data_4TSX # _entry.id 4TSX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4TSX WWPDB D_1000202224 # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 1ITG _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TSX _pdbx_database_status.recvd_initial_deposition_date 2014-06-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, L.' 1 'Kvaratskhelia, M.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Retrovirology _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-4690 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 100 _citation.page_last 100 _citation.title ;The mechanism of H171T resistance reveals the importance of N -protonated His171 for the binding of allosteric inhibitor BI-D to HIV-1 integrase. ; _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1186/s12977-014-0100-1 _citation.pdbx_database_id_PubMed 25421939 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Slaughter, A.' 1 primary 'Jurado, K.A.' 2 primary 'Deng, N.' 3 primary 'Feng, L.' 4 primary 'Kessl, J.J.' 5 primary 'Shkriabai, N.' 6 primary 'Larue, R.C.' 7 primary 'Fadel, H.J.' 8 primary 'Patel, P.A.' 9 primary 'Jena, N.' 10 primary 'Fuchs, J.R.' 11 primary 'Poeschla, E.' 12 primary 'Levy, R.M.' 13 primary 'Engelman, A.' 14 primary 'Kvaratskhelia, M.' 15 # _cell.length_a 72.248 _cell.length_b 72.248 _cell.length_c 66.032 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4TSX _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TSX _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Integrase 18115.402 1 ? 'H171T, F185K' 'Catalytical core Domain, UNP residues 50-212' ? 2 non-polymer syn '(2S)-tert-butoxy[4-(3,4-dihydro-2H-chromen-6-yl)-2-methylquinolin-3-yl]ethanoic acid' 405.486 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 56 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLD(CAF)THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTT VKAA(CAF)WWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAETLKTAVQMAVFIHNKKRKGGIGGYSAGERIV DIIATDIQTKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAETLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ TKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 GLY n 1 4 GLN n 1 5 VAL n 1 6 ASP n 1 7 CYS n 1 8 SER n 1 9 PRO n 1 10 GLY n 1 11 ILE n 1 12 TRP n 1 13 GLN n 1 14 LEU n 1 15 ASP n 1 16 CAF n 1 17 THR n 1 18 HIS n 1 19 LEU n 1 20 GLU n 1 21 GLY n 1 22 LYS n 1 23 VAL n 1 24 ILE n 1 25 LEU n 1 26 VAL n 1 27 ALA n 1 28 VAL n 1 29 HIS n 1 30 VAL n 1 31 ALA n 1 32 SER n 1 33 GLY n 1 34 TYR n 1 35 ILE n 1 36 GLU n 1 37 ALA n 1 38 GLU n 1 39 VAL n 1 40 ILE n 1 41 PRO n 1 42 ALA n 1 43 GLU n 1 44 THR n 1 45 GLY n 1 46 GLN n 1 47 GLU n 1 48 THR n 1 49 ALA n 1 50 TYR n 1 51 PHE n 1 52 LEU n 1 53 LEU n 1 54 LYS n 1 55 LEU n 1 56 ALA n 1 57 GLY n 1 58 ARG n 1 59 TRP n 1 60 PRO n 1 61 VAL n 1 62 LYS n 1 63 THR n 1 64 VAL n 1 65 HIS n 1 66 THR n 1 67 ASP n 1 68 ASN n 1 69 GLY n 1 70 SER n 1 71 ASN n 1 72 PHE n 1 73 THR n 1 74 SER n 1 75 THR n 1 76 THR n 1 77 VAL n 1 78 LYS n 1 79 ALA n 1 80 ALA n 1 81 CAF n 1 82 TRP n 1 83 TRP n 1 84 ALA n 1 85 GLY n 1 86 ILE n 1 87 LYS n 1 88 GLN n 1 89 GLU n 1 90 PHE n 1 91 GLY n 1 92 ILE n 1 93 PRO n 1 94 TYR n 1 95 ASN n 1 96 PRO n 1 97 GLN n 1 98 SER n 1 99 GLN n 1 100 GLY n 1 101 VAL n 1 102 ILE n 1 103 GLU n 1 104 SER n 1 105 MET n 1 106 ASN n 1 107 LYS n 1 108 GLU n 1 109 LEU n 1 110 LYS n 1 111 LYS n 1 112 ILE n 1 113 ILE n 1 114 GLY n 1 115 GLN n 1 116 VAL n 1 117 ARG n 1 118 ASP n 1 119 GLN n 1 120 ALA n 1 121 GLU n 1 122 THR n 1 123 LEU n 1 124 LYS n 1 125 THR n 1 126 ALA n 1 127 VAL n 1 128 GLN n 1 129 MET n 1 130 ALA n 1 131 VAL n 1 132 PHE n 1 133 ILE n 1 134 HIS n 1 135 ASN n 1 136 LYS n 1 137 LYS n 1 138 ARG n 1 139 LYS n 1 140 GLY n 1 141 GLY n 1 142 ILE n 1 143 GLY n 1 144 GLY n 1 145 TYR n 1 146 SER n 1 147 ALA n 1 148 GLY n 1 149 GLU n 1 150 ARG n 1 151 ILE n 1 152 VAL n 1 153 ASP n 1 154 ILE n 1 155 ILE n 1 156 ALA n 1 157 THR n 1 158 ASP n 1 159 ILE n 1 160 GLN n 1 161 THR n 1 162 LYS n 1 163 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pol _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F2WR39_9HIV1 _struct_ref.pdbx_db_accession F2WR39 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ TKE ; _struct_ref.pdbx_align_begin 50 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TSX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F2WR39 _struct_ref_seq.db_align_beg 50 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TSX THR A 122 ? UNP F2WR39 HIS 171 'engineered mutation' 171 1 1 4TSX LYS A 136 ? UNP F2WR39 PHE 185 'engineered mutation' 185 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAF 'L-peptide linking' n S-DIMETHYLARSINOYL-CYSTEINE 'CYSTEIN-S-YL CACODYLATE' 'C5 H12 As N O3 S' 241.140 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LF0 non-polymer . '(2S)-tert-butoxy[4-(3,4-dihydro-2H-chromen-6-yl)-2-methylquinolin-3-yl]ethanoic acid' ? 'C25 H27 N O4' 405.486 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TSX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.5 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '8% PEG8000, 0.1 M Na Cacodylate, pH 6.5, 0.1 M Ammonium Sulphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details mirrors _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-09-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type OTHER _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4TSX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.940 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15117 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.900 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 48.449 _reflns.pdbx_netI_over_sigmaI 24.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.431 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 73892 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.940 1.970 ? 4.22 ? ? ? 731 ? 100.000 ? ? ? ? 0.445 ? ? ? ? ? ? ? ? 4.800 ? 1.476 ? ? ? ? 0 1 1 ? ? 1.970 2.010 ? ? ? ? ? 764 ? 100.000 ? ? ? ? 0.382 ? ? ? ? ? ? ? ? 4.800 ? 1.542 ? ? ? ? 0 2 1 ? ? 2.010 2.050 ? ? ? ? ? 730 ? 100.000 ? ? ? ? 0.339 ? ? ? ? ? ? ? ? 4.800 ? 1.614 ? ? ? ? 0 3 1 ? ? 2.050 2.090 ? ? ? ? ? 750 ? 100.000 ? ? ? ? 0.294 ? ? ? ? ? ? ? ? 4.800 ? 1.777 ? ? ? ? 0 4 1 ? ? 2.090 2.140 ? ? ? ? ? 742 ? 100.000 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 4.900 ? 1.798 ? ? ? ? 0 5 1 ? ? 2.140 2.180 ? ? ? ? ? 743 ? 100.000 ? ? ? ? 0.199 ? ? ? ? ? ? ? ? 4.900 ? 1.915 ? ? ? ? 0 6 1 ? ? 2.180 2.240 ? ? ? ? ? 741 ? 99.700 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 4.900 ? 2.003 ? ? ? ? 0 7 1 ? ? 2.240 2.300 ? ? ? ? ? 749 ? 100.000 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 4.900 ? 2.242 ? ? ? ? 0 8 1 ? ? 2.300 2.370 ? ? ? ? ? 750 ? 100.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 4.900 ? 2.125 ? ? ? ? 0 9 1 ? ? 2.370 2.440 ? ? ? ? ? 760 ? 100.000 ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 4.900 ? 2.310 ? ? ? ? 0 10 1 ? ? 2.440 2.530 ? ? ? ? ? 737 ? 99.900 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 4.900 ? 2.592 ? ? ? ? 0 11 1 ? ? 2.530 2.630 ? ? ? ? ? 753 ? 100.000 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 4.900 ? 2.675 ? ? ? ? 0 12 1 ? ? 2.630 2.750 ? ? ? ? ? 745 ? 100.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 4.900 ? 2.768 ? ? ? ? 0 13 1 ? ? 2.750 2.900 ? ? ? ? ? 762 ? 99.700 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 5.000 ? 2.841 ? ? ? ? 0 14 1 ? ? 2.900 3.080 ? ? ? ? ? 745 ? 99.700 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 5.000 ? 3.166 ? ? ? ? 0 15 1 ? ? 3.080 3.320 ? ? ? ? ? 769 ? 99.900 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 4.900 ? 3.143 ? ? ? ? 0 16 1 ? ? 3.320 3.650 ? ? ? ? ? 759 ? 100.000 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 5.000 ? 3.210 ? ? ? ? 0 17 1 ? ? 3.650 4.180 ? ? ? ? ? 775 ? 99.900 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 4.900 ? 3.112 ? ? ? ? 0 18 1 ? ? 4.180 5.260 ? ? ? ? ? 778 ? 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 4.900 ? 3.027 ? ? ? ? 0 19 1 ? ? 5.260 50.000 ? ? ? ? ? 834 ? 99.600 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 4.600 ? 3.025 ? ? ? ? 0 20 1 ? ? # _refine.aniso_B[1][1] 0.1600 _refine.aniso_B[1][2] 0.0800 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.1600 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.5100 _refine.B_iso_max 134.000 _refine.B_iso_mean 46.1930 _refine.B_iso_min 25.230 _refine.correlation_coeff_Fo_to_Fc 0.9650 _refine.correlation_coeff_Fo_to_Fc_free 0.9510 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TSX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9400 _refine.ls_d_res_low 50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15047 _refine.ls_number_reflns_R_free 1517 _refine.ls_number_reflns_R_work 13530 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5900 _refine.ls_percent_reflns_R_free 10.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1931 _refine.ls_R_factor_R_free 0.2210 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1899 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2264 _refine.ls_wR_factor_R_work 0.1910 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1440 _refine.pdbx_overall_ESU_R_Free 0.1340 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.1510 _refine.overall_SU_ML 0.0910 _refine.overall_SU_R_Cruickshank_DPI 0.1421 _refine.overall_SU_R_free 0.1338 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8455 # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9400 _refine_hist.d_res_low 50 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 1212 _refine_hist.pdbx_number_residues_total 145 _refine_hist.pdbx_B_iso_mean_ligand 49.64 _refine_hist.pdbx_B_iso_mean_solvent 52.34 _refine_hist.pdbx_number_atoms_protein 1116 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 1185 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.735 1.988 1599 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.104 5.000 140 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.861 25.000 46 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.971 15.000 197 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 24.515 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.142 0.200 180 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 846 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 3.610 4.414 578 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.546 6.544 712 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.170 4.668 607 ? r_scbond_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.940 _refine_ls_shell.d_res_low 1.9910 _refine_ls_shell.number_reflns_all 1096 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 127 _refine_ls_shell.number_reflns_R_work 969 _refine_ls_shell.percent_reflns_obs 99.5500 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2950 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2440 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? # _struct.entry_id 4TSX _struct.title 'HIV-1 Integrase Catalytic Core Domain Mutant Complexed with Allosteric Inhibitor' _struct.pdbx_descriptor 'HIV-1 Integrase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TSX _struct_keywords.text 'HIV Integrase, CCD, H171T, DDE motif, dimer interface, allosteric inhibitor, ALLINI, quinoline, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.details 'Functional biological unit is the tetramer of full length protein' _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.pdbx_formula_weight ? _struct_biol.pdbx_formula_weight_method ? _struct_biol.pdbx_aggregation_state ? _struct_biol.pdbx_assembly_method ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 44 ? TRP A 59 ? THR A 93 TRP A 108 1 ? 16 HELX_P HELX_P2 AA2 ASN A 68 ? THR A 73 ? ASN A 117 THR A 122 5 ? 6 HELX_P HELX_P3 AA3 SER A 74 ? GLY A 85 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 AA4 SER A 104 ? ARG A 117 ? SER A 153 ARG A 166 1 ? 14 HELX_P HELX_P5 AA5 ASP A 118 ? ALA A 120 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 AA6 THR A 122 ? LYS A 137 ? THR A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 AA7 SER A 146 ? GLN A 160 ? SER A 195 GLN A 209 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ASP 15 C ? ? ? 1_555 A CAF 16 N ? ? A ASP 64 A CAF 65 1_555 ? ? ? ? ? ? ? 1.529 ? covale2 covale both ? A CAF 16 C ? ? ? 1_555 A THR 17 N ? ? A CAF 65 A THR 66 1_555 ? ? ? ? ? ? ? 1.468 ? covale3 covale both ? A ALA 80 C ? ? ? 1_555 A CAF 81 N ? ? A ALA 129 A CAF 130 1_555 ? ? ? ? ? ? ? 1.534 ? covale4 covale both ? A CAF 81 C ? ? ? 1_555 A TRP 82 N ? ? A CAF 130 A TRP 131 1_555 ? ? ? ? ? ? ? 1.575 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 103 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 152 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 104 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 153 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.18 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 35 ? ILE A 40 ? ILE A 84 ILE A 89 AA1 2 LYS A 22 ? HIS A 29 ? LYS A 71 HIS A 78 AA1 3 ILE A 11 ? LEU A 19 ? ILE A 60 LEU A 68 AA1 4 THR A 63 ? HIS A 65 ? THR A 112 HIS A 114 AA1 5 LYS A 87 ? GLN A 88 ? LYS A 136 GLN A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 36 ? O GLU A 85 N ALA A 27 ? N ALA A 76 AA1 2 3 O VAL A 26 ? O VAL A 75 N ASP A 15 ? N ASP A 64 AA1 3 4 N TRP A 12 ? N TRP A 61 O HIS A 65 ? O HIS A 114 AA1 4 5 N VAL A 64 ? N VAL A 113 O LYS A 87 ? O LYS A 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A LF0 301 ? 14 'binding site for residue LF0 A 301' AC2 Software A SO4 302 ? 7 'binding site for residue SO4 A 302' AC3 Software A SO4 303 ? 2 'binding site for residue SO4 A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 GLN A 46 ? GLN A 95 . ? 1_555 ? 2 AC1 14 LEU A 53 ? LEU A 102 . ? 1_555 ? 3 AC1 14 THR A 75 ? THR A 124 . ? 1_555 ? 4 AC1 14 THR A 76 ? THR A 125 . ? 1_555 ? 5 AC1 14 ALA A 80 ? ALA A 129 . ? 1_555 ? 6 AC1 14 TRP A 83 ? TRP A 132 . ? 1_555 ? 7 AC1 14 GLN A 119 ? GLN A 168 . ? 5_555 ? 8 AC1 14 ALA A 120 ? ALA A 169 . ? 5_555 ? 9 AC1 14 GLU A 121 ? GLU A 170 . ? 5_555 ? 10 AC1 14 THR A 122 ? THR A 171 . ? 5_555 ? 11 AC1 14 THR A 125 ? THR A 174 . ? 5_555 ? 12 AC1 14 MET A 129 ? MET A 178 . ? 5_555 ? 13 AC1 14 HOH E . ? HOH A 420 . ? 1_555 ? 14 AC1 14 HOH E . ? HOH A 423 . ? 1_555 ? 15 AC2 7 SER A 74 ? SER A 123 . ? 1_555 ? 16 AC2 7 THR A 75 ? THR A 124 . ? 1_555 ? 17 AC2 7 THR A 76 ? THR A 125 . ? 1_555 ? 18 AC2 7 LYS A 137 ? LYS A 186 . ? 6_455 ? 19 AC2 7 ARG A 138 ? ARG A 187 . ? 6_455 ? 20 AC2 7 HOH E . ? HOH A 404 . ? 1_555 ? 21 AC2 7 HOH E . ? HOH A 419 . ? 1_555 ? 22 AC3 2 THR A 17 ? THR A 66 . ? 1_555 ? 23 AC3 2 HIS A 18 ? HIS A 67 . ? 1_555 ? # _atom_sites.entry_id 4TSX _atom_sites.fract_transf_matrix[1][1] 0.013841 _atom_sites.fract_transf_matrix[1][2] 0.007991 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015982 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015144 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol AS C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 50 ? ? ? A . n A 1 2 HIS 2 51 ? ? ? A . n A 1 3 GLY 3 52 ? ? ? A . n A 1 4 GLN 4 53 ? ? ? A . n A 1 5 VAL 5 54 ? ? ? A . n A 1 6 ASP 6 55 55 ASP ASP A . n A 1 7 CYS 7 56 56 CYS CYS A . n A 1 8 SER 8 57 57 SER SER A . n A 1 9 PRO 9 58 58 PRO PRO A . n A 1 10 GLY 10 59 59 GLY GLY A . n A 1 11 ILE 11 60 60 ILE ILE A . n A 1 12 TRP 12 61 61 TRP TRP A . n A 1 13 GLN 13 62 62 GLN GLN A . n A 1 14 LEU 14 63 63 LEU LEU A . n A 1 15 ASP 15 64 64 ASP ASP A . n A 1 16 CAF 16 65 65 CAF CAF A . n A 1 17 THR 17 66 66 THR THR A . n A 1 18 HIS 18 67 67 HIS HIS A . n A 1 19 LEU 19 68 68 LEU LEU A . n A 1 20 GLU 20 69 69 GLU GLU A . n A 1 21 GLY 21 70 70 GLY GLY A . n A 1 22 LYS 22 71 71 LYS LYS A . n A 1 23 VAL 23 72 72 VAL VAL A . n A 1 24 ILE 24 73 73 ILE ILE A . n A 1 25 LEU 25 74 74 LEU LEU A . n A 1 26 VAL 26 75 75 VAL VAL A . n A 1 27 ALA 27 76 76 ALA ALA A . n A 1 28 VAL 28 77 77 VAL VAL A . n A 1 29 HIS 29 78 78 HIS HIS A . n A 1 30 VAL 30 79 79 VAL VAL A . n A 1 31 ALA 31 80 80 ALA ALA A . n A 1 32 SER 32 81 81 SER SER A . n A 1 33 GLY 33 82 82 GLY GLY A . n A 1 34 TYR 34 83 83 TYR TYR A . n A 1 35 ILE 35 84 84 ILE ILE A . n A 1 36 GLU 36 85 85 GLU GLU A . n A 1 37 ALA 37 86 86 ALA ALA A . n A 1 38 GLU 38 87 87 GLU GLU A . n A 1 39 VAL 39 88 88 VAL VAL A . n A 1 40 ILE 40 89 89 ILE ILE A . n A 1 41 PRO 41 90 90 PRO PRO A . n A 1 42 ALA 42 91 91 ALA ALA A . n A 1 43 GLU 43 92 92 GLU GLU A . n A 1 44 THR 44 93 93 THR THR A . n A 1 45 GLY 45 94 94 GLY GLY A . n A 1 46 GLN 46 95 95 GLN GLN A . n A 1 47 GLU 47 96 96 GLU GLU A . n A 1 48 THR 48 97 97 THR THR A . n A 1 49 ALA 49 98 98 ALA ALA A . n A 1 50 TYR 50 99 99 TYR TYR A . n A 1 51 PHE 51 100 100 PHE PHE A . n A 1 52 LEU 52 101 101 LEU LEU A . n A 1 53 LEU 53 102 102 LEU LEU A . n A 1 54 LYS 54 103 103 LYS LYS A . n A 1 55 LEU 55 104 104 LEU LEU A . n A 1 56 ALA 56 105 105 ALA ALA A . n A 1 57 GLY 57 106 106 GLY GLY A . n A 1 58 ARG 58 107 107 ARG ARG A . n A 1 59 TRP 59 108 108 TRP TRP A . n A 1 60 PRO 60 109 109 PRO PRO A . n A 1 61 VAL 61 110 110 VAL VAL A . n A 1 62 LYS 62 111 111 LYS LYS A . n A 1 63 THR 63 112 112 THR THR A . n A 1 64 VAL 64 113 113 VAL VAL A . n A 1 65 HIS 65 114 114 HIS HIS A . n A 1 66 THR 66 115 115 THR THR A . n A 1 67 ASP 67 116 116 ASP ASP A . n A 1 68 ASN 68 117 117 ASN ASN A . n A 1 69 GLY 69 118 118 GLY GLY A . n A 1 70 SER 70 119 119 SER SER A . n A 1 71 ASN 71 120 120 ASN ASN A . n A 1 72 PHE 72 121 121 PHE PHE A . n A 1 73 THR 73 122 122 THR THR A . n A 1 74 SER 74 123 123 SER SER A . n A 1 75 THR 75 124 124 THR THR A . n A 1 76 THR 76 125 125 THR THR A . n A 1 77 VAL 77 126 126 VAL VAL A . n A 1 78 LYS 78 127 127 LYS LYS A . n A 1 79 ALA 79 128 128 ALA ALA A . n A 1 80 ALA 80 129 129 ALA ALA A . n A 1 81 CAF 81 130 130 CAF CAF A . n A 1 82 TRP 82 131 131 TRP TRP A . n A 1 83 TRP 83 132 132 TRP TRP A . n A 1 84 ALA 84 133 133 ALA ALA A . n A 1 85 GLY 85 134 134 GLY GLY A . n A 1 86 ILE 86 135 135 ILE ILE A . n A 1 87 LYS 87 136 136 LYS LYS A . n A 1 88 GLN 88 137 137 GLN GLN A . n A 1 89 GLU 89 138 138 GLU GLU A . n A 1 90 PHE 90 139 139 PHE PHE A . n A 1 91 GLY 91 140 140 GLY GLY A . n A 1 92 ILE 92 141 141 ILE ILE A . n A 1 93 PRO 93 142 142 PRO PRO A . n A 1 94 TYR 94 143 ? ? ? A . n A 1 95 ASN 95 144 ? ? ? A . n A 1 96 PRO 96 145 ? ? ? A . n A 1 97 GLN 97 146 ? ? ? A . n A 1 98 SER 98 147 ? ? ? A . n A 1 99 GLN 99 148 ? ? ? A . n A 1 100 GLY 100 149 ? ? ? A . n A 1 101 VAL 101 150 ? ? ? A . n A 1 102 ILE 102 151 ? ? ? A . n A 1 103 GLU 103 152 152 GLU GLU A . n A 1 104 SER 104 153 153 SER SER A . n A 1 105 MET 105 154 154 MET MET A . n A 1 106 ASN 106 155 155 ASN ASN A . n A 1 107 LYS 107 156 156 LYS LYS A . n A 1 108 GLU 108 157 157 GLU GLU A . n A 1 109 LEU 109 158 158 LEU LEU A . n A 1 110 LYS 110 159 159 LYS LYS A . n A 1 111 LYS 111 160 160 LYS LYS A . n A 1 112 ILE 112 161 161 ILE ILE A . n A 1 113 ILE 113 162 162 ILE ILE A . n A 1 114 GLY 114 163 163 GLY GLY A . n A 1 115 GLN 115 164 164 GLN GLN A . n A 1 116 VAL 116 165 165 VAL VAL A . n A 1 117 ARG 117 166 166 ARG ARG A . n A 1 118 ASP 118 167 167 ASP ASP A . n A 1 119 GLN 119 168 168 GLN GLN A . n A 1 120 ALA 120 169 169 ALA ALA A . n A 1 121 GLU 121 170 170 GLU GLU A . n A 1 122 THR 122 171 171 THR THR A . n A 1 123 LEU 123 172 172 LEU LEU A . n A 1 124 LYS 124 173 173 LYS LYS A . n A 1 125 THR 125 174 174 THR THR A . n A 1 126 ALA 126 175 175 ALA ALA A . n A 1 127 VAL 127 176 176 VAL VAL A . n A 1 128 GLN 128 177 177 GLN GLN A . n A 1 129 MET 129 178 178 MET MET A . n A 1 130 ALA 130 179 179 ALA ALA A . n A 1 131 VAL 131 180 180 VAL VAL A . n A 1 132 PHE 132 181 181 PHE PHE A . n A 1 133 ILE 133 182 182 ILE ILE A . n A 1 134 HIS 134 183 183 HIS HIS A . n A 1 135 ASN 135 184 184 ASN ASN A . n A 1 136 LYS 136 185 185 LYS LYS A . n A 1 137 LYS 137 186 186 LYS LYS A . n A 1 138 ARG 138 187 187 ARG ARG A . n A 1 139 LYS 139 188 188 LYS LYS A . n A 1 140 GLY 140 189 189 GLY GLY A . n A 1 141 GLY 141 190 190 GLY GLY A . n A 1 142 ILE 142 191 ? ? ? A . n A 1 143 GLY 143 192 192 GLY GLY A . n A 1 144 GLY 144 193 193 GLY GLY A . n A 1 145 TYR 145 194 194 TYR TYR A . n A 1 146 SER 146 195 195 SER SER A . n A 1 147 ALA 147 196 196 ALA ALA A . n A 1 148 GLY 148 197 197 GLY GLY A . n A 1 149 GLU 149 198 198 GLU GLU A . n A 1 150 ARG 150 199 199 ARG ARG A . n A 1 151 ILE 151 200 200 ILE ILE A . n A 1 152 VAL 152 201 201 VAL VAL A . n A 1 153 ASP 153 202 202 ASP ASP A . n A 1 154 ILE 154 203 203 ILE ILE A . n A 1 155 ILE 155 204 204 ILE ILE A . n A 1 156 ALA 156 205 205 ALA ALA A . n A 1 157 THR 157 206 206 THR THR A . n A 1 158 ASP 158 207 207 ASP ASP A . n A 1 159 ILE 159 208 208 ILE ILE A . n A 1 160 GLN 160 209 209 GLN GLN A . n A 1 161 THR 161 210 ? ? ? A . n A 1 162 LYS 162 211 ? ? ? A . n A 1 163 GLU 163 212 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 LF0 1 301 1 LF0 LF0 A . C 3 SO4 1 302 1 SO4 SO4 A . D 3 SO4 1 303 2 SO4 SO4 A . E 4 HOH 1 401 51 HOH HOH A . E 4 HOH 2 402 43 HOH HOH A . E 4 HOH 3 403 20 HOH HOH A . E 4 HOH 4 404 39 HOH HOH A . E 4 HOH 5 405 17 HOH HOH A . E 4 HOH 6 406 37 HOH HOH A . E 4 HOH 7 407 18 HOH HOH A . E 4 HOH 8 408 2 HOH HOH A . E 4 HOH 9 409 42 HOH HOH A . E 4 HOH 10 410 52 HOH HOH A . E 4 HOH 11 411 45 HOH HOH A . E 4 HOH 12 412 25 HOH HOH A . E 4 HOH 13 413 16 HOH HOH A . E 4 HOH 14 414 53 HOH HOH A . E 4 HOH 15 415 26 HOH HOH A . E 4 HOH 16 416 6 HOH HOH A . E 4 HOH 17 417 9 HOH HOH A . E 4 HOH 18 418 3 HOH HOH A . E 4 HOH 19 419 35 HOH HOH A . E 4 HOH 20 420 48 HOH HOH A . E 4 HOH 21 421 15 HOH HOH A . E 4 HOH 22 422 7 HOH HOH A . E 4 HOH 23 423 29 HOH HOH A . E 4 HOH 24 424 55 HOH HOH A . E 4 HOH 25 425 46 HOH HOH A . E 4 HOH 26 426 40 HOH HOH A . E 4 HOH 27 427 30 HOH HOH A . E 4 HOH 28 428 1 HOH HOH A . E 4 HOH 29 429 4 HOH HOH A . E 4 HOH 30 430 5 HOH HOH A . E 4 HOH 31 431 8 HOH HOH A . E 4 HOH 32 432 10 HOH HOH A . E 4 HOH 33 433 11 HOH HOH A . E 4 HOH 34 434 12 HOH HOH A . E 4 HOH 35 435 13 HOH HOH A . E 4 HOH 36 436 14 HOH HOH A . E 4 HOH 37 437 19 HOH HOH A . E 4 HOH 38 438 21 HOH HOH A . E 4 HOH 39 439 22 HOH HOH A . E 4 HOH 40 440 23 HOH HOH A . E 4 HOH 41 441 24 HOH HOH A . E 4 HOH 42 442 27 HOH HOH A . E 4 HOH 43 443 28 HOH HOH A . E 4 HOH 44 444 31 HOH HOH A . E 4 HOH 45 445 32 HOH HOH A . E 4 HOH 46 446 33 HOH HOH A . E 4 HOH 47 447 34 HOH HOH A . E 4 HOH 48 448 36 HOH HOH A . E 4 HOH 49 449 38 HOH HOH A . E 4 HOH 50 450 41 HOH HOH A . E 4 HOH 51 451 44 HOH HOH A . E 4 HOH 52 452 47 HOH HOH A . E 4 HOH 53 453 49 HOH HOH A . E 4 HOH 54 454 50 HOH HOH A . E 4 HOH 55 455 54 HOH HOH A . E 4 HOH 56 456 56 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CAF 16 A CAF 65 ? CYS 'modified residue' 2 A CAF 81 A CAF 130 ? CYS 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3910 ? 1 MORE -63 ? 1 'SSA (A^2)' 13590 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.0213333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-12-17 2 'Structure model' 1 1 2017-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Refinement description' 3 2 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_src_gen 2 2 'Structure model' pdbx_struct_oper_list 3 2 'Structure model' software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.14 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 107 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A ASP 64 ? ? N A CAF 65 ? ? 1.529 1.336 0.193 0.023 Y 2 1 C A ALA 129 ? ? N A CAF 130 ? ? 1.534 1.336 0.198 0.023 Y 3 1 C A CAF 130 ? ? N A TRP 131 ? ? 1.575 1.336 0.239 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 107 ? ? CZ A ARG 107 ? ? NH1 A ARG 107 ? ? 116.99 120.30 -3.31 0.50 N 2 1 O A ALA 129 ? ? C A ALA 129 ? ? N A CAF 130 ? ? 110.28 122.70 -12.42 1.60 Y # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ASP _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 64 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -14.33 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A CAF 65 ? CE2 ? A CAF 16 CE2 2 1 Y 1 A CAF 130 ? CE2 ? A CAF 81 CE2 3 1 Y 1 A LYS 188 ? CG ? A LYS 139 CG 4 1 Y 1 A LYS 188 ? CD ? A LYS 139 CD 5 1 Y 1 A LYS 188 ? CE ? A LYS 139 CE 6 1 Y 1 A LYS 188 ? NZ ? A LYS 139 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 50 ? A MET 1 2 1 Y 1 A HIS 51 ? A HIS 2 3 1 Y 1 A GLY 52 ? A GLY 3 4 1 Y 1 A GLN 53 ? A GLN 4 5 1 Y 1 A VAL 54 ? A VAL 5 6 1 Y 1 A TYR 143 ? A TYR 94 7 1 Y 1 A ASN 144 ? A ASN 95 8 1 Y 1 A PRO 145 ? A PRO 96 9 1 Y 1 A GLN 146 ? A GLN 97 10 1 Y 1 A SER 147 ? A SER 98 11 1 Y 1 A GLN 148 ? A GLN 99 12 1 Y 1 A GLY 149 ? A GLY 100 13 1 Y 1 A VAL 150 ? A VAL 101 14 1 Y 1 A ILE 151 ? A ILE 102 15 1 Y 1 A ILE 191 ? A ILE 142 16 1 Y 1 A THR 210 ? A THR 161 17 1 Y 1 A LYS 211 ? A LYS 162 18 1 Y 1 A GLU 212 ? A GLU 163 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2S)-tert-butoxy[4-(3,4-dihydro-2H-chromen-6-yl)-2-methylquinolin-3-yl]ethanoic acid' LF0 3 'SULFATE ION' SO4 4 water HOH #