data_4TSK # _entry.id 4TSK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4TSK pdb_00004tsk 10.2210/pdb4tsk/pdb WWPDB D_1000202110 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TSK _pdbx_database_status.recvd_initial_deposition_date 2014-06-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cahn, J.K.B.' 1 'Brinkmann-Chen, S.' 2 'Arnold, F.H.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Metab. Eng.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1096-7184 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26C _citation.language ? _citation.page_first 17 _citation.page_last 22 _citation.title 'Uncovering rare NADH-preferring ketol-acid reductoisomerases.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ymben.2014.08.003 _citation.pdbx_database_id_PubMed 25172159 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brinkmann-Chen, S.' 1 ? primary 'Cahn, J.K.' 2 ? primary 'Arnold, F.H.' 3 ? # _cell.length_a 124.099 _cell.length_b 124.099 _cell.length_c 124.099 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4TSK _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 2 3' _symmetry.entry_id 4TSK _symmetry.Int_Tables_number 195 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ketol-acid reductoisomerase' 38785.109 1 1.1.1.86 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 3 non-polymer syn 'L(+)-TARTARIC ACID' 150.087 1 ? ? ? ? 4 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421 1 ? ? ? ? 5 water nat water 18.015 46 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Acetohydroxy-acid isomeroreductase,Alpha-keto-beta-hydroxylacyl reductoisomerase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKIYYDADISIQPLADKRIAVIGYGSQGHAHAQNLRDSGFDVVIGLRPGSSWAKAEADGFRVMAVGEAVEESDVIMILL PDERQPAVYEREIRPYLTAGKALAFAHGFNIHFSQIQPPKDVDVFMVAPKGPGHLVRRVYEAGGGVPALIAVHQDASGQA KDLALAYARGIGAGRAGILTTTFREETETDLFGEQAVLCGGLSALIKAGFETLVEAGYQPEIAYFECLHEMKLIVDLIYE GGLEYMRYSISDTAQWGDFTSGPRIINEETKKEMRRILADIQSGAFAKSWILENQANRPMFNAINRRELEHPIEVVGRKL RSMMPFIKAKRPGDDRVPATADRAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKIYYDADISIQPLADKRIAVIGYGSQGHAHAQNLRDSGFDVVIGLRPGSSWAKAEADGFRVMAVGEAVEESDVIMILL PDERQPAVYEREIRPYLTAGKALAFAHGFNIHFSQIQPPKDVDVFMVAPKGPGHLVRRVYEAGGGVPALIAVHQDASGQA KDLALAYARGIGAGRAGILTTTFREETETDLFGEQAVLCGGLSALIKAGFETLVEAGYQPEIAYFECLHEMKLIVDLIYE GGLEYMRYSISDTAQWGDFTSGPRIINEETKKEMRRILADIQSGAFAKSWILENQANRPMFNAINRRELEHPIEVVGRKL RSMMPFIKAKRPGDDRVPATADRAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 ILE n 1 5 TYR n 1 6 TYR n 1 7 ASP n 1 8 ALA n 1 9 ASP n 1 10 ILE n 1 11 SER n 1 12 ILE n 1 13 GLN n 1 14 PRO n 1 15 LEU n 1 16 ALA n 1 17 ASP n 1 18 LYS n 1 19 ARG n 1 20 ILE n 1 21 ALA n 1 22 VAL n 1 23 ILE n 1 24 GLY n 1 25 TYR n 1 26 GLY n 1 27 SER n 1 28 GLN n 1 29 GLY n 1 30 HIS n 1 31 ALA n 1 32 HIS n 1 33 ALA n 1 34 GLN n 1 35 ASN n 1 36 LEU n 1 37 ARG n 1 38 ASP n 1 39 SER n 1 40 GLY n 1 41 PHE n 1 42 ASP n 1 43 VAL n 1 44 VAL n 1 45 ILE n 1 46 GLY n 1 47 LEU n 1 48 ARG n 1 49 PRO n 1 50 GLY n 1 51 SER n 1 52 SER n 1 53 TRP n 1 54 ALA n 1 55 LYS n 1 56 ALA n 1 57 GLU n 1 58 ALA n 1 59 ASP n 1 60 GLY n 1 61 PHE n 1 62 ARG n 1 63 VAL n 1 64 MET n 1 65 ALA n 1 66 VAL n 1 67 GLY n 1 68 GLU n 1 69 ALA n 1 70 VAL n 1 71 GLU n 1 72 GLU n 1 73 SER n 1 74 ASP n 1 75 VAL n 1 76 ILE n 1 77 MET n 1 78 ILE n 1 79 LEU n 1 80 LEU n 1 81 PRO n 1 82 ASP n 1 83 GLU n 1 84 ARG n 1 85 GLN n 1 86 PRO n 1 87 ALA n 1 88 VAL n 1 89 TYR n 1 90 GLU n 1 91 ARG n 1 92 GLU n 1 93 ILE n 1 94 ARG n 1 95 PRO n 1 96 TYR n 1 97 LEU n 1 98 THR n 1 99 ALA n 1 100 GLY n 1 101 LYS n 1 102 ALA n 1 103 LEU n 1 104 ALA n 1 105 PHE n 1 106 ALA n 1 107 HIS n 1 108 GLY n 1 109 PHE n 1 110 ASN n 1 111 ILE n 1 112 HIS n 1 113 PHE n 1 114 SER n 1 115 GLN n 1 116 ILE n 1 117 GLN n 1 118 PRO n 1 119 PRO n 1 120 LYS n 1 121 ASP n 1 122 VAL n 1 123 ASP n 1 124 VAL n 1 125 PHE n 1 126 MET n 1 127 VAL n 1 128 ALA n 1 129 PRO n 1 130 LYS n 1 131 GLY n 1 132 PRO n 1 133 GLY n 1 134 HIS n 1 135 LEU n 1 136 VAL n 1 137 ARG n 1 138 ARG n 1 139 VAL n 1 140 TYR n 1 141 GLU n 1 142 ALA n 1 143 GLY n 1 144 GLY n 1 145 GLY n 1 146 VAL n 1 147 PRO n 1 148 ALA n 1 149 LEU n 1 150 ILE n 1 151 ALA n 1 152 VAL n 1 153 HIS n 1 154 GLN n 1 155 ASP n 1 156 ALA n 1 157 SER n 1 158 GLY n 1 159 GLN n 1 160 ALA n 1 161 LYS n 1 162 ASP n 1 163 LEU n 1 164 ALA n 1 165 LEU n 1 166 ALA n 1 167 TYR n 1 168 ALA n 1 169 ARG n 1 170 GLY n 1 171 ILE n 1 172 GLY n 1 173 ALA n 1 174 GLY n 1 175 ARG n 1 176 ALA n 1 177 GLY n 1 178 ILE n 1 179 LEU n 1 180 THR n 1 181 THR n 1 182 THR n 1 183 PHE n 1 184 ARG n 1 185 GLU n 1 186 GLU n 1 187 THR n 1 188 GLU n 1 189 THR n 1 190 ASP n 1 191 LEU n 1 192 PHE n 1 193 GLY n 1 194 GLU n 1 195 GLN n 1 196 ALA n 1 197 VAL n 1 198 LEU n 1 199 CYS n 1 200 GLY n 1 201 GLY n 1 202 LEU n 1 203 SER n 1 204 ALA n 1 205 LEU n 1 206 ILE n 1 207 LYS n 1 208 ALA n 1 209 GLY n 1 210 PHE n 1 211 GLU n 1 212 THR n 1 213 LEU n 1 214 VAL n 1 215 GLU n 1 216 ALA n 1 217 GLY n 1 218 TYR n 1 219 GLN n 1 220 PRO n 1 221 GLU n 1 222 ILE n 1 223 ALA n 1 224 TYR n 1 225 PHE n 1 226 GLU n 1 227 CYS n 1 228 LEU n 1 229 HIS n 1 230 GLU n 1 231 MET n 1 232 LYS n 1 233 LEU n 1 234 ILE n 1 235 VAL n 1 236 ASP n 1 237 LEU n 1 238 ILE n 1 239 TYR n 1 240 GLU n 1 241 GLY n 1 242 GLY n 1 243 LEU n 1 244 GLU n 1 245 TYR n 1 246 MET n 1 247 ARG n 1 248 TYR n 1 249 SER n 1 250 ILE n 1 251 SER n 1 252 ASP n 1 253 THR n 1 254 ALA n 1 255 GLN n 1 256 TRP n 1 257 GLY n 1 258 ASP n 1 259 PHE n 1 260 THR n 1 261 SER n 1 262 GLY n 1 263 PRO n 1 264 ARG n 1 265 ILE n 1 266 ILE n 1 267 ASN n 1 268 GLU n 1 269 GLU n 1 270 THR n 1 271 LYS n 1 272 LYS n 1 273 GLU n 1 274 MET n 1 275 ARG n 1 276 ARG n 1 277 ILE n 1 278 LEU n 1 279 ALA n 1 280 ASP n 1 281 ILE n 1 282 GLN n 1 283 SER n 1 284 GLY n 1 285 ALA n 1 286 PHE n 1 287 ALA n 1 288 LYS n 1 289 SER n 1 290 TRP n 1 291 ILE n 1 292 LEU n 1 293 GLU n 1 294 ASN n 1 295 GLN n 1 296 ALA n 1 297 ASN n 1 298 ARG n 1 299 PRO n 1 300 MET n 1 301 PHE n 1 302 ASN n 1 303 ALA n 1 304 ILE n 1 305 ASN n 1 306 ARG n 1 307 ARG n 1 308 GLU n 1 309 LEU n 1 310 GLU n 1 311 HIS n 1 312 PRO n 1 313 ILE n 1 314 GLU n 1 315 VAL n 1 316 VAL n 1 317 GLY n 1 318 ARG n 1 319 LYS n 1 320 LEU n 1 321 ARG n 1 322 SER n 1 323 MET n 1 324 MET n 1 325 PRO n 1 326 PHE n 1 327 ILE n 1 328 LYS n 1 329 ALA n 1 330 LYS n 1 331 ARG n 1 332 PRO n 1 333 GLY n 1 334 ASP n 1 335 ASP n 1 336 ARG n 1 337 VAL n 1 338 PRO n 1 339 ALA n 1 340 THR n 1 341 ALA n 1 342 ASP n 1 343 ARG n 1 344 ALA n 1 345 HIS n 1 346 HIS n 1 347 HIS n 1 348 HIS n 1 349 HIS n 1 350 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 350 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ilvC, Aaci_2227' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 446 / 104-1A' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Alicyclobacillus acidocaldarius subsp. acidocaldarius' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 521098 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 27009 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C8WR67_ALIAD _struct_ref.pdbx_db_accession C8WR67 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEKIYYDADISIQPLADKRIAVIGYGSQGHAHAQNLRDSGFDVVIGLRPGSSWAKAEADGFRVMAVGEAVEESDVIMILL PDERQPAVYEREIRPYLTAGKALAFAHGFNIHFSQIQPPKDVDVFMVAPKGPGHLVRRVYEAGGGVPALIAVHQDASGQA KDLALAYARGIGAGRAGILTTTFREETETDLFGEQAVLCGGLSALIKAGFETLVEAGYQPEIAYFECLHEMKLIVDLIYE GGLEYMRYSISDTAQWGDFTSGPRIINEETKKEMRRILADIQSGAFAKSWILENQANRPMFNAINRRELEHPIEVVGRKL RSMMPFIKAKRPGDDRVPATADRA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TSK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 344 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C8WR67 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 344 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 344 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TSK HIS A 345 ? UNP C8WR67 ? ? 'expression tag' 345 1 1 4TSK HIS A 346 ? UNP C8WR67 ? ? 'expression tag' 346 2 1 4TSK HIS A 347 ? UNP C8WR67 ? ? 'expression tag' 347 3 1 4TSK HIS A 348 ? UNP C8WR67 ? ? 'expression tag' 348 4 1 4TSK HIS A 349 ? UNP C8WR67 ? ? 'expression tag' 349 5 1 4TSK HIS A 350 ? UNP C8WR67 ? ? 'expression tag' 350 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NDP non-polymer . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ? 'C21 H30 N7 O17 P3' 745.421 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TLA non-polymer . 'L(+)-TARTARIC ACID' ? 'C4 H6 O6' 150.087 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TSK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1M sodium potassium tartrate, 200mM sodium chloride, 100mM imidazole pH 8' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-04-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'LIQUID NITROGEN-COOLED DOUBLE CRYSTAL K-B FOCUSING MIRRORS' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4TSK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.07 _reflns.d_resolution_low 124.10 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 38239 _reflns.number_obs 38239 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.400 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.087 _reflns.pdbx_netI_over_av_sigmaI 7.300 _reflns.pdbx_netI_over_sigmaI 8.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.103 _reflns.pdbx_Rpim_I_all 0.053 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 130927 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.070 2.180 ? 0.800 14347 ? ? 5024 ? 89.100 ? ? ? ? 0.936 ? ? ? ? ? ? ? ? 2.900 0.936 ? ? 1.100 ? 0.618 0 1 1 ? ? 2.180 2.310 ? 1.200 19233 ? ? 5357 ? 99.800 ? ? ? ? 0.637 ? ? ? ? ? ? ? ? 3.600 0.637 ? ? 2.000 ? 0.388 0 2 1 ? ? 2.310 2.470 ? 1.800 17502 ? ? 5008 ? 99.400 ? ? ? ? 0.423 ? ? ? ? ? ? ? ? 3.500 0.423 ? ? 3.000 ? 0.259 0 3 1 ? ? 2.470 2.670 ? 3.000 16449 ? ? 4690 ? 99.400 ? ? ? ? 0.261 ? ? ? ? ? ? ? ? 3.500 0.261 ? ? 4.600 ? 0.159 0 4 1 ? ? 2.670 2.920 ? 4.700 15289 ? ? 4313 ? 99.600 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 3.500 0.166 ? ? 6.900 ? 0.100 0 5 1 ? ? 2.920 3.270 ? 7.800 13492 ? ? 3899 ? 98.900 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 3.500 0.097 ? ? 10.700 ? 0.059 0 6 1 ? ? 3.270 3.770 ? 11.700 12320 ? ? 3462 ? 99.500 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 3.600 0.059 ? ? 17.100 ? 0.035 0 7 1 ? ? 3.770 4.620 ? 14.500 10162 ? ? 2940 ? 98.800 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 3.500 0.044 ? ? 22.800 ? 0.027 0 8 1 ? ? 4.620 6.540 ? 14.500 7799 ? ? 2277 ? 98.100 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 3.400 0.043 ? ? 24.000 ? 0.026 0 9 1 ? ? 6.540 39.244 ? 14.700 4334 ? ? 1269 ? 96.200 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 3.400 0.037 ? ? 27.300 ? 0.022 0 10 1 ? ? # _refine.entry_id 4TSK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 124.1000 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.8300 _refine.ls_number_reflns_obs 22066 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1556 _refine.ls_R_factor_R_work 0.1542 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.1822 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_number_reflns_R_free 1108 _refine.ls_number_reflns_R_work 20958 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 40.5480 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9580 _refine.correlation_coeff_Fo_to_Fc_free 0.9470 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.2020 _refine.pdbx_overall_ESU_R_Free 0.1670 _refine.overall_SU_ML 0.1070 _refine.overall_SU_B 4.7640 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 4KQW _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 114.500 _refine.B_iso_min 9.080 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 124.1000 _refine_hist.pdbx_number_atoms_ligand 61 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 2692 _refine_hist.pdbx_number_residues_total 333 _refine_hist.pdbx_B_iso_mean_ligand 41.58 _refine_hist.pdbx_B_iso_mean_solvent 34.56 _refine_hist.pdbx_number_atoms_protein 2585 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' r_bond_refined_d 2701 0.018 0.019 ? ? 'X-RAY DIFFRACTION' r_bond_other_d 2556 0.001 0.020 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 3658 1.998 1.987 ? ? 'X-RAY DIFFRACTION' r_angle_other_deg 5874 0.914 3.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 391 0.100 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 3057 0.009 0.021 ? ? 'X-RAY DIFFRACTION' r_gen_planes_other 626 0.001 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 1331 3.125 3.801 ? ? 'X-RAY DIFFRACTION' r_mcbond_other 1330 3.119 3.795 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 1662 4.181 5.686 ? ? # _refine_ls_shell.d_res_high 2.5000 _refine_ls_shell.d_res_low 2.5650 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 99.6300 _refine_ls_shell.number_reflns_R_work 1530 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.2120 _refine_ls_shell.R_factor_R_free 0.2670 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 74 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1604 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_obs ? # _struct.entry_id 4TSK _struct.title 'Ketol-acid reductoisomerase from Alicyclobacillus acidocaldarius' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TSK _struct_keywords.text 'ketol-acid reductoisomerase, Rossmann fold, NADPH-binding, OXIDOREDUCTASE, ISOMERASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE,ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 6 ? ILE A 10 ? TYR A 6 ILE A 10 5 ? 5 HELX_P HELX_P2 AA2 ILE A 12 ? ASP A 17 ? ILE A 12 ASP A 17 1 ? 6 HELX_P HELX_P3 AA3 GLY A 26 ? SER A 39 ? GLY A 26 SER A 39 1 ? 14 HELX_P HELX_P4 AA4 GLY A 50 ? ASP A 59 ? GLY A 50 ASP A 59 1 ? 10 HELX_P HELX_P5 AA5 VAL A 66 ? SER A 73 ? VAL A 66 SER A 73 1 ? 8 HELX_P HELX_P6 AA6 PRO A 81 ? GLU A 83 ? PRO A 81 GLU A 83 5 ? 3 HELX_P HELX_P7 AA7 ARG A 84 ? ILE A 93 ? ARG A 84 ILE A 93 1 ? 10 HELX_P HELX_P8 AA8 ARG A 94 ? LEU A 97 ? ARG A 94 LEU A 97 5 ? 4 HELX_P HELX_P9 AA9 GLY A 108 ? PHE A 113 ? GLY A 108 PHE A 113 1 ? 6 HELX_P HELX_P10 AB1 PRO A 132 ? ALA A 142 ? PRO A 132 ALA A 142 1 ? 11 HELX_P HELX_P11 AB2 GLN A 159 ? ILE A 171 ? GLN A 159 ILE A 171 1 ? 13 HELX_P HELX_P12 AB3 GLY A 172 ? ALA A 176 ? GLY A 172 ALA A 176 5 ? 5 HELX_P HELX_P13 AB4 THR A 182 ? VAL A 197 ? THR A 182 VAL A 197 1 ? 16 HELX_P HELX_P14 AB5 CYS A 199 ? ALA A 216 ? CYS A 199 ALA A 216 1 ? 18 HELX_P HELX_P15 AB6 GLN A 219 ? LEU A 228 ? GLN A 219 LEU A 228 1 ? 10 HELX_P HELX_P16 AB7 LEU A 228 ? ILE A 250 ? LEU A 228 ILE A 250 1 ? 23 HELX_P HELX_P17 AB8 SER A 251 ? ILE A 266 ? SER A 251 ILE A 266 1 ? 16 HELX_P HELX_P18 AB9 ASN A 267 ? SER A 283 ? ASN A 267 SER A 283 1 ? 17 HELX_P HELX_P19 AC1 GLY A 284 ? ALA A 296 ? GLY A 284 ALA A 296 1 ? 13 HELX_P HELX_P20 AC2 ARG A 298 ? GLU A 310 ? ARG A 298 GLU A 310 1 ? 13 HELX_P HELX_P21 AC3 HIS A 311 ? MET A 323 ? HIS A 311 MET A 323 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 190 O ? ? ? 1_555 C MG . MG ? ? A ASP 190 A MG 402 1_555 ? ? ? ? ? ? ? 2.882 ? ? metalc2 metalc ? ? A ASP 190 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 190 A MG 402 1_555 ? ? ? ? ? ? ? 2.746 ? ? metalc3 metalc ? ? A ASP 190 OD2 ? ? ? 1_555 D MG . MG ? ? A ASP 190 A MG 403 1_555 ? ? ? ? ? ? ? 2.024 ? ? metalc4 metalc ? ? A GLU 194 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 194 A MG 403 1_555 ? ? ? ? ? ? ? 2.214 ? ? metalc5 metalc ? ? A GLU 226 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 226 A MG 402 4_544 ? ? ? ? ? ? ? 2.405 ? ? metalc6 metalc ? ? A ARG 247 O ? ? ? 1_555 B MG . MG ? ? A ARG 247 A MG 401 1_555 ? ? ? ? ? ? ? 2.451 ? ? metalc7 metalc ? ? A ILE 250 O ? ? ? 1_555 B MG . MG ? ? A ILE 250 A MG 401 1_555 ? ? ? ? ? ? ? 2.566 ? ? metalc8 metalc ? ? A ASP 252 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 252 A MG 401 1_555 ? ? ? ? ? ? ? 2.575 ? ? metalc9 metalc ? ? A GLN 255 OE1 ? ? ? 1_555 B MG . MG ? ? A GLN 255 A MG 401 1_555 ? ? ? ? ? ? ? 2.598 ? ? metalc10 metalc ? ? B MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 401 A HOH 526 1_555 ? ? ? ? ? ? ? 2.449 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 E TLA . O2 ? ? A MG 402 A TLA 404 1_555 ? ? ? ? ? ? ? 2.802 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 E TLA . O4 ? ? A MG 402 A TLA 404 1_555 ? ? ? ? ? ? ? 2.520 ? ? metalc13 metalc ? ? C MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 402 A HOH 502 4_544 ? ? ? ? ? ? ? 2.554 ? ? metalc14 metalc ? ? D MG . MG ? ? ? 1_555 E TLA . O1 ? ? A MG 403 A TLA 404 1_555 ? ? ? ? ? ? ? 2.140 ? ? metalc15 metalc ? ? D MG . MG ? ? ? 1_555 E TLA . O2 ? ? A MG 403 A TLA 404 1_555 ? ? ? ? ? ? ? 2.159 ? ? metalc16 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 403 A HOH 512 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc17 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 403 A HOH 523 1_555 ? ? ? ? ? ? ? 2.136 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 4 ? TYR A 5 ? ILE A 4 TYR A 5 AA1 2 ILE A 178 ? THR A 180 ? ILE A 178 THR A 180 AA1 3 ALA A 148 ? GLN A 154 ? ALA A 148 GLN A 154 AA1 4 ASP A 123 ? PRO A 129 ? ASP A 123 PRO A 129 AA1 5 ALA A 102 ? PHE A 105 ? ALA A 102 PHE A 105 AA1 6 VAL A 75 ? ILE A 78 ? VAL A 75 ILE A 78 AA1 7 ARG A 19 ? ILE A 23 ? ARG A 19 ILE A 23 AA1 8 ASP A 42 ? LEU A 47 ? ASP A 42 LEU A 47 AA1 9 VAL A 63 ? ALA A 65 ? VAL A 63 ALA A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 5 ? N TYR A 5 O ILE A 178 ? O ILE A 178 AA1 2 3 O LEU A 179 ? O LEU A 179 N ILE A 150 ? N ILE A 150 AA1 3 4 O LEU A 149 ? O LEU A 149 N ALA A 128 ? N ALA A 128 AA1 4 5 O ASP A 123 ? O ASP A 123 N LEU A 103 ? N LEU A 103 AA1 5 6 O ALA A 104 ? O ALA A 104 N ILE A 76 ? N ILE A 76 AA1 6 7 O MET A 77 ? O MET A 77 N ILE A 23 ? N ILE A 23 AA1 7 8 N ILE A 20 ? N ILE A 20 O VAL A 44 ? O VAL A 44 AA1 8 9 N ILE A 45 ? N ILE A 45 O MET A 64 ? O MET A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 401 ? 7 'binding site for residue MG A 401' AC2 Software A MG 402 ? 5 'binding site for residue MG A 402' AC3 Software A MG 403 ? 5 'binding site for residue MG A 403' AC4 Software A TLA 404 ? 14 'binding site for residue TLA A 404' AC5 Software A NDP 405 ? 25 'binding site for residue NDP A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ARG A 247 ? ARG A 247 . ? 1_555 ? 2 AC1 7 TYR A 248 ? TYR A 248 . ? 1_555 ? 3 AC1 7 ILE A 250 ? ILE A 250 . ? 1_555 ? 4 AC1 7 ASP A 252 ? ASP A 252 . ? 1_555 ? 5 AC1 7 GLN A 255 ? GLN A 255 . ? 1_555 ? 6 AC1 7 HOH G . ? HOH A 519 . ? 1_555 ? 7 AC1 7 HOH G . ? HOH A 526 . ? 1_555 ? 8 AC2 5 ASP A 190 ? ASP A 190 . ? 1_555 ? 9 AC2 5 GLU A 194 ? GLU A 194 . ? 1_555 ? 10 AC2 5 GLU A 226 ? GLU A 226 . ? 4_544 ? 11 AC2 5 TLA E . ? TLA A 404 . ? 1_555 ? 12 AC2 5 HOH G . ? HOH A 502 . ? 4_544 ? 13 AC3 5 ASP A 190 ? ASP A 190 . ? 1_555 ? 14 AC3 5 GLU A 194 ? GLU A 194 . ? 1_555 ? 15 AC3 5 TLA E . ? TLA A 404 . ? 1_555 ? 16 AC3 5 HOH G . ? HOH A 512 . ? 1_555 ? 17 AC3 5 HOH G . ? HOH A 523 . ? 1_555 ? 18 AC4 14 PRO A 132 ? PRO A 132 . ? 1_555 ? 19 AC4 14 ASP A 190 ? ASP A 190 . ? 1_555 ? 20 AC4 14 GLU A 194 ? GLU A 194 . ? 1_555 ? 21 AC4 14 LEU A 198 ? LEU A 198 . ? 1_555 ? 22 AC4 14 GLU A 230 ? GLU A 230 . ? 4_544 ? 23 AC4 14 ILE A 250 ? ILE A 250 . ? 4_544 ? 24 AC4 14 SER A 251 ? SER A 251 . ? 4_544 ? 25 AC4 14 ALA A 254 ? ALA A 254 . ? 4_544 ? 26 AC4 14 MG C . ? MG A 402 . ? 1_555 ? 27 AC4 14 MG D . ? MG A 403 . ? 1_555 ? 28 AC4 14 NDP F . ? NDP A 405 . ? 1_555 ? 29 AC4 14 HOH G . ? HOH A 512 . ? 1_555 ? 30 AC4 14 HOH G . ? HOH A 515 . ? 1_555 ? 31 AC4 14 HOH G . ? HOH A 523 . ? 1_555 ? 32 AC5 25 TYR A 25 ? TYR A 25 . ? 1_555 ? 33 AC5 25 GLY A 26 ? GLY A 26 . ? 1_555 ? 34 AC5 25 SER A 27 ? SER A 27 . ? 1_555 ? 35 AC5 25 GLN A 28 ? GLN A 28 . ? 1_555 ? 36 AC5 25 ARG A 48 ? ARG A 48 . ? 1_555 ? 37 AC5 25 SER A 52 ? SER A 52 . ? 1_555 ? 38 AC5 25 LEU A 79 ? LEU A 79 . ? 1_555 ? 39 AC5 25 LEU A 80 ? LEU A 80 . ? 1_555 ? 40 AC5 25 PRO A 81 ? PRO A 81 . ? 1_555 ? 41 AC5 25 ASP A 82 ? ASP A 82 . ? 1_555 ? 42 AC5 25 GLN A 85 ? GLN A 85 . ? 1_555 ? 43 AC5 25 VAL A 88 ? VAL A 88 . ? 1_555 ? 44 AC5 25 ALA A 106 ? ALA A 106 . ? 1_555 ? 45 AC5 25 HIS A 107 ? HIS A 107 . ? 1_555 ? 46 AC5 25 GLY A 131 ? GLY A 131 . ? 1_555 ? 47 AC5 25 PRO A 132 ? PRO A 132 . ? 1_555 ? 48 AC5 25 GLY A 133 ? GLY A 133 . ? 1_555 ? 49 AC5 25 SER A 249 ? SER A 249 . ? 4_544 ? 50 AC5 25 ILE A 250 ? ILE A 250 . ? 4_544 ? 51 AC5 25 SER A 251 ? SER A 251 . ? 4_544 ? 52 AC5 25 TLA E . ? TLA A 404 . ? 1_555 ? 53 AC5 25 HOH G . ? HOH A 513 . ? 1_555 ? 54 AC5 25 HOH G . ? HOH A 528 . ? 1_555 ? 55 AC5 25 HOH G . ? HOH A 536 . ? 1_555 ? 56 AC5 25 HOH G . ? HOH A 541 . ? 1_555 ? # _atom_sites.entry_id 4TSK _atom_sites.fract_transf_matrix[1][1] 0.008058 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008058 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008058 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 CYS 199 199 199 CYS CYS A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 GLN 219 219 219 GLN GLN A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 TYR 224 224 224 TYR TYR A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 CYS 227 227 227 CYS CYS A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 HIS 229 229 229 HIS HIS A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 MET 231 231 231 MET MET A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 TYR 245 245 245 TYR TYR A . n A 1 246 MET 246 246 246 MET MET A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 TYR 248 248 248 TYR TYR A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 GLN 255 255 255 GLN GLN A . n A 1 256 TRP 256 256 256 TRP TRP A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 THR 260 260 260 THR THR A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 ASN 267 267 267 ASN ASN A . n A 1 268 GLU 268 268 268 GLU GLU A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 THR 270 270 270 THR THR A . n A 1 271 LYS 271 271 271 LYS LYS A . n A 1 272 LYS 272 272 272 LYS LYS A . n A 1 273 GLU 273 273 273 GLU GLU A . n A 1 274 MET 274 274 274 MET MET A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 ARG 276 276 276 ARG ARG A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 ASP 280 280 280 ASP ASP A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 GLN 282 282 282 GLN GLN A . n A 1 283 SER 283 283 283 SER SER A . n A 1 284 GLY 284 284 284 GLY GLY A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 SER 289 289 289 SER SER A . n A 1 290 TRP 290 290 290 TRP TRP A . n A 1 291 ILE 291 291 291 ILE ILE A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 ASN 294 294 294 ASN ASN A . n A 1 295 GLN 295 295 295 GLN GLN A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 ASN 297 297 297 ASN ASN A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 MET 300 300 300 MET MET A . n A 1 301 PHE 301 301 301 PHE PHE A . n A 1 302 ASN 302 302 302 ASN ASN A . n A 1 303 ALA 303 303 303 ALA ALA A . n A 1 304 ILE 304 304 304 ILE ILE A . n A 1 305 ASN 305 305 305 ASN ASN A . n A 1 306 ARG 306 306 306 ARG ARG A . n A 1 307 ARG 307 307 307 ARG ARG A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 GLU 310 310 310 GLU GLU A . n A 1 311 HIS 311 311 311 HIS HIS A . n A 1 312 PRO 312 312 312 PRO PRO A . n A 1 313 ILE 313 313 313 ILE ILE A . n A 1 314 GLU 314 314 314 GLU GLU A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 GLY 317 317 317 GLY GLY A . n A 1 318 ARG 318 318 318 ARG ARG A . n A 1 319 LYS 319 319 319 LYS LYS A . n A 1 320 LEU 320 320 320 LEU LEU A . n A 1 321 ARG 321 321 321 ARG ARG A . n A 1 322 SER 322 322 322 SER SER A . n A 1 323 MET 323 323 323 MET MET A . n A 1 324 MET 324 324 324 MET MET A . n A 1 325 PRO 325 325 325 PRO PRO A . n A 1 326 PHE 326 326 326 PHE PHE A . n A 1 327 ILE 327 327 327 ILE ILE A . n A 1 328 LYS 328 328 328 LYS LYS A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 LYS 330 330 330 LYS LYS A . n A 1 331 ARG 331 331 331 ARG ARG A . n A 1 332 PRO 332 332 332 PRO PRO A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 ASP 334 334 334 ASP ASP A . n A 1 335 ASP 335 335 ? ? ? A . n A 1 336 ARG 336 336 ? ? ? A . n A 1 337 VAL 337 337 ? ? ? A . n A 1 338 PRO 338 338 ? ? ? A . n A 1 339 ALA 339 339 ? ? ? A . n A 1 340 THR 340 340 ? ? ? A . n A 1 341 ALA 341 341 ? ? ? A . n A 1 342 ASP 342 342 ? ? ? A . n A 1 343 ARG 343 343 ? ? ? A . n A 1 344 ALA 344 344 ? ? ? A . n A 1 345 HIS 345 345 ? ? ? A . n A 1 346 HIS 346 346 ? ? ? A . n A 1 347 HIS 347 347 ? ? ? A . n A 1 348 HIS 348 348 ? ? ? A . n A 1 349 HIS 349 349 ? ? ? A . n A 1 350 HIS 350 350 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MG A . C 2 MG 1 402 2 MG MG A . D 2 MG 1 403 3 MG MG A . E 3 TLA 1 404 4 TLA TLA A . F 4 NDP 1 405 5 NDP NAP A . G 5 HOH 1 501 25 HOH HOH A . G 5 HOH 2 502 41 HOH HOH A . G 5 HOH 3 503 32 HOH HOH A . G 5 HOH 4 504 14 HOH HOH A . G 5 HOH 5 505 30 HOH HOH A . G 5 HOH 6 506 12 HOH HOH A . G 5 HOH 7 507 31 HOH HOH A . G 5 HOH 8 508 35 HOH HOH A . G 5 HOH 9 509 20 HOH HOH A . G 5 HOH 10 510 27 HOH HOH A . G 5 HOH 11 511 3 HOH HOH A . G 5 HOH 12 512 47 HOH HOH A . G 5 HOH 13 513 2 HOH HOH A . G 5 HOH 14 514 21 HOH HOH A . G 5 HOH 15 515 36 HOH HOH A . G 5 HOH 16 516 34 HOH HOH A . G 5 HOH 17 517 28 HOH HOH A . G 5 HOH 18 518 38 HOH HOH A . G 5 HOH 19 519 39 HOH HOH A . G 5 HOH 20 520 29 HOH HOH A . G 5 HOH 21 521 7 HOH HOH A . G 5 HOH 22 522 44 HOH HOH A . G 5 HOH 23 523 48 HOH HOH A . G 5 HOH 24 524 5 HOH HOH A . G 5 HOH 25 525 10 HOH HOH A . G 5 HOH 26 526 40 HOH HOH A . G 5 HOH 27 527 42 HOH HOH A . G 5 HOH 28 528 17 HOH HOH A . G 5 HOH 29 529 9 HOH HOH A . G 5 HOH 30 530 11 HOH HOH A . G 5 HOH 31 531 6 HOH HOH A . G 5 HOH 32 532 8 HOH HOH A . G 5 HOH 33 533 13 HOH HOH A . G 5 HOH 34 534 15 HOH HOH A . G 5 HOH 35 535 16 HOH HOH A . G 5 HOH 36 536 18 HOH HOH A . G 5 HOH 37 537 19 HOH HOH A . G 5 HOH 38 538 22 HOH HOH A . G 5 HOH 39 539 24 HOH HOH A . G 5 HOH 40 540 26 HOH HOH A . G 5 HOH 41 541 33 HOH HOH A . G 5 HOH 42 542 37 HOH HOH A . G 5 HOH 43 543 43 HOH HOH A . G 5 HOH 44 544 45 HOH HOH A . G 5 HOH 45 545 46 HOH HOH A . G 5 HOH 46 546 49 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G 1 2 A,B,C,D,E,F,G 1 3 A,B,C,D,E,F,G 1 4 A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -124.0990000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -124.0990000000 4 'crystal symmetry operation' 4_544 x,-y-1,-z-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -124.0990000000 0.0000000000 0.0000000000 -1.0000000000 -124.0990000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD1 ? A ASP 190 ? A ASP 190 ? 1_555 85.7 ? 2 O ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OE2 ? A GLU 226 ? A GLU 226 ? 1_555 112.0 ? 3 OD1 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OE2 ? A GLU 226 ? A GLU 226 ? 1_555 161.3 ? 4 O ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2 ? E TLA . ? A TLA 404 ? 1_555 109.0 ? 5 OD1 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2 ? E TLA . ? A TLA 404 ? 1_555 56.6 ? 6 OE2 ? A GLU 226 ? A GLU 226 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2 ? E TLA . ? A TLA 404 ? 1_555 119.2 ? 7 O ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O4 ? E TLA . ? A TLA 404 ? 1_555 143.5 ? 8 OD1 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O4 ? E TLA . ? A TLA 404 ? 1_555 114.7 ? 9 OE2 ? A GLU 226 ? A GLU 226 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O4 ? E TLA . ? A TLA 404 ? 1_555 54.3 ? 10 O2 ? E TLA . ? A TLA 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O4 ? E TLA . ? A TLA 404 ? 1_555 65.8 ? 11 O ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 502 ? 4_544 136.4 ? 12 OD1 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 502 ? 4_544 59.5 ? 13 OE2 ? A GLU 226 ? A GLU 226 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 502 ? 4_544 102.0 ? 14 O2 ? E TLA . ? A TLA 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 502 ? 4_544 74.8 ? 15 O4 ? E TLA . ? A TLA 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 502 ? 4_544 79.0 ? 16 OD2 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 OE1 ? A GLU 194 ? A GLU 194 ? 1_555 97.7 ? 17 OD2 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O1 ? E TLA . ? A TLA 404 ? 1_555 171.2 ? 18 OE1 ? A GLU 194 ? A GLU 194 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O1 ? E TLA . ? A TLA 404 ? 1_555 86.6 ? 19 OD2 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O2 ? E TLA . ? A TLA 404 ? 1_555 90.7 ? 20 OE1 ? A GLU 194 ? A GLU 194 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O2 ? E TLA . ? A TLA 404 ? 1_555 78.2 ? 21 O1 ? E TLA . ? A TLA 404 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O2 ? E TLA . ? A TLA 404 ? 1_555 82.7 ? 22 OD2 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 512 ? 1_555 97.3 ? 23 OE1 ? A GLU 194 ? A GLU 194 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 512 ? 1_555 94.2 ? 24 O1 ? E TLA . ? A TLA 404 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 512 ? 1_555 90.0 ? 25 O2 ? E TLA . ? A TLA 404 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 512 ? 1_555 169.6 ? 26 OD2 ? A ASP 190 ? A ASP 190 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 523 ? 1_555 86.4 ? 27 OE1 ? A GLU 194 ? A GLU 194 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 523 ? 1_555 170.7 ? 28 O1 ? E TLA . ? A TLA 404 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 523 ? 1_555 88.3 ? 29 O2 ? E TLA . ? A TLA 404 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 523 ? 1_555 93.5 ? 30 O ? G HOH . ? A HOH 512 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? G HOH . ? A HOH 523 ? 1_555 93.6 ? 31 O ? A ARG 247 ? A ARG 247 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? A ILE 250 ? A ILE 250 ? 1_555 85.6 ? 32 O ? A ARG 247 ? A ARG 247 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD1 ? A ASP 252 ? A ASP 252 ? 1_555 162.0 ? 33 O ? A ILE 250 ? A ILE 250 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD1 ? A ASP 252 ? A ASP 252 ? 1_555 109.8 ? 34 O ? A ARG 247 ? A ARG 247 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLN 255 ? A GLN 255 ? 1_555 80.2 ? 35 O ? A ILE 250 ? A ILE 250 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLN 255 ? A GLN 255 ? 1_555 139.1 ? 36 OD1 ? A ASP 252 ? A ASP 252 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLN 255 ? A GLN 255 ? 1_555 82.0 ? 37 O ? A ARG 247 ? A ARG 247 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? G HOH . ? A HOH 526 ? 1_555 101.3 ? 38 O ? A ILE 250 ? A ILE 250 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? G HOH . ? A HOH 526 ? 1_555 120.4 ? 39 OD1 ? A ASP 252 ? A ASP 252 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? G HOH . ? A HOH 526 ? 1_555 79.5 ? 40 OE1 ? A GLN 255 ? A GLN 255 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? G HOH . ? A HOH 526 ? 1_555 100.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-07-09 2 'Structure model' 1 1 2014-11-19 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' Other 4 3 'Structure model' 'Refinement description' 5 3 'Structure model' 'Source and taxonomy' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Derived calculations' 9 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity_src_gen 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' software 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' pdbx_struct_conn_angle 10 4 'Structure model' refine_hist 11 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 2 3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 3 'Structure model' '_software.classification' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.value' 20 4 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 21 4 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 22 4 'Structure model' '_struct_conn.pdbx_dist_value' 23 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0069 1 ? 'data scaling' ? ? 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 2013/01/04 ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/scala.html ? SCALA ? ? other 3.3.21 2 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Dec. 10, 2013' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.14 3 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 175 ? ? CZ A ARG 175 ? ? NH1 A ARG 175 ? ? 124.69 120.30 4.39 0.50 N 2 1 NE A ARG 247 ? ? CZ A ARG 247 ? ? NH1 A ARG 247 ? ? 123.46 120.30 3.16 0.50 N 3 1 NE A ARG 264 ? ? CZ A ARG 264 ? ? NH1 A ARG 264 ? ? 123.33 120.30 3.03 0.50 N 4 1 NE A ARG 306 ? ? CZ A ARG 306 ? ? NH1 A ARG 306 ? ? 124.33 120.30 4.03 0.50 N 5 1 NE A ARG 321 ? ? CZ A ARG 321 ? ? NH2 A ARG 321 ? ? 116.55 120.30 -3.75 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 25 ? ? -155.92 48.58 2 1 ILE A 93 ? ? -132.78 -57.58 3 1 ASP A 121 ? ? -12.32 -49.32 4 1 LYS A 130 ? ? -90.31 57.99 5 1 THR A 181 ? ? -162.46 -166.34 6 1 VAL A 197 ? ? -122.29 -67.69 7 1 CYS A 199 ? ? -126.75 -60.87 8 1 LYS A 328 ? ? -69.99 80.23 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 120 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 121 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 144.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 163 ? CD2 ? A LEU 163 CD2 2 1 Y 1 A LEU 179 ? CD1 ? A LEU 179 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 335 ? A ASP 335 3 1 Y 1 A ARG 336 ? A ARG 336 4 1 Y 1 A VAL 337 ? A VAL 337 5 1 Y 1 A PRO 338 ? A PRO 338 6 1 Y 1 A ALA 339 ? A ALA 339 7 1 Y 1 A THR 340 ? A THR 340 8 1 Y 1 A ALA 341 ? A ALA 341 9 1 Y 1 A ASP 342 ? A ASP 342 10 1 Y 1 A ARG 343 ? A ARG 343 11 1 Y 1 A ALA 344 ? A ALA 344 12 1 Y 1 A HIS 345 ? A HIS 345 13 1 Y 1 A HIS 346 ? A HIS 346 14 1 Y 1 A HIS 347 ? A HIS 347 15 1 Y 1 A HIS 348 ? A HIS 348 16 1 Y 1 A HIS 349 ? A HIS 349 17 1 Y 1 A HIS 350 ? A HIS 350 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 NDP PA P N S 251 NDP O1A O N N 252 NDP O2A O N N 253 NDP O5B O N N 254 NDP C5B C N N 255 NDP C4B C N R 256 NDP O4B O N N 257 NDP C3B C N R 258 NDP O3B O N N 259 NDP C2B C N R 260 NDP O2B O N N 261 NDP C1B C N R 262 NDP N9A N Y N 263 NDP C8A C Y N 264 NDP N7A N Y N 265 NDP C5A C Y N 266 NDP C6A C Y N 267 NDP N6A N N N 268 NDP N1A N Y N 269 NDP C2A C Y N 270 NDP N3A N Y N 271 NDP C4A C Y N 272 NDP O3 O N N 273 NDP PN P N S 274 NDP O1N O N N 275 NDP O2N O N N 276 NDP O5D O N N 277 NDP C5D C N N 278 NDP C4D C N R 279 NDP O4D O N N 280 NDP C3D C N S 281 NDP O3D O N N 282 NDP C2D C N R 283 NDP O2D O N N 284 NDP C1D C N R 285 NDP N1N N N N 286 NDP C2N C N N 287 NDP C3N C N N 288 NDP C7N C N N 289 NDP O7N O N N 290 NDP N7N N N N 291 NDP C4N C N N 292 NDP C5N C N N 293 NDP C6N C N N 294 NDP P2B P N N 295 NDP O1X O N N 296 NDP O2X O N N 297 NDP O3X O N N 298 NDP HOA2 H N N 299 NDP H51A H N N 300 NDP H52A H N N 301 NDP H4B H N N 302 NDP H3B H N N 303 NDP HO3A H N N 304 NDP H2B H N N 305 NDP H1B H N N 306 NDP H8A H N N 307 NDP H61A H N N 308 NDP H62A H N N 309 NDP H2A H N N 310 NDP H21N H N N 311 NDP H51N H N N 312 NDP H52N H N N 313 NDP H4D H N N 314 NDP H3D H N N 315 NDP HO3N H N N 316 NDP H2D H N N 317 NDP HO2N H N N 318 NDP H1D H N N 319 NDP H2N H N N 320 NDP H71N H N N 321 NDP H72N H N N 322 NDP H41N H N N 323 NDP H42N H N N 324 NDP H5N H N N 325 NDP H6N H N N 326 NDP HOP2 H N N 327 NDP HOP3 H N N 328 PHE N N N N 329 PHE CA C N S 330 PHE C C N N 331 PHE O O N N 332 PHE CB C N N 333 PHE CG C Y N 334 PHE CD1 C Y N 335 PHE CD2 C Y N 336 PHE CE1 C Y N 337 PHE CE2 C Y N 338 PHE CZ C Y N 339 PHE OXT O N N 340 PHE H H N N 341 PHE H2 H N N 342 PHE HA H N N 343 PHE HB2 H N N 344 PHE HB3 H N N 345 PHE HD1 H N N 346 PHE HD2 H N N 347 PHE HE1 H N N 348 PHE HE2 H N N 349 PHE HZ H N N 350 PHE HXT H N N 351 PRO N N N N 352 PRO CA C N S 353 PRO C C N N 354 PRO O O N N 355 PRO CB C N N 356 PRO CG C N N 357 PRO CD C N N 358 PRO OXT O N N 359 PRO H H N N 360 PRO HA H N N 361 PRO HB2 H N N 362 PRO HB3 H N N 363 PRO HG2 H N N 364 PRO HG3 H N N 365 PRO HD2 H N N 366 PRO HD3 H N N 367 PRO HXT H N N 368 SER N N N N 369 SER CA C N S 370 SER C C N N 371 SER O O N N 372 SER CB C N N 373 SER OG O N N 374 SER OXT O N N 375 SER H H N N 376 SER H2 H N N 377 SER HA H N N 378 SER HB2 H N N 379 SER HB3 H N N 380 SER HG H N N 381 SER HXT H N N 382 THR N N N N 383 THR CA C N S 384 THR C C N N 385 THR O O N N 386 THR CB C N R 387 THR OG1 O N N 388 THR CG2 C N N 389 THR OXT O N N 390 THR H H N N 391 THR H2 H N N 392 THR HA H N N 393 THR HB H N N 394 THR HG1 H N N 395 THR HG21 H N N 396 THR HG22 H N N 397 THR HG23 H N N 398 THR HXT H N N 399 TLA O1 O N N 400 TLA O11 O N N 401 TLA C1 C N N 402 TLA C2 C N R 403 TLA O2 O N N 404 TLA C3 C N R 405 TLA O3 O N N 406 TLA C4 C N N 407 TLA O4 O N N 408 TLA O41 O N N 409 TLA H11 H N N 410 TLA H2 H N N 411 TLA HA H N N 412 TLA H3 H N N 413 TLA HB H N N 414 TLA H41 H N N 415 TRP N N N N 416 TRP CA C N S 417 TRP C C N N 418 TRP O O N N 419 TRP CB C N N 420 TRP CG C Y N 421 TRP CD1 C Y N 422 TRP CD2 C Y N 423 TRP NE1 N Y N 424 TRP CE2 C Y N 425 TRP CE3 C Y N 426 TRP CZ2 C Y N 427 TRP CZ3 C Y N 428 TRP CH2 C Y N 429 TRP OXT O N N 430 TRP H H N N 431 TRP H2 H N N 432 TRP HA H N N 433 TRP HB2 H N N 434 TRP HB3 H N N 435 TRP HD1 H N N 436 TRP HE1 H N N 437 TRP HE3 H N N 438 TRP HZ2 H N N 439 TRP HZ3 H N N 440 TRP HH2 H N N 441 TRP HXT H N N 442 TYR N N N N 443 TYR CA C N S 444 TYR C C N N 445 TYR O O N N 446 TYR CB C N N 447 TYR CG C Y N 448 TYR CD1 C Y N 449 TYR CD2 C Y N 450 TYR CE1 C Y N 451 TYR CE2 C Y N 452 TYR CZ C Y N 453 TYR OH O N N 454 TYR OXT O N N 455 TYR H H N N 456 TYR H2 H N N 457 TYR HA H N N 458 TYR HB2 H N N 459 TYR HB3 H N N 460 TYR HD1 H N N 461 TYR HD2 H N N 462 TYR HE1 H N N 463 TYR HE2 H N N 464 TYR HH H N N 465 TYR HXT H N N 466 VAL N N N N 467 VAL CA C N S 468 VAL C C N N 469 VAL O O N N 470 VAL CB C N N 471 VAL CG1 C N N 472 VAL CG2 C N N 473 VAL OXT O N N 474 VAL H H N N 475 VAL H2 H N N 476 VAL HA H N N 477 VAL HB H N N 478 VAL HG11 H N N 479 VAL HG12 H N N 480 VAL HG13 H N N 481 VAL HG21 H N N 482 VAL HG22 H N N 483 VAL HG23 H N N 484 VAL HXT H N N 485 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NDP PA O1A doub N N 237 NDP PA O2A sing N N 238 NDP PA O5B sing N N 239 NDP PA O3 sing N N 240 NDP O2A HOA2 sing N N 241 NDP O5B C5B sing N N 242 NDP C5B C4B sing N N 243 NDP C5B H51A sing N N 244 NDP C5B H52A sing N N 245 NDP C4B O4B sing N N 246 NDP C4B C3B sing N N 247 NDP C4B H4B sing N N 248 NDP O4B C1B sing N N 249 NDP C3B O3B sing N N 250 NDP C3B C2B sing N N 251 NDP C3B H3B sing N N 252 NDP O3B HO3A sing N N 253 NDP C2B O2B sing N N 254 NDP C2B C1B sing N N 255 NDP C2B H2B sing N N 256 NDP O2B P2B sing N N 257 NDP C1B N9A sing N N 258 NDP C1B H1B sing N N 259 NDP N9A C8A sing Y N 260 NDP N9A C4A sing Y N 261 NDP C8A N7A doub Y N 262 NDP C8A H8A sing N N 263 NDP N7A C5A sing Y N 264 NDP C5A C6A sing Y N 265 NDP C5A C4A doub Y N 266 NDP C6A N6A sing N N 267 NDP C6A N1A doub Y N 268 NDP N6A H61A sing N N 269 NDP N6A H62A sing N N 270 NDP N1A C2A sing Y N 271 NDP C2A N3A doub Y N 272 NDP C2A H2A sing N N 273 NDP N3A C4A sing Y N 274 NDP O3 PN sing N N 275 NDP PN O1N doub N N 276 NDP PN O2N sing N N 277 NDP PN O5D sing N N 278 NDP O2N H21N sing N N 279 NDP O5D C5D sing N N 280 NDP C5D C4D sing N N 281 NDP C5D H51N sing N N 282 NDP C5D H52N sing N N 283 NDP C4D O4D sing N N 284 NDP C4D C3D sing N N 285 NDP C4D H4D sing N N 286 NDP O4D C1D sing N N 287 NDP C3D O3D sing N N 288 NDP C3D C2D sing N N 289 NDP C3D H3D sing N N 290 NDP O3D HO3N sing N N 291 NDP C2D O2D sing N N 292 NDP C2D C1D sing N N 293 NDP C2D H2D sing N N 294 NDP O2D HO2N sing N N 295 NDP C1D N1N sing N N 296 NDP C1D H1D sing N N 297 NDP N1N C2N sing N N 298 NDP N1N C6N sing N N 299 NDP C2N C3N doub N N 300 NDP C2N H2N sing N N 301 NDP C3N C7N sing N N 302 NDP C3N C4N sing N N 303 NDP C7N O7N doub N N 304 NDP C7N N7N sing N N 305 NDP N7N H71N sing N N 306 NDP N7N H72N sing N N 307 NDP C4N C5N sing N N 308 NDP C4N H41N sing N N 309 NDP C4N H42N sing N N 310 NDP C5N C6N doub N N 311 NDP C5N H5N sing N N 312 NDP C6N H6N sing N N 313 NDP P2B O1X doub N N 314 NDP P2B O2X sing N N 315 NDP P2B O3X sing N N 316 NDP O2X HOP2 sing N N 317 NDP O3X HOP3 sing N N 318 PHE N CA sing N N 319 PHE N H sing N N 320 PHE N H2 sing N N 321 PHE CA C sing N N 322 PHE CA CB sing N N 323 PHE CA HA sing N N 324 PHE C O doub N N 325 PHE C OXT sing N N 326 PHE CB CG sing N N 327 PHE CB HB2 sing N N 328 PHE CB HB3 sing N N 329 PHE CG CD1 doub Y N 330 PHE CG CD2 sing Y N 331 PHE CD1 CE1 sing Y N 332 PHE CD1 HD1 sing N N 333 PHE CD2 CE2 doub Y N 334 PHE CD2 HD2 sing N N 335 PHE CE1 CZ doub Y N 336 PHE CE1 HE1 sing N N 337 PHE CE2 CZ sing Y N 338 PHE CE2 HE2 sing N N 339 PHE CZ HZ sing N N 340 PHE OXT HXT sing N N 341 PRO N CA sing N N 342 PRO N CD sing N N 343 PRO N H sing N N 344 PRO CA C sing N N 345 PRO CA CB sing N N 346 PRO CA HA sing N N 347 PRO C O doub N N 348 PRO C OXT sing N N 349 PRO CB CG sing N N 350 PRO CB HB2 sing N N 351 PRO CB HB3 sing N N 352 PRO CG CD sing N N 353 PRO CG HG2 sing N N 354 PRO CG HG3 sing N N 355 PRO CD HD2 sing N N 356 PRO CD HD3 sing N N 357 PRO OXT HXT sing N N 358 SER N CA sing N N 359 SER N H sing N N 360 SER N H2 sing N N 361 SER CA C sing N N 362 SER CA CB sing N N 363 SER CA HA sing N N 364 SER C O doub N N 365 SER C OXT sing N N 366 SER CB OG sing N N 367 SER CB HB2 sing N N 368 SER CB HB3 sing N N 369 SER OG HG sing N N 370 SER OXT HXT sing N N 371 THR N CA sing N N 372 THR N H sing N N 373 THR N H2 sing N N 374 THR CA C sing N N 375 THR CA CB sing N N 376 THR CA HA sing N N 377 THR C O doub N N 378 THR C OXT sing N N 379 THR CB OG1 sing N N 380 THR CB CG2 sing N N 381 THR CB HB sing N N 382 THR OG1 HG1 sing N N 383 THR CG2 HG21 sing N N 384 THR CG2 HG22 sing N N 385 THR CG2 HG23 sing N N 386 THR OXT HXT sing N N 387 TLA O1 C1 doub N N 388 TLA O11 C1 sing N N 389 TLA O11 H11 sing N N 390 TLA C1 C2 sing N N 391 TLA C2 O2 sing N N 392 TLA C2 C3 sing N N 393 TLA C2 H2 sing N N 394 TLA O2 HA sing N N 395 TLA C3 O3 sing N N 396 TLA C3 C4 sing N N 397 TLA C3 H3 sing N N 398 TLA O3 HB sing N N 399 TLA C4 O4 doub N N 400 TLA C4 O41 sing N N 401 TLA O41 H41 sing N N 402 TRP N CA sing N N 403 TRP N H sing N N 404 TRP N H2 sing N N 405 TRP CA C sing N N 406 TRP CA CB sing N N 407 TRP CA HA sing N N 408 TRP C O doub N N 409 TRP C OXT sing N N 410 TRP CB CG sing N N 411 TRP CB HB2 sing N N 412 TRP CB HB3 sing N N 413 TRP CG CD1 doub Y N 414 TRP CG CD2 sing Y N 415 TRP CD1 NE1 sing Y N 416 TRP CD1 HD1 sing N N 417 TRP CD2 CE2 doub Y N 418 TRP CD2 CE3 sing Y N 419 TRP NE1 CE2 sing Y N 420 TRP NE1 HE1 sing N N 421 TRP CE2 CZ2 sing Y N 422 TRP CE3 CZ3 doub Y N 423 TRP CE3 HE3 sing N N 424 TRP CZ2 CH2 doub Y N 425 TRP CZ2 HZ2 sing N N 426 TRP CZ3 CH2 sing Y N 427 TRP CZ3 HZ3 sing N N 428 TRP CH2 HH2 sing N N 429 TRP OXT HXT sing N N 430 TYR N CA sing N N 431 TYR N H sing N N 432 TYR N H2 sing N N 433 TYR CA C sing N N 434 TYR CA CB sing N N 435 TYR CA HA sing N N 436 TYR C O doub N N 437 TYR C OXT sing N N 438 TYR CB CG sing N N 439 TYR CB HB2 sing N N 440 TYR CB HB3 sing N N 441 TYR CG CD1 doub Y N 442 TYR CG CD2 sing Y N 443 TYR CD1 CE1 sing Y N 444 TYR CD1 HD1 sing N N 445 TYR CD2 CE2 doub Y N 446 TYR CD2 HD2 sing N N 447 TYR CE1 CZ doub Y N 448 TYR CE1 HE1 sing N N 449 TYR CE2 CZ sing Y N 450 TYR CE2 HE2 sing N N 451 TYR CZ OH sing N N 452 TYR OH HH sing N N 453 TYR OXT HXT sing N N 454 VAL N CA sing N N 455 VAL N H sing N N 456 VAL N H2 sing N N 457 VAL CA C sing N N 458 VAL CA CB sing N N 459 VAL CA HA sing N N 460 VAL C O doub N N 461 VAL C OXT sing N N 462 VAL CB CG1 sing N N 463 VAL CB CG2 sing N N 464 VAL CB HB sing N N 465 VAL CG1 HG11 sing N N 466 VAL CG1 HG12 sing N N 467 VAL CG1 HG13 sing N N 468 VAL CG2 HG21 sing N N 469 VAL CG2 HG22 sing N N 470 VAL CG2 HG23 sing N N 471 VAL OXT HXT sing N N 472 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'L(+)-TARTARIC ACID' TLA 4 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NDP 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4KQW _pdbx_initial_refinement_model.details ? #