU n 1 85 GLY n 1 86 ARG n 1 87 ILE n 1 88 CYS n 1 89 LEU n 1 90 ASP n 1 91 ILE n 1 92 LEU n 1 93 LYS n 1 94 ASP n 1 95 LYS n 1 96 TRP n 1 97 SER n 1 98 PRO n 1 99 ALA n 1 100 LEU n 1 101 GLN n 1 102 ILE n 1 103 ARG n 1 104 THR n 1 105 VAL n 1 106 LEU n 1 107 LEU n 1 108 SER n 1 109 ILE n 1 110 GLN n 1 111 ALA n 1 112 LEU n 1 113 LEU n 1 114 SER n 1 115 ALA n 1 116 PRO n 1 117 ASN n 1 118 PRO n 1 119 ASP n 1 120 ASP n 1 121 PRO n 1 122 LEU n 1 123 ALA n 1 124 ASN n 1 125 ASP n 1 126 VAL n 1 127 ALA n 1 128 GLU n 1 129 GLN n 1 130 TRP n 1 131 LYS n 1 132 THR n 1 133 ASN n 1 134 GLU n 1 135 ALA n 1 136 GLN n 1 137 ALA n 1 138 ILE n 1 139 GLU n 1 140 THR n 1 141 ALA n 1 142 ARG n 1 143 ALA n 1 144 TRP n 1 145 THR n 1 146 ARG n 1 147 LEU n 1 148 TYR n 1 149 ALA n 1 150 MET n 1 151 ASN n 1 152 ASN n 1 153 ILE n 2 1 GLY n 2 2 SER n 2 3 ALA n 2 4 SER n 2 5 GLY n 2 6 ILE n 2 7 LEU n 2 8 LEU n 2 9 ASN n 2 10 VAL n 2 11 LYS n 2 12 GLU n 2 13 GLU n 2 14 VAL n 2 15 THR n 2 16 CYS n 2 17 PRO n 2 18 ILE n 2 19 CYS n 2 20 LEU n 2 21 GLU n 2 22 LEU n 2 23 LEU n 2 24 THR n 2 25 GLU n 2 26 PRO n 2 27 LEU n 2 28 SER n 2 29 LEU n 2 30 HIS n 2 31 CYS n 2 32 GLY n 2 33 HIS n 2 34 SER n 2 35 PHE n 2 36 CYS n 2 37 GLN n 2 38 ALA n 2 39 CYS n 2 40 ILE n 2 41 THR n 2 42 ALA n 2 43 ASN n 2 44 HIS n 2 45 LYS n 2 46 LYS n 2 47 SER n 2 48 MET n 2 49 LEU n 2 50 TYR n 2 51 LYS n 2 52 GLU n 2 53 GLY n 2 54 GLU n 2 55 ARG n 2 56 SER n 2 57 CYS n 2 58 PRO n 2 59 VAL n 2 60 CYS n 2 61 ARG n 2 62 ILE n 2 63 SER n 2 64 TYR n 2 65 GLN n 2 66 PRO n 2 67 GLU n 2 68 ASN n 2 69 ILE n 2 70 GLN n 2 71 PRO n 2 72 ASN n 2 73 ARG n 2 74 HIS n 2 75 VAL n 2 76 ALA n 2 77 ASN n 2 78 ILE n 2 79 VAL n 2 80 GLU n 2 81 LYS n 2 82 LEU n 2 83 ARG n 2 84 GLU n 2 85 VAL n 2 86 LYS n 2 87 LEU n 2 88 SER n 2 89 PRO n 2 90 GLU n 2 91 GLU n 2 92 GLY n 2 93 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 153 Human ? 'UBE2N, BLU' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 511693 ? ? ? ? ? ? 'BL21 Rosetta 2' ? ? ? ? ? ? ? plasmid ? ? ? 'pET30a, modified' ? ? 2 1 sample 'Biological sequence' 1 93 'Rhesus macaque' ? TRIM5 ? ? ? ? ? ? 'Macaca mulatta' 9544 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP UBE2N_HUMAN P61088 1 ;AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVD KLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI ; 2 ? 2 UNP TRIM5_MACMU Q0PF16 2 ;ASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKL REVKLSPEEGQ ; 2 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4TKP A 3 ? 153 ? P61088 2 ? 152 ? 2 152 2 2 4TKP B 3 ? 93 ? Q0PF16 2 ? 92 ? 2 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TKP GLY A 1 ? UNP P61088 ? ? 'expression tag' 0 1 1 4TKP THR A 2 ? UNP P61088 ? ? 'expression tag' 1 2 2 4TKP GLY B 1 ? UNP Q0PF16 ? ? 'expression tag' 0 3 2 4TKP SER B 2 ? UNP Q0PF16 ? ? 'expression tag' 1 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TKP _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.27 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0 M ammonium sulfate, 0.1 M bis-tris' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-07-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.2823 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.2823 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 50.9 _reflns.entry_id 4TKP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.08 _reflns.d_resolution_low 45.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15907 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.036 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.08 _reflns_shell.d_res_low 2.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.588 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.6 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TKP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.08 _refine.ls_d_res_low 45.93 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15568 _refine.ls_number_reflns_R_free 778 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.98 _refine.ls_percent_reflns_R_free 5.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2257 _refine.ls_R_factor_R_free 0.2553 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2243 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.93 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1656 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 1712 _refine_hist.d_res_high 2.08 _refine_hist.d_res_low 45.93 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1696 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.664 ? 2306 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.252 ? 647 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 263 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 298 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 2.0800 2.1544 . . 155 2751 99.00 . . . 0.3335 . 0.3251 . . . . . . . . 'X-RAY DIFFRACTION' 2.1544 2.2406 . . 164 2633 95.00 . . . 0.3196 . 0.3005 . . . . . . . . 'X-RAY DIFFRACTION' 2.2406 2.3426 . . 145 2595 94.00 . . . 0.3811 . 0.3503 . . . . . . . . 'X-RAY DIFFRACTION' 2.3426 2.4661 . . 144 2775 99.00 . . . 0.2773 . 0.2566 . . . . . . . . 'X-RAY DIFFRACTION' 2.4661 2.6206 . . 149 2759 100.00 . . . 0.3253 . 0.2430 . . . . . . . . 'X-RAY DIFFRACTION' 2.6206 2.8229 . . 127 2803 99.00 . . . 0.3365 . 0.2529 . . . . . . . . 'X-RAY DIFFRACTION' 2.8229 3.1069 . . 157 2759 99.00 . . . 0.3034 . 0.2494 . . . . . . . . 'X-RAY DIFFRACTION' 3.1069 3.5564 . . 159 2756 99.00 . . . 0.2649 . 0.2266 . . . . . . . . 'X-RAY DIFFRACTION' 3.5564 4.4801 . . 101 2766 98.00 . . . 0.2281 . 0.1921 . . . . . . . . 'X-RAY DIFFRACTION' 4.4801 45.9424 . . 150 2724 98.00 . . . 0.2076 . 0.2050 . . . . . . . . # _struct.entry_id 4TKP _struct.title 'Complex of Ubc13 with the RING domain of the TRIM5alpha retroviral restriction factor' _struct.pdbx_descriptor 'Ubiquitin-conjugating enzyme E2 N (E.C.6.3.2.19), Tripartite motif-containing protein 5 (E.C.6.3.2.-)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TKP _struct_keywords.text 'HIV restriction, TRIM5, Ubc13, E3 Ubiquitin ligase, RING dimerization, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 6 ? GLU A 19 ? PRO A 5 GLU A 18 1 ? 14 HELX_P HELX_P2 AA2 LEU A 89 ? LYS A 93 ? LEU A 88 LYS A 92 5 ? 5 HELX_P HELX_P3 AA3 GLN A 101 ? ALA A 115 ? GLN A 100 ALA A 114 1 ? 15 HELX_P HELX_P4 AA4 ASP A 125 ? ASN A 133 ? ASP A 124 ASN A 132 1 ? 9 HELX_P HELX_P5 AA5 ASN A 133 ? ALA A 149 ? ASN A 132 ALA A 148 1 ? 17 HELX_P HELX_P6 AA6 LEU B 7 ? VAL B 14 ? LEU B 6 VAL B 13 1 ? 8 HELX_P HELX_P7 AA7 ALA B 38 ? ILE B 40 ? ALA B 37 ILE B 39 5 ? 3 HELX_P HELX_P8 AA8 ASN B 72 ? LYS B 81 ? ASN B 71 LYS B 80 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CYS 16 SG ? ? ? 1_555 E ZN . ZN ? ? B CYS 15 B ZN 102 1_555 ? ? ? ? ? ? ? 2.479 ? metalc2 metalc ? ? B CYS 19 SG ? ? ? 1_555 E ZN . ZN ? ? B CYS 18 B ZN 102 1_555 ? ? ? ? ? ? ? 2.330 ? metalc3 metalc ? ? B CYS 31 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 30 B ZN 101 1_555 ? ? ? ? ? ? ? 2.356 ? metalc4 metalc ? ? B HIS 33 ND1 ? ? ? 1_555 D ZN . ZN ? ? B HIS 32 B ZN 101 1_555 ? ? ? ? ? ? ? 2.143 ? metalc5 metalc ? ? B CYS 36 SG ? ? ? 1_555 E ZN . ZN ? ? B CYS 35 B ZN 102 1_555 ? ? ? ? ? ? ? 2.755 ? metalc6 metalc ? ? B CYS 39 SG ? ? ? 1_555 E ZN . ZN ? ? B CYS 38 B ZN 102 1_555 ? ? ? ? ? ? ? 2.341 ? metalc7 metalc ? ? B CYS 57 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 56 B ZN 101 1_555 ? ? ? ? ? ? ? 2.354 ? metalc8 metalc ? ? B CYS 60 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 59 B ZN 101 1_555 ? ? ? ? ? ? ? 2.331 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 63 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 62 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 64 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 63 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.52 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 24 ? PRO A 28 ? ILE A 23 PRO A 27 AA1 2 TYR A 35 ? ALA A 41 ? TYR A 34 ALA A 40 AA1 3 THR A 52 ? PHE A 58 ? THR A 51 PHE A 57 AA1 4 LYS A 69 ? PHE A 72 ? LYS A 68 PHE A 71 AA2 1 SER B 34 ? CYS B 36 ? SER B 33 CYS B 35 AA2 2 PRO B 26 ? SER B 28 ? PRO B 25 SER B 27 AA2 3 GLN B 70 ? PRO B 71 ? GLN B 69 PRO B 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 27 ? N GLU A 26 O HIS A 37 ? O HIS A 36 AA1 2 3 N PHE A 36 ? N PHE A 35 O LEU A 57 ? O LEU A 56 AA1 3 4 N PHE A 58 ? N PHE A 57 O LYS A 69 ? O LYS A 68 AA2 1 2 O PHE B 35 ? O PHE B 34 N LEU B 27 ? N LEU B 26 AA2 2 3 N SER B 28 ? N SER B 27 O GLN B 70 ? O GLN B 69 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 5 'binding site for residue SO4 A 201' AC2 Software B ZN 101 ? 4 'binding site for residue ZN B 101' AC3 Software B ZN 102 ? 4 'binding site for residue ZN B 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 PHE A 58 ? PHE A 57 . ? 8_665 ? 2 AC1 5 PRO A 60 ? PRO A 59 . ? 8_665 ? 3 AC1 5 GLU A 61 ? GLU A 60 . ? 8_665 ? 4 AC1 5 ARG A 71 ? ARG A 70 . ? 1_555 ? 5 AC1 5 ARG A 86 ? ARG A 85 . ? 1_555 ? 6 AC2 4 CYS B 31 ? CYS B 30 . ? 1_555 ? 7 AC2 4 HIS B 33 ? HIS B 32 . ? 1_555 ? 8 AC2 4 CYS B 57 ? CYS B 56 . ? 1_555 ? 9 AC2 4 CYS B 60 ? CYS B 59 . ? 1_555 ? 10 AC3 4 CYS B 16 ? CYS B 15 . ? 1_555 ? 11 AC3 4 CYS B 19 ? CYS B 18 . ? 1_555 ? 12 AC3 4 CYS B 36 ? CYS B 35 . ? 1_555 ? 13 AC3 4 CYS B 39 ? CYS B 38 . ? 1_555 ? # _atom_sites.entry_id 4TKP _atom_sites.fract_transf_matrix[1][1] 0.012793 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012793 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012112 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 THR 2 1 ? ? ? A . n A 1 3 ALA 3 2 ? ? ? A . n A 1 4 GLY 4 3 ? ? ? A . n A 1 5 LEU 5 4 4 LEU LEU A . n A 1 6 PRO 6 5 5 PRO PRO A . n A 1 7 ARG 7 6 6 ARG ARG A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 ILE 9 8 8 ILE ILE A . n A 1 10 ILE 10 9 9 ILE ILE A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 THR 13 12 12 THR THR A . n A 1 14 GLN 14 13 13 GLN GLN A . n A 1 15 ARG 15 14 14 ARG ARG A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 PRO 20 19 19 PRO PRO A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 PRO 22 21 21 PRO PRO A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 ALA 26 25 25 ALA ALA A . n A 1 27 GLU 27 26 26 GLU GLU A . n A 1 28 PRO 28 27 27 PRO PRO A . n A 1 29 ASP 29 28 28 ASP ASP A . n A 1 30 GLU 30 29 29 GLU GLU A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 ASN 32 31 31 ASN ASN A . n A 1 33 ALA 33 32 32 ALA ALA A . n A 1 34 ARG 34 33 33 ARG ARG A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 PHE 36 35 35 PHE PHE A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 VAL 39 38 38 VAL VAL A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 ALA 41 40 40 ALA ALA A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 PRO 43 42 42 PRO PRO A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 SER 46 45 45 SER SER A . n A 1 47 PRO 47 46 46 PRO PRO A . n A 1 48 PHE 48 47 47 PHE PHE A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 GLY 50 49 49 GLY GLY A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 PHE 53 52 52 PHE PHE A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 LEU 55 54 54 LEU LEU A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 PHE 58 57 57 PHE PHE A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 PRO 60 59 59 PRO PRO A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 TYR 63 62 62 TYR TYR A . n A 1 64 PRO 64 63 63 PRO PRO A . n A 1 65 MET 65 64 64 MET MET A . n A 1 66 ALA 66 65 65 ALA ALA A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 PRO 68 67 67 PRO PRO A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 ARG 71 70 70 ARG ARG A . n A 1 72 PHE 72 71 71 PHE PHE A . n A 1 73 MET 73 72 72 MET MET A . n A 1 74 THR 74 73 73 THR THR A . n A 1 75 LYS 75 74 74 LYS LYS A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 TYR 77 76 76 TYR TYR A . n A 1 78 HIS 78 77 77 HIS HIS A . n A 1 79 PRO 79 78 78 PRO PRO A . n A 1 80 ASN 80 79 79 ASN ASN A . n A 1 81 VAL 81 80 80 VAL VAL A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 LEU 84 83 83 LEU LEU A . n A 1 85 GLY 85 84 84 GLY GLY A . n A 1 86 ARG 86 85 85 ARG ARG A . n A 1 87 ILE 87 86 86 ILE ILE A . n A 1 88 CYS 88 87 87 CYS CYS A . n A 1 89 LEU 89 88 88 LEU LEU A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 LEU 92 91 91 LEU LEU A . n A 1 93 LYS 93 92 92 LYS LYS A . n A 1 94 ASP 94 93 93 ASP ASP A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 TRP 96 95 95 TRP TRP A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 PRO 98 97 97 PRO PRO A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 GLN 101 100 100 GLN GLN A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 ARG 103 102 102 ARG ARG A . n A 1 104 THR 104 103 103 THR THR A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 LEU 106 105 105 LEU LEU A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 SER 108 107 107 SER SER A . n A 1 109 ILE 109 108 108 ILE ILE A . n A 1 110 GLN 110 109 109 GLN GLN A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 LEU 112 111 111 LEU LEU A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 SER 114 113 113 SER SER A . n A 1 115 ALA 115 114 114 ALA ALA A . n A 1 116 PRO 116 115 115 PRO PRO A . n A 1 117 ASN 117 116 116 ASN ASN A . n A 1 118 PRO 118 117 117 PRO PRO A . n A 1 119 ASP 119 118 118 ASP ASP A . n A 1 120 ASP 120 119 ? ? ? A . n A 1 121 PRO 121 120 ? ? ? A . n A 1 122 LEU 122 121 ? ? ? A . n A 1 123 ALA 123 122 ? ? ? A . n A 1 124 ASN 124 123 123 ASN ASN A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 VAL 126 125 125 VAL VAL A . n A 1 127 ALA 127 126 126 ALA ALA A . n A 1 128 GLU 128 127 127 GLU GLU A . n A 1 129 GLN 129 128 128 GLN GLN A . n A 1 130 TRP 130 129 129 TRP TRP A . n A 1 131 LYS 131 130 130 LYS LYS A . n A 1 132 THR 132 131 131 THR THR A . n A 1 133 ASN 133 132 132 ASN ASN A . n A 1 134 GLU 134 133 133 GLU GLU A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 GLN 136 135 135 GLN GLN A . n A 1 137 ALA 137 136 136 ALA ALA A . n A 1 138 ILE 138 137 137 ILE ILE A . n A 1 139 GLU 139 138 138 GLU GLU A . n A 1 140 THR 140 139 139 THR THR A . n A 1 141 ALA 141 140 140 ALA ALA A . n A 1 142 ARG 142 141 141 ARG ARG A . n A 1 143 ALA 143 142 142 ALA ALA A . n A 1 144 TRP 144 143 143 TRP TRP A . n A 1 145 THR 145 144 144 THR THR A . n A 1 146 ARG 146 145 145 ARG ARG A . n A 1 147 LEU 147 146 146 LEU LEU A . n A 1 148 TYR 148 147 147 TYR TYR A . n A 1 149 ALA 149 148 148 ALA ALA A . n A 1 150 MET 150 149 149 MET MET A . n A 1 151 ASN 151 150 150 ASN ASN A . n A 1 152 ASN 152 151 151 ASN ASN A . n A 1 153 ILE 153 152 152 ILE ILE A . n B 2 1 GLY 1 0 ? ? ? B . n B 2 2 SER 2 1 ? ? ? B . n B 2 3 ALA 3 2 ? ? ? B . n B 2 4 SER 4 3 ? ? ? B . n B 2 5 GLY 5 4 ? ? ? B . n B 2 6 ILE 6 5 5 ILE ILE B . n B 2 7 LEU 7 6 6 LEU LEU B . n B 2 8 LEU 8 7 7 LEU LEU B . n B 2 9 ASN 9 8 8 ASN ASN B . n B 2 10 VAL 10 9 9 VAL VAL B . n B 2 11 LYS 11 10 10 LYS LYS B . n B 2 12 GLU 12 11 11 GLU GLU B . n B 2 13 GLU 13 12 12 GLU GLU B . n B 2 14 VAL 14 13 13 VAL VAL B . n B 2 15 THR 15 14 14 THR THR B . n B 2 16 CYS 16 15 15 CYS CYS B . n B 2 17 PRO 17 16 16 PRO PRO B . n B 2 18 ILE 18 17 17 ILE ILE B . n B 2 19 CYS 19 18 18 CYS CYS B . n B 2 20 LEU 20 19 19 LEU LEU B . n B 2 21 GLU 21 20 20 GLU GLU B . n B 2 22 LEU 22 21 21 LEU LEU B . n B 2 23 LEU 23 22 22 LEU LEU B . n B 2 24 THR 24 23 23 THR THR B . n B 2 25 GLU 25 24 24 GLU GLU B . n B 2 26 PRO 26 25 25 PRO PRO B . n B 2 27 LEU 27 26 26 LEU LEU B . n B 2 28 SER 28 27 27 SER SER B . n B 2 29 LEU 29 28 28 LEU LEU B . n B 2 30 HIS 30 29 29 HIS HIS B . n B 2 31 CYS 31 30 30 CYS CYS B . n B 2 32 GLY 32 31 31 GLY GLY B . n B 2 33 HIS 33 32 32 HIS HIS B . n B 2 34 SER 34 33 33 SER SER B . n B 2 35 PHE 35 34 34 PHE PHE B . n B 2 36 CYS 36 35 35 CYS CYS B . n B 2 37 GLN 37 36 36 GLN GLN B . n B 2 38 ALA 38 37 37 ALA ALA B . n B 2 39 CYS 39 38 38 CYS CYS B . n B 2 40 ILE 40 39 39 ILE ILE B . n B 2 41 THR 41 40 ? ? ? B . n B 2 42 ALA 42 41 ? ? ? B . n B 2 43 ASN 43 42 ? ? ? B . n B 2 44 HIS 44 43 ? ? ? B . n B 2 45 LYS 45 44 ? ? ? B . n B 2 46 LYS 46 45 ? ? ? B . n B 2 47 SER 47 46 ? ? ? B . n B 2 48 MET 48 47 ? ? ? B . n B 2 49 LEU 49 48 ? ? ? B . n B 2 50 TYR 50 49 ? ? ? B . n B 2 51 LYS 51 50 ? ? ? B . n B 2 52 GLU 52 51 ? ? ? B . n B 2 53 GLY 53 52 ? ? ? B . n B 2 54 GLU 54 53 ? ? ? B . n B 2 55 ARG 55 54 ? ? ? B . n B 2 56 SER 56 55 55 SER SER B . n B 2 57 CYS 57 56 56 CYS CYS B . n B 2 58 PRO 58 57 57 PRO PRO B . n B 2 59 VAL 59 58 58 VAL VAL B . n B 2 60 CYS 60 59 59 CYS CYS B . n B 2 61 ARG 61 60 60 ARG ARG B . n B 2 62 ILE 62 61 61 ILE ILE B . n B 2 63 SER 63 62 62 SER SER B . n B 2 64 TYR 64 63 63 TYR TYR B . n B 2 65 GLN 65 64 64 GLN GLN B . n B 2 66 PRO 66 65 65 PRO PRO B . n B 2 67 GLU 67 66 66 GLU GLU B . n B 2 68 ASN 68 67 67 ASN ASN B . n B 2 69 ILE 69 68 68 ILE ILE B . n B 2 70 GLN 70 69 69 GLN GLN B . n B 2 71 PRO 71 70 70 PRO PRO B . n B 2 72 ASN 72 71 71 ASN ASN B . n B 2 73 ARG 73 72 72 ARG ARG B . n B 2 74 HIS 74 73 73 HIS HIS B . n B 2 75 VAL 75 74 74 VAL VAL B . n B 2 76 ALA 76 75 75 ALA ALA B . n B 2 77 ASN 77 76 76 ASN ASN B . n B 2 78 ILE 78 77 77 ILE ILE B . n B 2 79 VAL 79 78 78 VAL VAL B . n B 2 80 GLU 80 79 79 GLU GLU B . n B 2 81 LYS 81 80 80 LYS LYS B . n B 2 82 LEU 82 81 81 LEU LEU B . n B 2 83 ARG 83 82 82 ARG ARG B . n B 2 84 GLU 84 83 ? ? ? B . n B 2 85 VAL 85 84 ? ? ? B . n B 2 86 LYS 86 85 ? ? ? B . n B 2 87 LEU 87 86 ? ? ? B . n B 2 88 SER 88 87 ? ? ? B . n B 2 89 PRO 89 88 ? ? ? B . n B 2 90 GLU 90 89 ? ? ? B . n B 2 91 GLU 91 90 ? ? ? B . n B 2 92 GLY 92 91 ? ? ? B . n B 2 93 GLN 93 92 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 201 201 SO4 SO4 A . D 4 ZN 1 101 101 ZN ZN B . E 4 ZN 1 102 102 ZN ZN B . F 5 HOH 1 301 32 HOH HOH A . F 5 HOH 2 302 17 HOH HOH A . F 5 HOH 3 303 23 HOH HOH A . F 5 HOH 4 304 15 HOH HOH A . F 5 HOH 5 305 25 HOH HOH A . F 5 HOH 6 306 2 HOH HOH A . F 5 HOH 7 307 42 HOH HOH A . F 5 HOH 8 308 10 HOH HOH A . F 5 HOH 9 309 48 HOH HOH A . F 5 HOH 10 310 43 HOH HOH A . F 5 HOH 11 311 22 HOH HOH A . F 5 HOH 12 312 47 HOH HOH A . F 5 HOH 13 313 21 HOH HOH A . F 5 HOH 14 314 38 HOH HOH A . F 5 HOH 15 315 1 HOH HOH A . F 5 HOH 16 316 3 HOH HOH A . F 5 HOH 17 317 4 HOH HOH A . F 5 HOH 18 318 5 HOH HOH A . F 5 HOH 19 319 6 HOH HOH A . F 5 HOH 20 320 7 HOH HOH A . F 5 HOH 21 321 8 HOH HOH A . F 5 HOH 22 322 11 HOH HOH A . F 5 HOH 23 323 12 HOH HOH A . F 5 HOH 24 324 13 HOH HOH A . F 5 HOH 25 325 14 HOH HOH A . F 5 HOH 26 326 16 HOH HOH A . F 5 HOH 27 327 18 HOH HOH A . F 5 HOH 28 328 19 HOH HOH A . F 5 HOH 29 329 20 HOH HOH A . F 5 HOH 30 330 24 HOH HOH A . F 5 HOH 31 331 26 HOH HOH A . F 5 HOH 32 332 27 HOH HOH A . F 5 HOH 33 333 28 HOH HOH A . F 5 HOH 34 334 29 HOH HOH A . F 5 HOH 35 335 30 HOH HOH A . F 5 HOH 36 336 33 HOH HOH A . F 5 HOH 37 337 34 HOH HOH A . F 5 HOH 38 338 35 HOH HOH A . F 5 HOH 39 339 36 HOH HOH A . F 5 HOH 40 340 37 HOH HOH A . F 5 HOH 41 341 39 HOH HOH A . F 5 HOH 42 342 40 HOH HOH A . F 5 HOH 43 343 44 HOH HOH A . F 5 HOH 44 344 45 HOH HOH A . F 5 HOH 45 345 46 HOH HOH A . F 5 HOH 46 346 49 HOH HOH A . G 5 HOH 1 201 31 HOH HOH B . G 5 HOH 2 202 9 HOH HOH B . G 5 HOH 3 203 41 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1000 ? 1 MORE -9 ? 1 'SSA (A^2)' 12340 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? B CYS 16 ? B CYS 15 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 SG ? B CYS 19 ? B CYS 18 ? 1_555 111.6 ? 2 SG ? B CYS 16 ? B CYS 15 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 SG ? B CYS 36 ? B CYS 35 ? 1_555 92.9 ? 3 SG ? B CYS 19 ? B CYS 18 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 SG ? B CYS 36 ? B CYS 35 ? 1_555 99.2 ? 4 SG ? B CYS 16 ? B CYS 15 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 SG ? B CYS 39 ? B CYS 38 ? 1_555 103.1 ? 5 SG ? B CYS 19 ? B CYS 18 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 SG ? B CYS 39 ? B CYS 38 ? 1_555 131.2 ? 6 SG ? B CYS 36 ? B CYS 35 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 SG ? B CYS 39 ? B CYS 38 ? 1_555 112.4 ? 7 SG ? B CYS 31 ? B CYS 30 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 ND1 ? B HIS 33 ? B HIS 32 ? 1_555 107.4 ? 8 SG ? B CYS 31 ? B CYS 30 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 57 ? B CYS 56 ? 1_555 112.2 ? 9 ND1 ? B HIS 33 ? B HIS 32 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 57 ? B CYS 56 ? 1_555 110.4 ? 10 SG ? B CYS 31 ? B CYS 30 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 60 ? B CYS 59 ? 1_555 101.0 ? 11 ND1 ? B HIS 33 ? B HIS 32 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 60 ? B CYS 59 ? 1_555 117.8 ? 12 SG ? B CYS 57 ? B CYS 56 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 60 ? B CYS 59 ? 1_555 107.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-22 2 'Structure model' 1 1 2017-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_src_gen 2 2 'Structure model' pdbx_audit_support 3 2 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version '(phenix.refine: 1.8.2_1309)' _software.pdbx_ordinal 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 92 ? ? -133.65 -117.49 2 1 ILE B 17 ? ? -93.57 -61.75 3 1 PRO B 65 ? ? -61.40 41.47 4 1 GLU B 66 ? ? -158.77 -10.62 5 1 LYS B 80 ? ? -78.23 22.30 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A THR 1 ? A THR 2 3 1 Y 1 A ALA 2 ? A ALA 3 4 1 Y 1 A GLY 3 ? A GLY 4 5 1 Y 1 A ASP 119 ? A ASP 120 6 1 Y 1 A PRO 120 ? A PRO 121 7 1 Y 1 A LEU 121 ? A LEU 122 8 1 Y 1 A ALA 122 ? A ALA 123 9 1 Y 1 B GLY 0 ? B GLY 1 10 1 Y 1 B SER 1 ? B SER 2 11 1 Y 1 B ALA 2 ? B ALA 3 12 1 Y 1 B SER 3 ? B SER 4 13 1 Y 1 B GLY 4 ? B GLY 5 14 1 Y 1 B THR 40 ? B THR 41 15 1 Y 1 B ALA 41 ? B ALA 42 16 1 Y 1 B ASN 42 ? B ASN 43 17 1 Y 1 B HIS 43 ? B HIS 44 18 1 Y 1 B LYS 44 ? B LYS 45 19 1 Y 1 B LYS 45 ? B LYS 46 20 1 Y 1 B SER 46 ? B SER 47 21 1 Y 1 B MET 47 ? B MET 48 22 1 Y 1 B LEU 48 ? B LEU 49 23 1 Y 1 B TYR 49 ? B TYR 50 24 1 Y 1 B LYS 50 ? B LYS 51 25 1 Y 1 B GLU 51 ? B GLU 52 26 1 Y 1 B GLY 52 ? B GLY 53 27 1 Y 1 B GLU 53 ? B GLU 54 28 1 Y 1 B ARG 54 ? B ARG 55 29 1 Y 1 B GLU 83 ? B GLU 84 30 1 Y 1 B VAL 84 ? B VAL 85 31 1 Y 1 B LYS 85 ? B LYS 86 32 1 Y 1 B LEU 86 ? B LEU 87 33 1 Y 1 B SER 87 ? B SER 88 34 1 Y 1 B PRO 88 ? B PRO 89 35 1 Y 1 B GLU 89 ? B GLU 90 36 1 Y 1 B GLU 90 ? B GLU 91 37 1 Y 1 B GLY 91 ? B GLY 92 38 1 Y 1 B GLN 92 ? B GLN 93 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 'ZINC ION' ZN 5 water HOH #