data_4TV6 # _entry.id 4TV6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4TV6 pdb_00004tv6 10.2210/pdb4tv6/pdb WWPDB D_1000202326 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-29 2 'Structure model' 1 1 2014-11-05 3 'Structure model' 1 2 2014-12-17 4 'Structure model' 1 3 2017-11-22 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Refinement description' 7 4 'Structure model' 'Source and taxonomy' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' entity_src_gen 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' software 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' diffrn_radiation_wavelength 10 5 'Structure model' refine_hist # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 8 5 'Structure model' '_refine_hist.pdbx_number_atoms_protein' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TV6 _pdbx_database_status.recvd_initial_deposition_date 2014-06-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '4TV5 is the wild type protein' _pdbx_database_related.db_id 4TV5 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kobylarz, M.J.' 1 'Grigg, J.C.' 2 'Murphy, M.E.P.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 289 _citation.language ? _citation.page_first 33797 _citation.page_last 33807 _citation.title 'SbnG, a Citrate Synthase in Staphylococcus aureus: A NEW FOLD ON AN OLD ENZYME.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M114.603175 _citation.pdbx_database_id_PubMed 25336653 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kobylarz, M.J.' 1 ? primary 'Grigg, J.C.' 2 ? primary 'Sheldon, J.R.' 3 ? primary 'Heinrichs, D.E.' 4 ? primary 'Murphy, M.E.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '2-dehydro-3-deoxyglucarate aldolase' 28753.910 1 ? E151Q ? ? 2 non-polymer syn 'OXALOACETATE ION' 131.064 1 ? ? ? ? 3 water nat water 18.015 43 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MMQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIRAAEAAHIIPIVRVTAVIDRD IIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSLNGGRMARFGRTPLLDAMEMANEHIMVIAMIQDVEGVMAID DIAQVEGLDMIVEGAADLSQSLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK IYRHLSASLATSKQKGDEG ; _entity_poly.pdbx_seq_one_letter_code_can ;MMQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIRAAEAAHIIPIVRVTAVIDRD IIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSLNGGRMARFGRTPLLDAMEMANEHIMVIAMIQDVEGVMAID DIAQVEGLDMIVEGAADLSQSLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK IYRHLSASLATSKQKGDEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'OXALOACETATE ION' OAA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 GLN n 1 4 GLN n 1 5 LEU n 1 6 SER n 1 7 LEU n 1 8 LYS n 1 9 HIS n 1 10 ARG n 1 11 LEU n 1 12 ASN n 1 13 ASN n 1 14 GLY n 1 15 ASP n 1 16 SER n 1 17 VAL n 1 18 TYR n 1 19 GLY n 1 20 ILE n 1 21 PHE n 1 22 ASN n 1 23 SER n 1 24 ILE n 1 25 PRO n 1 26 ASP n 1 27 PRO n 1 28 LEU n 1 29 MET n 1 30 ILE n 1 31 GLU n 1 32 VAL n 1 33 ILE n 1 34 ALA n 1 35 ALA n 1 36 SER n 1 37 GLY n 1 38 TYR n 1 39 ASP n 1 40 PHE n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 ASP n 1 45 THR n 1 46 GLU n 1 47 HIS n 1 48 VAL n 1 49 ALA n 1 50 ILE n 1 51 ASN n 1 52 ASP n 1 53 GLU n 1 54 THR n 1 55 LEU n 1 56 ALA n 1 57 HIS n 1 58 LEU n 1 59 ILE n 1 60 ARG n 1 61 ALA n 1 62 ALA n 1 63 GLU n 1 64 ALA n 1 65 ALA n 1 66 HIS n 1 67 ILE n 1 68 ILE n 1 69 PRO n 1 70 ILE n 1 71 VAL n 1 72 ARG n 1 73 VAL n 1 74 THR n 1 75 ALA n 1 76 VAL n 1 77 ILE n 1 78 ASP n 1 79 ARG n 1 80 ASP n 1 81 ILE n 1 82 ILE n 1 83 LYS n 1 84 VAL n 1 85 LEU n 1 86 ASP n 1 87 MET n 1 88 GLY n 1 89 ALA n 1 90 ARG n 1 91 GLY n 1 92 ILE n 1 93 ILE n 1 94 VAL n 1 95 PRO n 1 96 HIS n 1 97 VAL n 1 98 LYS n 1 99 ASP n 1 100 ARG n 1 101 GLU n 1 102 THR n 1 103 VAL n 1 104 GLU n 1 105 HIS n 1 106 ILE n 1 107 VAL n 1 108 LYS n 1 109 LEU n 1 110 SER n 1 111 ARG n 1 112 TYR n 1 113 TYR n 1 114 PRO n 1 115 GLN n 1 116 GLY n 1 117 LEU n 1 118 ARG n 1 119 SER n 1 120 LEU n 1 121 ASN n 1 122 GLY n 1 123 GLY n 1 124 ARG n 1 125 MET n 1 126 ALA n 1 127 ARG n 1 128 PHE n 1 129 GLY n 1 130 ARG n 1 131 THR n 1 132 PRO n 1 133 LEU n 1 134 LEU n 1 135 ASP n 1 136 ALA n 1 137 MET n 1 138 GLU n 1 139 MET n 1 140 ALA n 1 141 ASN n 1 142 GLU n 1 143 HIS n 1 144 ILE n 1 145 MET n 1 146 VAL n 1 147 ILE n 1 148 ALA n 1 149 MET n 1 150 ILE n 1 151 GLN n 1 152 ASP n 1 153 VAL n 1 154 GLU n 1 155 GLY n 1 156 VAL n 1 157 MET n 1 158 ALA n 1 159 ILE n 1 160 ASP n 1 161 ASP n 1 162 ILE n 1 163 ALA n 1 164 GLN n 1 165 VAL n 1 166 GLU n 1 167 GLY n 1 168 LEU n 1 169 ASP n 1 170 MET n 1 171 ILE n 1 172 VAL n 1 173 GLU n 1 174 GLY n 1 175 ALA n 1 176 ALA n 1 177 ASP n 1 178 LEU n 1 179 SER n 1 180 GLN n 1 181 SER n 1 182 LEU n 1 183 GLY n 1 184 ILE n 1 185 PRO n 1 186 TRP n 1 187 GLN n 1 188 THR n 1 189 ARG n 1 190 ASP n 1 191 ASP n 1 192 GLN n 1 193 VAL n 1 194 THR n 1 195 SER n 1 196 HIS n 1 197 VAL n 1 198 GLN n 1 199 HIS n 1 200 ILE n 1 201 PHE n 1 202 GLU n 1 203 VAL n 1 204 VAL n 1 205 ASN n 1 206 ALA n 1 207 HIS n 1 208 GLY n 1 209 LYS n 1 210 HIS n 1 211 PHE n 1 212 CYS n 1 213 ALA n 1 214 LEU n 1 215 PRO n 1 216 ARG n 1 217 GLU n 1 218 ASP n 1 219 GLU n 1 220 ASP n 1 221 ILE n 1 222 ALA n 1 223 LYS n 1 224 TRP n 1 225 GLN n 1 226 ALA n 1 227 GLN n 1 228 GLY n 1 229 VAL n 1 230 GLN n 1 231 THR n 1 232 PHE n 1 233 ILE n 1 234 LEU n 1 235 GLY n 1 236 ASP n 1 237 ASP n 1 238 ARG n 1 239 GLY n 1 240 LYS n 1 241 ILE n 1 242 TYR n 1 243 ARG n 1 244 HIS n 1 245 LEU n 1 246 SER n 1 247 ALA n 1 248 SER n 1 249 LEU n 1 250 ALA n 1 251 THR n 1 252 SER n 1 253 LYS n 1 254 GLN n 1 255 LYS n 1 256 GLY n 1 257 ASP n 1 258 GLU n 1 259 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 259 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sbnG, NWMN_0066' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Newman _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 426430 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OAA non-polymer . 'OXALOACETATE ION' ? 'C4 H3 O5 -1' 131.064 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 MET 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ALA 75 75 ? ? ? A . n A 1 76 VAL 76 76 ? ? ? A . n A 1 77 ILE 77 77 ? ? ? A . n A 1 78 ASP 78 78 ? ? ? A . n A 1 79 ARG 79 79 ? ? ? A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASN 121 121 ? ? ? A . n A 1 122 GLY 122 122 ? ? ? A . n A 1 123 GLY 123 123 ? ? ? A . n A 1 124 ARG 124 124 ? ? ? A . n A 1 125 MET 125 125 ? ? ? A . n A 1 126 ALA 126 126 ? ? ? A . n A 1 127 ARG 127 127 ? ? ? A . n A 1 128 PHE 128 128 ? ? ? A . n A 1 129 GLY 129 129 ? ? ? A . n A 1 130 ARG 130 130 ? ? ? A . n A 1 131 THR 131 131 ? ? ? A . n A 1 132 PRO 132 132 ? ? ? A . n A 1 133 LEU 133 133 ? ? ? A . n A 1 134 LEU 134 134 ? ? ? A . n A 1 135 ASP 135 135 ? ? ? A . n A 1 136 ALA 136 136 ? ? ? A . n A 1 137 MET 137 137 ? ? ? A . n A 1 138 GLU 138 138 ? ? ? A . n A 1 139 MET 139 139 ? ? ? A . n A 1 140 ALA 140 140 ? ? ? A . n A 1 141 ASN 141 141 ? ? ? A . n A 1 142 GLU 142 142 ? ? ? A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 TRP 186 186 186 TRP TRP A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ASN 205 205 205 ASN ASN A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 HIS 210 210 210 HIS HIS A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 CYS 212 212 212 CYS CYS A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 LYS 223 223 223 LYS LYS A . n A 1 224 TRP 224 224 224 TRP TRP A . n A 1 225 GLN 225 225 225 GLN GLN A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 GLN 227 227 227 GLN GLN A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 PHE 232 232 232 PHE PHE A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 ALA 247 247 247 ALA ALA A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 THR 251 251 251 THR THR A . n A 1 252 SER 252 252 252 SER SER A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 GLU 258 258 ? ? ? A . n A 1 259 GLY 259 259 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 OAA 1 301 1 OAA OAA A . C 3 HOH 1 401 6 HOH HOH A . C 3 HOH 2 402 23 HOH HOH A . C 3 HOH 3 403 1 HOH HOH A . C 3 HOH 4 404 30 HOH HOH A . C 3 HOH 5 405 4 HOH HOH A . C 3 HOH 6 406 5 HOH HOH A . C 3 HOH 7 407 16 HOH HOH A . C 3 HOH 8 408 20 HOH HOH A . C 3 HOH 9 409 17 HOH HOH A . C 3 HOH 10 410 25 HOH HOH A . C 3 HOH 11 411 34 HOH HOH A . C 3 HOH 12 412 45 HOH HOH A . C 3 HOH 13 413 32 HOH HOH A . C 3 HOH 14 414 2 HOH HOH A . C 3 HOH 15 415 9 HOH HOH A . C 3 HOH 16 416 39 HOH HOH A . C 3 HOH 17 417 15 HOH HOH A . C 3 HOH 18 418 11 HOH HOH A . C 3 HOH 19 419 31 HOH HOH A . C 3 HOH 20 420 28 HOH HOH A . C 3 HOH 21 421 26 HOH HOH A . C 3 HOH 22 422 13 HOH HOH A . C 3 HOH 23 423 42 HOH HOH A . C 3 HOH 24 424 3 HOH HOH A . C 3 HOH 25 425 7 HOH HOH A . C 3 HOH 26 426 8 HOH HOH A . C 3 HOH 27 427 10 HOH HOH A . C 3 HOH 28 428 12 HOH HOH A . C 3 HOH 29 429 14 HOH HOH A . C 3 HOH 30 430 18 HOH HOH A . C 3 HOH 31 431 19 HOH HOH A . C 3 HOH 32 432 21 HOH HOH A . C 3 HOH 33 433 22 HOH HOH A . C 3 HOH 34 434 24 HOH HOH A . C 3 HOH 35 435 27 HOH HOH A . C 3 HOH 36 436 29 HOH HOH A . C 3 HOH 37 437 33 HOH HOH A . C 3 HOH 38 438 35 HOH HOH A . C 3 HOH 39 439 36 HOH HOH A . C 3 HOH 40 440 41 HOH HOH A . C 3 HOH 41 441 43 HOH HOH A . C 3 HOH 42 442 44 HOH HOH A . C 3 HOH 43 443 46 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.14 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.length_a 77.240 _cell.length_b 77.240 _cell.length_c 75.810 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4TV6 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 3 1 2' _symmetry.entry_id 4TV6 _symmetry.Int_Tables_number 149 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TV6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.78 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5% (v/v) tascimate, 0.1 M HEPES, 10% PEG MME 5000, 40 mM gaunidine hydrochloride, 5 mM oxaloacetate, 5 mM coeznyme A' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-03-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54180 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54180 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 27.050 _reflns.pdbx_number_measured_all 34715 _reflns.number_all 7119 _reflns.number_obs 7119 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_netI_over_sigmaI 11.500 _reflns.pdbx_Rsym_value 0.089 _reflns.pdbx_redundancy 4.900 _reflns.percent_possible_obs 87.500 _reflns.pdbx_Rrim_I_all 0.097 _reflns.pdbx_Rpim_I_all 0.037 _reflns.B_iso_Wilson_estimate 39.000 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4TV6 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 2.600 2.740 ? 4906 ? 0 0.246 5.100 0.040 ? 4.800 ? ? ? 1018 ? ? ? ? 87.300 ? 0.017 ? 1 2 8.220 27.050 ? 1118 ? 0 0.040 20.100 0.056 ? 4.900 ? ? ? 227 ? ? ? ? 79.700 ? 0.023 ? # _refine.entry_id 4TV6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 27.0520 _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 87.4900 _refine.ls_number_reflns_obs 7115 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2342 _refine.ls_R_factor_R_work 0.2320 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2819 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.5300 _refine.ls_number_reflns_R_free 322 _refine.ls_number_reflns_R_work 6793 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 56.5870 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 133.410 _refine.B_iso_min 15.340 _refine.pdbx_overall_phase_error 30.1000 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 27.0520 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1805 _refine_hist.pdbx_number_residues_total 225 _refine_hist.pdbx_B_iso_mean_ligand 65.98 _refine_hist.pdbx_B_iso_mean_solvent 36.78 _refine_hist.pdbx_number_atoms_protein 1753 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1791 0.003 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2426 0.748 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 282 0.022 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 315 0.004 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 654 15.124 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 2.6003 3.2752 2 88.0000 3369 . 0.2686 0.3169 . 167 . 3536 . 'X-RAY DIFFRACTION' . 3.2752 27.0535 2 87.0000 3424 . 0.2173 0.2668 . 155 . 3579 . 'X-RAY DIFFRACTION' . # _struct.entry_id 4TV6 _struct.title 'Crystal Structure of Citrate Synthase Variant SbnG E151Q' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TV6 _struct_keywords.text 'siderophore biosynthesis, iron, citrate synthase, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A6QDA6_STAAE _struct_ref.pdbx_db_accession A6QDA6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIRAAEAAHIIPIVRVTAVIDRD IIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSLNGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAID DIAQVEGLDMIVEGAADLSQSLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK IYRHLSASLATSKQKGDEG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TV6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 259 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A6QDA6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 259 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 259 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4TV6 _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 151 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A6QDA6 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 151 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 151 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 22550 ? 1 MORE -66 ? 1 'SSA (A^2)' 51150 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 -y,-x,-z 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 -x+y,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 x,x-y,-z 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.details ;The biological assembly is a hexamer generated from the monomer in the asymmetric unit by the operation:-x+y,y,-z, -x+y,-x,z, x,x-y,-z, -y,x-y,z and -y,-x,-z ; _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.pdbx_formula_weight ? _struct_biol.pdbx_formula_weight_method ? _struct_biol.pdbx_aggregation_state ? _struct_biol.pdbx_assembly_method ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 6 ? ASN A 12 ? SER A 6 ASN A 12 1 ? 7 HELX_P HELX_P2 AA2 ASP A 26 ? SER A 36 ? ASP A 26 SER A 36 1 ? 11 HELX_P HELX_P3 AA3 ASN A 51 ? ALA A 65 ? ASN A 51 ALA A 65 1 ? 15 HELX_P HELX_P4 AA4 ILE A 81 ? MET A 87 ? ILE A 81 MET A 87 1 ? 7 HELX_P HELX_P5 AA5 ASP A 99 ? SER A 110 ? ASP A 99 SER A 110 1 ? 12 HELX_P HELX_P6 AA6 ASP A 152 ? ALA A 158 ? ASP A 152 ALA A 158 1 ? 7 HELX_P HELX_P7 AA7 ALA A 158 ? ALA A 163 ? ALA A 158 ALA A 163 1 ? 6 HELX_P HELX_P8 AA8 GLY A 174 ? LEU A 182 ? GLY A 174 LEU A 182 1 ? 9 HELX_P HELX_P9 AA9 ASP A 190 ? HIS A 207 ? ASP A 190 HIS A 207 1 ? 18 HELX_P HELX_P10 AB1 GLU A 219 ? GLN A 227 ? GLU A 219 GLN A 227 1 ? 9 HELX_P HELX_P11 AB2 ASP A 237 ? GLY A 256 ? ASP A 237 GLY A 256 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 113 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 113 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 114 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 114 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.02 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 17 ? ASN A 22 ? VAL A 17 ASN A 22 AA1 2 PHE A 40 ? ASP A 44 ? PHE A 40 ASP A 44 AA1 3 ILE A 68 ? ARG A 72 ? ILE A 68 ARG A 72 AA1 4 GLY A 91 ? VAL A 94 ? GLY A 91 VAL A 94 AA1 5 MET A 145 ? ILE A 150 ? MET A 145 ILE A 150 AA1 6 MET A 170 ? GLU A 173 ? MET A 170 GLU A 173 AA1 7 HIS A 210 ? ALA A 213 ? HIS A 210 ALA A 213 AA1 8 THR A 231 ? ASP A 236 ? THR A 231 ASP A 236 AA1 9 VAL A 17 ? ASN A 22 ? VAL A 17 ASN A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 20 ? N ILE A 20 O VAL A 42 ? O VAL A 42 AA1 2 3 N ILE A 43 ? N ILE A 43 O ILE A 70 ? O ILE A 70 AA1 3 4 N VAL A 71 ? N VAL A 71 O GLY A 91 ? O GLY A 91 AA1 4 5 N ILE A 92 ? N ILE A 92 O MET A 145 ? O MET A 145 AA1 5 6 N ALA A 148 ? N ALA A 148 O VAL A 172 ? O VAL A 172 AA1 6 7 N GLU A 173 ? N GLU A 173 O CYS A 212 ? O CYS A 212 AA1 7 8 N ALA A 213 ? N ALA A 213 O ILE A 233 ? O ILE A 233 AA1 8 9 O PHE A 232 ? O PHE A 232 N GLY A 19 ? N GLY A 19 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id OAA _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue OAA A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 GLU A 46 ? GLU A 46 . ? 1_555 ? 2 AC1 9 HIS A 47 ? HIS A 47 . ? 1_555 ? 3 AC1 9 ARG A 72 ? ARG A 72 . ? 1_555 ? 4 AC1 9 PRO A 95 ? PRO A 95 . ? 1_555 ? 5 AC1 9 HIS A 96 ? HIS A 96 . ? 1_555 ? 6 AC1 9 TYR A 113 ? TYR A 113 . ? 2_555 ? 7 AC1 9 SER A 119 ? SER A 119 . ? 2_555 ? 8 AC1 9 GLN A 151 ? GLN A 151 . ? 1_555 ? 9 AC1 9 ASP A 177 ? ASP A 177 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NE _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 100 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 161 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 49 ? ? -67.19 99.51 2 1 VAL A 73 ? ? -93.01 -144.67 3 1 ALA A 163 ? ? -81.65 30.54 4 1 LEU A 214 ? ? -115.95 79.28 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 404 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -15.0964 -22.0020 11.4927 0.3173 0.3065 0.5262 0.0152 -0.0040 0.0853 0.7665 4.6965 5.5444 -0.7311 -0.6397 -1.0049 -0.2439 0.2256 0.0333 0.3013 0.0657 0.7627 0.1744 0.3414 -0.7705 'X-RAY DIFFRACTION' 2 ? refined -8.8910 -12.3242 8.3895 0.1976 0.2204 0.2711 0.0191 -0.0003 0.0479 2.2931 5.7566 4.5606 -0.2267 -1.9270 0.3128 -0.0218 0.1538 -0.1019 -0.1984 -0.1096 0.1359 0.1981 0.0836 0.2202 'X-RAY DIFFRACTION' 3 ? refined -10.6157 -11.5530 26.1636 0.6583 0.6024 0.4325 0.1032 0.1014 -0.0318 6.5079 6.3078 5.1513 -0.9510 -1.7057 0.3128 -0.0552 0.5364 -0.4074 -1.6263 0.5597 0.2782 1.6068 -0.1650 0.0441 'X-RAY DIFFRACTION' 4 ? refined -20.7996 -2.9088 22.7621 0.7681 1.0337 0.8329 0.2452 0.1622 0.1157 2.0830 6.7731 1.7727 0.0185 -0.5219 -0.0726 0.0823 -0.1561 0.1687 0.2632 0.4304 2.2179 0.6942 -0.1605 -1.3855 'X-RAY DIFFRACTION' 5 ? refined -5.9932 -20.1288 28.1666 0.7463 0.8039 0.2914 0.1975 -0.0666 0.0206 1.3734 4.6247 5.2148 -0.4194 -0.0441 -3.1700 -0.6831 0.5789 0.0899 -0.4117 -0.2637 -0.2981 1.1914 -0.2016 1.2778 'X-RAY DIFFRACTION' 6 ? refined -13.5833 -20.0330 29.1581 0.7942 0.8750 0.2053 0.3368 0.4310 0.4247 2.0401 2.3828 4.2273 0.7453 -0.8140 -1.5607 -0.1849 0.4551 -0.5691 -0.7788 0.1328 0.8971 0.9743 -0.2408 0.0463 'X-RAY DIFFRACTION' 7 ? refined 5.5718 -29.1746 24.2809 0.8393 0.9043 0.5756 0.3146 -0.1688 -0.1491 7.2317 7.6108 2.1646 -5.8722 0.8082 0.0236 1.3350 -0.1571 -1.2398 0.5377 -0.1051 -0.8183 -0.8317 1.9804 0.3873 'X-RAY DIFFRACTION' 8 ? refined -9.8320 -31.0922 22.6368 0.8357 0.5717 0.4619 0.0970 0.1122 0.1939 2.0723 4.6471 7.6457 0.5397 0.5034 0.8833 -0.3582 0.7791 -0.3644 -0.7172 -0.4778 0.5026 1.1949 1.5040 0.5200 'X-RAY DIFFRACTION' 9 ? refined 7.2425 -31.0615 -1.1544 0.3764 0.2196 0.5455 0.1183 0.0557 -0.0241 2.0929 3.1991 3.2495 0.9890 1.3895 -1.8282 0.0788 -0.3507 0.2405 0.1160 -0.7382 -0.1715 -0.0479 0.3155 0.4083 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 6 A 26 ;chain 'A' and (resid 6 through 26 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 27 A 87 ;chain 'A' and (resid 27 through 87 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 88 A 109 ;chain 'A' and (resid 88 through 109 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 110 A 144 ;chain 'A' and (resid 110 through 144 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 145 A 158 ;chain 'A' and (resid 145 through 158 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 159 A 174 ;chain 'A' and (resid 159 through 174 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 175 A 190 ;chain 'A' and (resid 175 through 190 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 191 A 236 ;chain 'A' and (resid 191 through 236 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 237 A 257 ;chain 'A' and (resid 237 through 257 ) ; ? ? ? ? ? # _pdbx_phasing_MR.entry_id 4TV6 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor 44.210 _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.500 _pdbx_phasing_MR.d_res_low_rotation 18.240 _pdbx_phasing_MR.d_res_high_translation 2.500 _pdbx_phasing_MR.d_res_low_translation 18.240 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A MET 2 ? A MET 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A ALA 75 ? A ALA 75 7 1 Y 1 A VAL 76 ? A VAL 76 8 1 Y 1 A ILE 77 ? A ILE 77 9 1 Y 1 A ASP 78 ? A ASP 78 10 1 Y 1 A ARG 79 ? A ARG 79 11 1 Y 1 A ASN 121 ? A ASN 121 12 1 Y 1 A GLY 122 ? A GLY 122 13 1 Y 1 A GLY 123 ? A GLY 123 14 1 Y 1 A ARG 124 ? A ARG 124 15 1 Y 1 A MET 125 ? A MET 125 16 1 Y 1 A ALA 126 ? A ALA 126 17 1 Y 1 A ARG 127 ? A ARG 127 18 1 Y 1 A PHE 128 ? A PHE 128 19 1 Y 1 A GLY 129 ? A GLY 129 20 1 Y 1 A ARG 130 ? A ARG 130 21 1 Y 1 A THR 131 ? A THR 131 22 1 Y 1 A PRO 132 ? A PRO 132 23 1 Y 1 A LEU 133 ? A LEU 133 24 1 Y 1 A LEU 134 ? A LEU 134 25 1 Y 1 A ASP 135 ? A ASP 135 26 1 Y 1 A ALA 136 ? A ALA 136 27 1 Y 1 A MET 137 ? A MET 137 28 1 Y 1 A GLU 138 ? A GLU 138 29 1 Y 1 A MET 139 ? A MET 139 30 1 Y 1 A ALA 140 ? A ALA 140 31 1 Y 1 A ASN 141 ? A ASN 141 32 1 Y 1 A GLU 142 ? A GLU 142 33 1 Y 1 A GLU 258 ? A GLU 258 34 1 Y 1 A GLY 259 ? A GLY 259 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 OAA O1 O N N 250 OAA O2 O N N 251 OAA O4 O N N 252 OAA O5 O N N 253 OAA O3 O N N 254 OAA C1 C N N 255 OAA C2 C N N 256 OAA C3 C N N 257 OAA C4 C N N 258 OAA HO5 H N N 259 OAA H21 H N N 260 OAA H22 H N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TRP N N N N 333 TRP CA C N S 334 TRP C C N N 335 TRP O O N N 336 TRP CB C N N 337 TRP CG C Y N 338 TRP CD1 C Y N 339 TRP CD2 C Y N 340 TRP NE1 N Y N 341 TRP CE2 C Y N 342 TRP CE3 C Y N 343 TRP CZ2 C Y N 344 TRP CZ3 C Y N 345 TRP CH2 C Y N 346 TRP OXT O N N 347 TRP H H N N 348 TRP H2 H N N 349 TRP HA H N N 350 TRP HB2 H N N 351 TRP HB3 H N N 352 TRP HD1 H N N 353 TRP HE1 H N N 354 TRP HE3 H N N 355 TRP HZ2 H N N 356 TRP HZ3 H N N 357 TRP HH2 H N N 358 TRP HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 OAA O1 C1 doub N N 237 OAA O2 C1 sing N N 238 OAA O4 C4 doub N N 239 OAA O5 C4 sing N N 240 OAA O5 HO5 sing N N 241 OAA O3 C3 doub N N 242 OAA C1 C2 sing N N 243 OAA C2 C3 sing N N 244 OAA C2 H21 sing N N 245 OAA C2 H22 sing N N 246 OAA C3 C4 sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TRP N CA sing N N 317 TRP N H sing N N 318 TRP N H2 sing N N 319 TRP CA C sing N N 320 TRP CA CB sing N N 321 TRP CA HA sing N N 322 TRP C O doub N N 323 TRP C OXT sing N N 324 TRP CB CG sing N N 325 TRP CB HB2 sing N N 326 TRP CB HB3 sing N N 327 TRP CG CD1 doub Y N 328 TRP CG CD2 sing Y N 329 TRP CD1 NE1 sing Y N 330 TRP CD1 HD1 sing N N 331 TRP CD2 CE2 doub Y N 332 TRP CD2 CE3 sing Y N 333 TRP NE1 CE2 sing Y N 334 TRP NE1 HE1 sing N N 335 TRP CE2 CZ2 sing Y N 336 TRP CE3 CZ3 doub Y N 337 TRP CE3 HE3 sing N N 338 TRP CZ2 CH2 doub Y N 339 TRP CZ2 HZ2 sing N N 340 TRP CZ3 CH2 sing Y N 341 TRP CZ3 HZ3 sing N N 342 TRP CH2 HH2 sing N N 343 TRP OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 # _atom_sites.entry_id 4TV6 _atom_sites.fract_transf_matrix[1][1] 0.012947 _atom_sites.fract_transf_matrix[1][2] 0.007475 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014950 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013191 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_