data_4TYE # _entry.id 4TYE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4TYE WWPDB D_1000202510 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'FGFR4 - Apo-2-structure' 4TYG unspecified PDB 'FGFR4 - Dovitinib-structure' 4TYI unspecified PDB 'FGFR4 - Ponatinib-structure' 4TYJ unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TYE _pdbx_database_status.recvd_initial_deposition_date 2014-07-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lesca, E.' 1 'Lammens, A.' 2 'Huber, R.' 3 'Augustin, M.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 426 _citation.language ? _citation.page_first 3744 _citation.page_last 3756 _citation.title 'Structural analysis of the human fibroblast growth factor receptor 4 kinase.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2014.09.004 _citation.pdbx_database_id_PubMed 25219510 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lesca, E.' 1 primary 'Lammens, A.' 2 primary 'Huber, R.' 3 primary 'Augustin, M.' 4 # _cell.entry_id 4TYE _cell.length_a 61.948 _cell.length_b 61.948 _cell.length_c 184.930 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TYE _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fibroblast growth factor receptor 4' 34689.059 1 2.7.10.1 ? 'UNP residues 447-753' ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 2 ? ? ? ? 3 water nat water 18.015 25 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name FGFR-4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AMGSAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEME VMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQY LESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEI FTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE ; _entity_poly.pdbx_seq_one_letter_code_can ;AMGSAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEME VMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQY LESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEI FTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 GLY n 1 4 SER n 1 5 ALA n 1 6 GLY n 1 7 LEU n 1 8 VAL n 1 9 SER n 1 10 LEU n 1 11 ASP n 1 12 LEU n 1 13 PRO n 1 14 LEU n 1 15 ASP n 1 16 PRO n 1 17 LEU n 1 18 TRP n 1 19 GLU n 1 20 PHE n 1 21 PRO n 1 22 ARG n 1 23 ASP n 1 24 ARG n 1 25 LEU n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 LYS n 1 30 PRO n 1 31 LEU n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 CYS n 1 36 PHE n 1 37 GLY n 1 38 GLN n 1 39 VAL n 1 40 VAL n 1 41 ARG n 1 42 ALA n 1 43 GLU n 1 44 ALA n 1 45 PHE n 1 46 GLY n 1 47 MET n 1 48 ASP n 1 49 PRO n 1 50 ALA n 1 51 ARG n 1 52 PRO n 1 53 ASP n 1 54 GLN n 1 55 ALA n 1 56 SER n 1 57 THR n 1 58 VAL n 1 59 ALA n 1 60 VAL n 1 61 LYS n 1 62 MET n 1 63 LEU n 1 64 LYS n 1 65 ASP n 1 66 ASN n 1 67 ALA n 1 68 SER n 1 69 ASP n 1 70 LYS n 1 71 ASP n 1 72 LEU n 1 73 ALA n 1 74 ASP n 1 75 LEU n 1 76 VAL n 1 77 SER n 1 78 GLU n 1 79 MET n 1 80 GLU n 1 81 VAL n 1 82 MET n 1 83 LYS n 1 84 LEU n 1 85 ILE n 1 86 GLY n 1 87 ARG n 1 88 HIS n 1 89 LYS n 1 90 ASN n 1 91 ILE n 1 92 ILE n 1 93 ASN n 1 94 LEU n 1 95 LEU n 1 96 GLY n 1 97 VAL n 1 98 CYS n 1 99 THR n 1 100 GLN n 1 101 GLU n 1 102 GLY n 1 103 PRO n 1 104 LEU n 1 105 TYR n 1 106 VAL n 1 107 ILE n 1 108 VAL n 1 109 GLU n 1 110 CYS n 1 111 ALA n 1 112 ALA n 1 113 LYS n 1 114 GLY n 1 115 ASN n 1 116 LEU n 1 117 ARG n 1 118 GLU n 1 119 PHE n 1 120 LEU n 1 121 ARG n 1 122 ALA n 1 123 ARG n 1 124 ARG n 1 125 PRO n 1 126 PRO n 1 127 GLY n 1 128 PRO n 1 129 ASP n 1 130 LEU n 1 131 SER n 1 132 PRO n 1 133 ASP n 1 134 GLY n 1 135 PRO n 1 136 ARG n 1 137 SER n 1 138 SER n 1 139 GLU n 1 140 GLY n 1 141 PRO n 1 142 LEU n 1 143 SER n 1 144 PHE n 1 145 PRO n 1 146 VAL n 1 147 LEU n 1 148 VAL n 1 149 SER n 1 150 CYS n 1 151 ALA n 1 152 TYR n 1 153 GLN n 1 154 VAL n 1 155 ALA n 1 156 ARG n 1 157 GLY n 1 158 MET n 1 159 GLN n 1 160 TYR n 1 161 LEU n 1 162 GLU n 1 163 SER n 1 164 ARG n 1 165 LYS n 1 166 CYS n 1 167 ILE n 1 168 HIS n 1 169 ARG n 1 170 ASP n 1 171 LEU n 1 172 ALA n 1 173 ALA n 1 174 ARG n 1 175 ASN n 1 176 VAL n 1 177 LEU n 1 178 VAL n 1 179 THR n 1 180 GLU n 1 181 ASP n 1 182 ASN n 1 183 VAL n 1 184 MET n 1 185 LYS n 1 186 ILE n 1 187 ALA n 1 188 ASP n 1 189 PHE n 1 190 GLY n 1 191 LEU n 1 192 ALA n 1 193 ARG n 1 194 GLY n 1 195 VAL n 1 196 HIS n 1 197 HIS n 1 198 ILE n 1 199 ASP n 1 200 TYR n 1 201 TYR n 1 202 LYS n 1 203 LYS n 1 204 THR n 1 205 SER n 1 206 ASN n 1 207 GLY n 1 208 ARG n 1 209 LEU n 1 210 PRO n 1 211 VAL n 1 212 LYS n 1 213 TRP n 1 214 MET n 1 215 ALA n 1 216 PRO n 1 217 GLU n 1 218 ALA n 1 219 LEU n 1 220 PHE n 1 221 ASP n 1 222 ARG n 1 223 VAL n 1 224 TYR n 1 225 THR n 1 226 HIS n 1 227 GLN n 1 228 SER n 1 229 ASP n 1 230 VAL n 1 231 TRP n 1 232 SER n 1 233 PHE n 1 234 GLY n 1 235 ILE n 1 236 LEU n 1 237 LEU n 1 238 TRP n 1 239 GLU n 1 240 ILE n 1 241 PHE n 1 242 THR n 1 243 LEU n 1 244 GLY n 1 245 GLY n 1 246 SER n 1 247 PRO n 1 248 TYR n 1 249 PRO n 1 250 GLY n 1 251 ILE n 1 252 PRO n 1 253 VAL n 1 254 GLU n 1 255 GLU n 1 256 LEU n 1 257 PHE n 1 258 SER n 1 259 LEU n 1 260 LEU n 1 261 ARG n 1 262 GLU n 1 263 GLY n 1 264 HIS n 1 265 ARG n 1 266 MET n 1 267 ASP n 1 268 ARG n 1 269 PRO n 1 270 PRO n 1 271 HIS n 1 272 CYS n 1 273 PRO n 1 274 PRO n 1 275 GLU n 1 276 LEU n 1 277 TYR n 1 278 GLY n 1 279 LEU n 1 280 MET n 1 281 ARG n 1 282 GLU n 1 283 CYS n 1 284 TRP n 1 285 HIS n 1 286 ALA n 1 287 ALA n 1 288 PRO n 1 289 SER n 1 290 GLN n 1 291 ARG n 1 292 PRO n 1 293 THR n 1 294 PHE n 1 295 LYS n 1 296 GLN n 1 297 LEU n 1 298 VAL n 1 299 GLU n 1 300 ALA n 1 301 LEU n 1 302 ASP n 1 303 LYS n 1 304 VAL n 1 305 LEU n 1 306 LEU n 1 307 ALA n 1 308 VAL n 1 309 SER n 1 310 GLU n 1 311 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FGFR4, JTK2, TKF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pFastBac HTB' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code FGFR4_HUMAN _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession P22455 _struct_ref.pdbx_seq_one_letter_code ;AGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKL IGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESR KCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLG GSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE ; _struct_ref.pdbx_align_begin 447 _struct_ref.pdbx_align_end ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TYE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 311 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22455 _struct_ref_seq.db_align_beg 447 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 753 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 447 _struct_ref_seq.pdbx_auth_seq_align_end 753 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TYE ALA A 1 ? UNP P22455 ? ? 'expression tag' 443 1 1 4TYE MET A 2 ? UNP P22455 ? ? 'expression tag' 444 2 1 4TYE GLY A 3 ? UNP P22455 ? ? 'expression tag' 445 3 1 4TYE SER A 4 ? UNP P22455 ? ? 'expression tag' 446 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TYE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.6 M NaH2PO4, 0.6 M KH2PO4, 0.075 M NaHEPES pH 7.5, 24% Glycerol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-11-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99998 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99998 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4TYE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.80 _reflns.d_resolution_low 58.74 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9467 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0.0 _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_Rmerge_I_obs 0.1270 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 3.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.8540 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.37 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 1.37 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -2.74 _refine.B_iso_max ? _refine.B_iso_mean 60.159 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.930 _refine.correlation_coeff_Fo_to_Fc_free 0.898 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TYE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.80 _refine.ls_d_res_low 58.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8742 _refine.ls_number_reflns_R_free 725 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.61 _refine.ls_percent_reflns_R_free 7.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22682 _refine.ls_R_factor_R_free 0.27766 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22269 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'generated using Swissmodel' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.406 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 35.647 _refine.overall_SU_ML 0.326 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2302 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 2337 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 58.74 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.019 2282 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1605 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.272 1.982 3107 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.981 3.000 3851 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.761 5.000 289 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.806 22.857 91 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.773 15.000 352 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.578 15.000 17 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.062 0.200 342 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 2536 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 461 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.802 _refine_ls_shell.d_res_low 2.874 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 521 _refine_ls_shell.percent_reflns_obs 99.64 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.388 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.315 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? # _struct.entry_id 4TYE _struct.title 'Structural analysis of the human Fibroblast Growth Factor Receptor 4 Kinase' _struct.pdbx_descriptor >#TARGETLONGNAME#< _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TYE _struct_keywords.text 'Fibroblast growth factor receptor, Kinase, Transferase, Dovitinib, Ponatinb, Proteros Biostructures GmbH' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 68 ? GLY A 86 ? SER A 510 GLY A 528 1 ? 19 HELX_P HELX_P2 AA2 ASN A 115 ? ARG A 123 ? ASN A 557 ARG A 565 1 ? 9 HELX_P HELX_P3 AA3 SER A 143 ? ARG A 164 ? SER A 585 ARG A 606 1 ? 22 HELX_P HELX_P4 AA4 ALA A 215 ? PHE A 220 ? ALA A 657 PHE A 662 1 ? 6 HELX_P HELX_P5 AA5 THR A 225 ? THR A 242 ? THR A 667 THR A 684 1 ? 18 HELX_P HELX_P6 AA6 GLU A 255 ? GLY A 263 ? GLU A 697 GLY A 705 1 ? 9 HELX_P HELX_P7 AA7 PRO A 273 ? TRP A 284 ? PRO A 715 TRP A 726 1 ? 12 HELX_P HELX_P8 AA8 THR A 293 ? GLU A 310 ? THR A 735 GLU A 752 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 25 ? GLU A 33 ? LEU A 467 GLU A 475 AA1 2 GLY A 37 ? PHE A 45 ? GLY A 479 PHE A 487 AA1 3 ALA A 55 ? LEU A 63 ? ALA A 497 LEU A 505 AA1 4 TYR A 105 ? VAL A 108 ? TYR A 547 VAL A 550 AA1 5 LEU A 94 ? CYS A 98 ? LEU A 536 CYS A 540 AA2 1 VAL A 176 ? VAL A 178 ? VAL A 618 VAL A 620 AA2 2 MET A 184 ? ILE A 186 ? MET A 626 ILE A 628 AA3 1 LEU A 191 ? ALA A 192 ? LEU A 633 ALA A 634 AA3 2 VAL A 195 ? HIS A 196 ? VAL A 637 HIS A 638 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 26 ? N VAL A 468 O GLU A 43 ? O GLU A 485 AA1 2 3 N ALA A 44 ? N ALA A 486 O SER A 56 ? O SER A 498 AA1 3 4 N ALA A 59 ? N ALA A 501 O VAL A 108 ? O VAL A 550 AA1 4 5 O ILE A 107 ? O ILE A 549 N LEU A 95 ? N LEU A 537 AA2 1 2 N LEU A 177 ? N LEU A 619 O LYS A 185 ? O LYS A 627 AA3 1 2 N ALA A 192 ? N ALA A 634 O VAL A 195 ? O VAL A 637 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PO4 801 ? 8 'binding site for residue PO4 A 801' AC2 Software A PO4 802 ? 5 'binding site for residue PO4 A 802' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 GLU A 19 ? GLU A 461 . ? 1_555 ? 2 AC1 8 PHE A 20 ? PHE A 462 . ? 1_555 ? 3 AC1 8 PRO A 21 ? PRO A 463 . ? 1_555 ? 4 AC1 8 ARG A 22 ? ARG A 464 . ? 1_555 ? 5 AC1 8 CYS A 98 ? CYS A 540 . ? 1_555 ? 6 AC1 8 GLN A 100 ? GLN A 542 . ? 1_555 ? 7 AC1 8 GLU A 101 ? GLU A 543 . ? 1_555 ? 8 AC1 8 ASP A 221 ? ASP A 663 . ? 4_455 ? 9 AC2 5 ARG A 265 ? ARG A 707 . ? 1_555 ? 10 AC2 5 ARG A 281 ? ARG A 723 . ? 1_555 ? 11 AC2 5 TRP A 284 ? TRP A 726 . ? 1_555 ? 12 AC2 5 HIS A 285 ? HIS A 727 . ? 1_555 ? 13 AC2 5 HOH D . ? HOH A 919 . ? 1_555 ? # _atom_sites.entry_id 4TYE _atom_sites.fract_transf_matrix[1][1] 0.016143 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016143 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005407 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 443 ? ? ? A . n A 1 2 MET 2 444 ? ? ? A . n A 1 3 GLY 3 445 ? ? ? A . n A 1 4 SER 4 446 ? ? ? A . n A 1 5 ALA 5 447 ? ? ? A . n A 1 6 GLY 6 448 ? ? ? A . n A 1 7 LEU 7 449 ? ? ? A . n A 1 8 VAL 8 450 ? ? ? A . n A 1 9 SER 9 451 451 SER SER A . n A 1 10 LEU 10 452 452 LEU LEU A . n A 1 11 ASP 11 453 453 ASP ASP A . n A 1 12 LEU 12 454 454 LEU LEU A . n A 1 13 PRO 13 455 455 PRO PRO A . n A 1 14 LEU 14 456 456 LEU LEU A . n A 1 15 ASP 15 457 457 ASP ASP A . n A 1 16 PRO 16 458 458 PRO PRO A . n A 1 17 LEU 17 459 459 LEU LEU A . n A 1 18 TRP 18 460 460 TRP TRP A . n A 1 19 GLU 19 461 461 GLU GLU A . n A 1 20 PHE 20 462 462 PHE PHE A . n A 1 21 PRO 21 463 463 PRO PRO A . n A 1 22 ARG 22 464 464 ARG ARG A . n A 1 23 ASP 23 465 465 ASP ASP A . n A 1 24 ARG 24 466 466 ARG ARG A . n A 1 25 LEU 25 467 467 LEU LEU A . n A 1 26 VAL 26 468 468 VAL VAL A . n A 1 27 LEU 27 469 469 LEU LEU A . n A 1 28 GLY 28 470 470 GLY GLY A . n A 1 29 LYS 29 471 471 LYS LYS A . n A 1 30 PRO 30 472 472 PRO PRO A . n A 1 31 LEU 31 473 473 LEU LEU A . n A 1 32 GLY 32 474 474 GLY GLY A . n A 1 33 GLU 33 475 475 GLU GLU A . n A 1 34 GLY 34 476 476 GLY GLY A . n A 1 35 CYS 35 477 477 CYS CYS A . n A 1 36 PHE 36 478 478 PHE PHE A . n A 1 37 GLY 37 479 479 GLY GLY A . n A 1 38 GLN 38 480 480 GLN GLN A . n A 1 39 VAL 39 481 481 VAL VAL A . n A 1 40 VAL 40 482 482 VAL VAL A . n A 1 41 ARG 41 483 483 ARG ARG A . n A 1 42 ALA 42 484 484 ALA ALA A . n A 1 43 GLU 43 485 485 GLU GLU A . n A 1 44 ALA 44 486 486 ALA ALA A . n A 1 45 PHE 45 487 487 PHE PHE A . n A 1 46 GLY 46 488 488 GLY GLY A . n A 1 47 MET 47 489 489 MET MET A . n A 1 48 ASP 48 490 490 ASP ASP A . n A 1 49 PRO 49 491 491 PRO PRO A . n A 1 50 ALA 50 492 492 ALA ALA A . n A 1 51 ARG 51 493 493 ARG ARG A . n A 1 52 PRO 52 494 494 PRO PRO A . n A 1 53 ASP 53 495 495 ASP ASP A . n A 1 54 GLN 54 496 496 GLN GLN A . n A 1 55 ALA 55 497 497 ALA ALA A . n A 1 56 SER 56 498 498 SER SER A . n A 1 57 THR 57 499 499 THR THR A . n A 1 58 VAL 58 500 500 VAL VAL A . n A 1 59 ALA 59 501 501 ALA ALA A . n A 1 60 VAL 60 502 502 VAL VAL A . n A 1 61 LYS 61 503 503 LYS LYS A . n A 1 62 MET 62 504 504 MET MET A . n A 1 63 LEU 63 505 505 LEU LEU A . n A 1 64 LYS 64 506 506 LYS LYS A . n A 1 65 ASP 65 507 507 ASP ASP A . n A 1 66 ASN 66 508 508 ASN ASN A . n A 1 67 ALA 67 509 509 ALA ALA A . n A 1 68 SER 68 510 510 SER SER A . n A 1 69 ASP 69 511 511 ASP ASP A . n A 1 70 LYS 70 512 512 LYS LYS A . n A 1 71 ASP 71 513 513 ASP ASP A . n A 1 72 LEU 72 514 514 LEU LEU A . n A 1 73 ALA 73 515 515 ALA ALA A . n A 1 74 ASP 74 516 516 ASP ASP A . n A 1 75 LEU 75 517 517 LEU LEU A . n A 1 76 VAL 76 518 518 VAL VAL A . n A 1 77 SER 77 519 519 SER SER A . n A 1 78 GLU 78 520 520 GLU GLU A . n A 1 79 MET 79 521 521 MET MET A . n A 1 80 GLU 80 522 522 GLU GLU A . n A 1 81 VAL 81 523 523 VAL VAL A . n A 1 82 MET 82 524 524 MET MET A . n A 1 83 LYS 83 525 525 LYS LYS A . n A 1 84 LEU 84 526 526 LEU LEU A . n A 1 85 ILE 85 527 527 ILE ILE A . n A 1 86 GLY 86 528 528 GLY GLY A . n A 1 87 ARG 87 529 529 ARG ARG A . n A 1 88 HIS 88 530 530 HIS HIS A . n A 1 89 LYS 89 531 531 LYS LYS A . n A 1 90 ASN 90 532 532 ASN ASN A . n A 1 91 ILE 91 533 533 ILE ILE A . n A 1 92 ILE 92 534 534 ILE ILE A . n A 1 93 ASN 93 535 535 ASN ASN A . n A 1 94 LEU 94 536 536 LEU LEU A . n A 1 95 LEU 95 537 537 LEU LEU A . n A 1 96 GLY 96 538 538 GLY GLY A . n A 1 97 VAL 97 539 539 VAL VAL A . n A 1 98 CYS 98 540 540 CYS CYS A . n A 1 99 THR 99 541 541 THR THR A . n A 1 100 GLN 100 542 542 GLN GLN A . n A 1 101 GLU 101 543 543 GLU GLU A . n A 1 102 GLY 102 544 544 GLY GLY A . n A 1 103 PRO 103 545 545 PRO PRO A . n A 1 104 LEU 104 546 546 LEU LEU A . n A 1 105 TYR 105 547 547 TYR TYR A . n A 1 106 VAL 106 548 548 VAL VAL A . n A 1 107 ILE 107 549 549 ILE ILE A . n A 1 108 VAL 108 550 550 VAL VAL A . n A 1 109 GLU 109 551 551 GLU GLU A . n A 1 110 CYS 110 552 552 CYS CYS A . n A 1 111 ALA 111 553 553 ALA ALA A . n A 1 112 ALA 112 554 554 ALA ALA A . n A 1 113 LYS 113 555 555 LYS LYS A . n A 1 114 GLY 114 556 556 GLY GLY A . n A 1 115 ASN 115 557 557 ASN ASN A . n A 1 116 LEU 116 558 558 LEU LEU A . n A 1 117 ARG 117 559 559 ARG ARG A . n A 1 118 GLU 118 560 560 GLU GLU A . n A 1 119 PHE 119 561 561 PHE PHE A . n A 1 120 LEU 120 562 562 LEU LEU A . n A 1 121 ARG 121 563 563 ARG ARG A . n A 1 122 ALA 122 564 564 ALA ALA A . n A 1 123 ARG 123 565 565 ARG ARG A . n A 1 124 ARG 124 566 566 ARG ARG A . n A 1 125 PRO 125 567 567 PRO PRO A . n A 1 126 PRO 126 568 568 PRO PRO A . n A 1 127 GLY 127 569 569 GLY GLY A . n A 1 128 PRO 128 570 570 PRO PRO A . n A 1 129 ASP 129 571 571 ASP ASP A . n A 1 130 LEU 130 572 572 LEU LEU A . n A 1 131 SER 131 573 573 SER SER A . n A 1 132 PRO 132 574 574 PRO PRO A . n A 1 133 ASP 133 575 575 ASP ASP A . n A 1 134 GLY 134 576 576 GLY GLY A . n A 1 135 PRO 135 577 ? ? ? A . n A 1 136 ARG 136 578 ? ? ? A . n A 1 137 SER 137 579 ? ? ? A . n A 1 138 SER 138 580 ? ? ? A . n A 1 139 GLU 139 581 581 GLU GLU A . n A 1 140 GLY 140 582 582 GLY GLY A . n A 1 141 PRO 141 583 583 PRO PRO A . n A 1 142 LEU 142 584 584 LEU LEU A . n A 1 143 SER 143 585 585 SER SER A . n A 1 144 PHE 144 586 586 PHE PHE A . n A 1 145 PRO 145 587 587 PRO PRO A . n A 1 146 VAL 146 588 588 VAL VAL A . n A 1 147 LEU 147 589 589 LEU LEU A . n A 1 148 VAL 148 590 590 VAL VAL A . n A 1 149 SER 149 591 591 SER SER A . n A 1 150 CYS 150 592 592 CYS CYS A . n A 1 151 ALA 151 593 593 ALA ALA A . n A 1 152 TYR 152 594 594 TYR TYR A . n A 1 153 GLN 153 595 595 GLN GLN A . n A 1 154 VAL 154 596 596 VAL VAL A . n A 1 155 ALA 155 597 597 ALA ALA A . n A 1 156 ARG 156 598 598 ARG ARG A . n A 1 157 GLY 157 599 599 GLY GLY A . n A 1 158 MET 158 600 600 MET MET A . n A 1 159 GLN 159 601 601 GLN GLN A . n A 1 160 TYR 160 602 602 TYR TYR A . n A 1 161 LEU 161 603 603 LEU LEU A . n A 1 162 GLU 162 604 604 GLU GLU A . n A 1 163 SER 163 605 605 SER SER A . n A 1 164 ARG 164 606 606 ARG ARG A . n A 1 165 LYS 165 607 607 LYS LYS A . n A 1 166 CYS 166 608 608 CYS CYS A . n A 1 167 ILE 167 609 609 ILE ILE A . n A 1 168 HIS 168 610 610 HIS HIS A . n A 1 169 ARG 169 611 611 ARG ARG A . n A 1 170 ASP 170 612 612 ASP ASP A . n A 1 171 LEU 171 613 613 LEU LEU A . n A 1 172 ALA 172 614 614 ALA ALA A . n A 1 173 ALA 173 615 615 ALA ALA A . n A 1 174 ARG 174 616 616 ARG ARG A . n A 1 175 ASN 175 617 617 ASN ASN A . n A 1 176 VAL 176 618 618 VAL VAL A . n A 1 177 LEU 177 619 619 LEU LEU A . n A 1 178 VAL 178 620 620 VAL VAL A . n A 1 179 THR 179 621 621 THR THR A . n A 1 180 GLU 180 622 622 GLU GLU A . n A 1 181 ASP 181 623 623 ASP ASP A . n A 1 182 ASN 182 624 624 ASN ASN A . n A 1 183 VAL 183 625 625 VAL VAL A . n A 1 184 MET 184 626 626 MET MET A . n A 1 185 LYS 185 627 627 LYS LYS A . n A 1 186 ILE 186 628 628 ILE ILE A . n A 1 187 ALA 187 629 629 ALA ALA A . n A 1 188 ASP 188 630 630 ASP ASP A . n A 1 189 PHE 189 631 631 PHE PHE A . n A 1 190 GLY 190 632 632 GLY GLY A . n A 1 191 LEU 191 633 633 LEU LEU A . n A 1 192 ALA 192 634 634 ALA ALA A . n A 1 193 ARG 193 635 635 ARG ARG A . n A 1 194 GLY 194 636 636 GLY GLY A . n A 1 195 VAL 195 637 637 VAL VAL A . n A 1 196 HIS 196 638 638 HIS HIS A . n A 1 197 HIS 197 639 639 HIS HIS A . n A 1 198 ILE 198 640 640 ILE ILE A . n A 1 199 ASP 199 641 641 ASP ASP A . n A 1 200 TYR 200 642 642 TYR TYR A . n A 1 201 TYR 201 643 643 TYR TYR A . n A 1 202 LYS 202 644 ? ? ? A . n A 1 203 LYS 203 645 ? ? ? A . n A 1 204 THR 204 646 ? ? ? A . n A 1 205 SER 205 647 ? ? ? A . n A 1 206 ASN 206 648 ? ? ? A . n A 1 207 GLY 207 649 ? ? ? A . n A 1 208 ARG 208 650 ? ? ? A . n A 1 209 LEU 209 651 651 LEU LEU A . n A 1 210 PRO 210 652 652 PRO PRO A . n A 1 211 VAL 211 653 653 VAL VAL A . n A 1 212 LYS 212 654 654 LYS LYS A . n A 1 213 TRP 213 655 655 TRP TRP A . n A 1 214 MET 214 656 656 MET MET A . n A 1 215 ALA 215 657 657 ALA ALA A . n A 1 216 PRO 216 658 658 PRO PRO A . n A 1 217 GLU 217 659 659 GLU GLU A . n A 1 218 ALA 218 660 660 ALA ALA A . n A 1 219 LEU 219 661 661 LEU LEU A . n A 1 220 PHE 220 662 662 PHE PHE A . n A 1 221 ASP 221 663 663 ASP ASP A . n A 1 222 ARG 222 664 664 ARG ARG A . n A 1 223 VAL 223 665 665 VAL VAL A . n A 1 224 TYR 224 666 666 TYR TYR A . n A 1 225 THR 225 667 667 THR THR A . n A 1 226 HIS 226 668 668 HIS HIS A . n A 1 227 GLN 227 669 669 GLN GLN A . n A 1 228 SER 228 670 670 SER SER A . n A 1 229 ASP 229 671 671 ASP ASP A . n A 1 230 VAL 230 672 672 VAL VAL A . n A 1 231 TRP 231 673 673 TRP TRP A . n A 1 232 SER 232 674 674 SER SER A . n A 1 233 PHE 233 675 675 PHE PHE A . n A 1 234 GLY 234 676 676 GLY GLY A . n A 1 235 ILE 235 677 677 ILE ILE A . n A 1 236 LEU 236 678 678 LEU LEU A . n A 1 237 LEU 237 679 679 LEU LEU A . n A 1 238 TRP 238 680 680 TRP TRP A . n A 1 239 GLU 239 681 681 GLU GLU A . n A 1 240 ILE 240 682 682 ILE ILE A . n A 1 241 PHE 241 683 683 PHE PHE A . n A 1 242 THR 242 684 684 THR THR A . n A 1 243 LEU 243 685 685 LEU LEU A . n A 1 244 GLY 244 686 686 GLY GLY A . n A 1 245 GLY 245 687 687 GLY GLY A . n A 1 246 SER 246 688 688 SER SER A . n A 1 247 PRO 247 689 689 PRO PRO A . n A 1 248 TYR 248 690 690 TYR TYR A . n A 1 249 PRO 249 691 691 PRO PRO A . n A 1 250 GLY 250 692 692 GLY GLY A . n A 1 251 ILE 251 693 693 ILE ILE A . n A 1 252 PRO 252 694 694 PRO PRO A . n A 1 253 VAL 253 695 695 VAL VAL A . n A 1 254 GLU 254 696 696 GLU GLU A . n A 1 255 GLU 255 697 697 GLU GLU A . n A 1 256 LEU 256 698 698 LEU LEU A . n A 1 257 PHE 257 699 699 PHE PHE A . n A 1 258 SER 258 700 700 SER SER A . n A 1 259 LEU 259 701 701 LEU LEU A . n A 1 260 LEU 260 702 702 LEU LEU A . n A 1 261 ARG 261 703 703 ARG ARG A . n A 1 262 GLU 262 704 704 GLU GLU A . n A 1 263 GLY 263 705 705 GLY GLY A . n A 1 264 HIS 264 706 706 HIS HIS A . n A 1 265 ARG 265 707 707 ARG ARG A . n A 1 266 MET 266 708 708 MET MET A . n A 1 267 ASP 267 709 709 ASP ASP A . n A 1 268 ARG 268 710 710 ARG ARG A . n A 1 269 PRO 269 711 711 PRO PRO A . n A 1 270 PRO 270 712 712 PRO PRO A . n A 1 271 HIS 271 713 713 HIS HIS A . n A 1 272 CYS 272 714 714 CYS CYS A . n A 1 273 PRO 273 715 715 PRO PRO A . n A 1 274 PRO 274 716 716 PRO PRO A . n A 1 275 GLU 275 717 717 GLU GLU A . n A 1 276 LEU 276 718 718 LEU LEU A . n A 1 277 TYR 277 719 719 TYR TYR A . n A 1 278 GLY 278 720 720 GLY GLY A . n A 1 279 LEU 279 721 721 LEU LEU A . n A 1 280 MET 280 722 722 MET MET A . n A 1 281 ARG 281 723 723 ARG ARG A . n A 1 282 GLU 282 724 724 GLU GLU A . n A 1 283 CYS 283 725 725 CYS CYS A . n A 1 284 TRP 284 726 726 TRP TRP A . n A 1 285 HIS 285 727 727 HIS HIS A . n A 1 286 ALA 286 728 728 ALA ALA A . n A 1 287 ALA 287 729 729 ALA ALA A . n A 1 288 PRO 288 730 730 PRO PRO A . n A 1 289 SER 289 731 731 SER SER A . n A 1 290 GLN 290 732 732 GLN GLN A . n A 1 291 ARG 291 733 733 ARG ARG A . n A 1 292 PRO 292 734 734 PRO PRO A . n A 1 293 THR 293 735 735 THR THR A . n A 1 294 PHE 294 736 736 PHE PHE A . n A 1 295 LYS 295 737 737 LYS LYS A . n A 1 296 GLN 296 738 738 GLN GLN A . n A 1 297 LEU 297 739 739 LEU LEU A . n A 1 298 VAL 298 740 740 VAL VAL A . n A 1 299 GLU 299 741 741 GLU GLU A . n A 1 300 ALA 300 742 742 ALA ALA A . n A 1 301 LEU 301 743 743 LEU LEU A . n A 1 302 ASP 302 744 744 ASP ASP A . n A 1 303 LYS 303 745 745 LYS LYS A . n A 1 304 VAL 304 746 746 VAL VAL A . n A 1 305 LEU 305 747 747 LEU LEU A . n A 1 306 LEU 306 748 748 LEU LEU A . n A 1 307 ALA 307 749 749 ALA ALA A . n A 1 308 VAL 308 750 750 VAL VAL A . n A 1 309 SER 309 751 751 SER SER A . n A 1 310 GLU 310 752 752 GLU GLU A . n A 1 311 GLU 311 753 753 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 801 1 PO4 PO4 A . C 2 PO4 1 802 2 PO4 PO4 A . D 3 HOH 1 901 18 HOH HOH A . D 3 HOH 2 902 1 HOH HOH A . D 3 HOH 3 903 7 HOH HOH A . D 3 HOH 4 904 2 HOH HOH A . D 3 HOH 5 905 3 HOH HOH A . D 3 HOH 6 906 4 HOH HOH A . D 3 HOH 7 907 5 HOH HOH A . D 3 HOH 8 908 6 HOH HOH A . D 3 HOH 9 909 8 HOH HOH A . D 3 HOH 10 910 9 HOH HOH A . D 3 HOH 11 911 10 HOH HOH A . D 3 HOH 12 912 11 HOH HOH A . D 3 HOH 13 913 12 HOH HOH A . D 3 HOH 14 914 13 HOH HOH A . D 3 HOH 15 915 14 HOH HOH A . D 3 HOH 16 916 15 HOH HOH A . D 3 HOH 17 917 16 HOH HOH A . D 3 HOH 18 918 17 HOH HOH A . D 3 HOH 19 919 19 HOH HOH A . D 3 HOH 20 920 20 HOH HOH A . D 3 HOH 21 921 21 HOH HOH A . D 3 HOH 22 922 22 HOH HOH A . D 3 HOH 23 923 23 HOH HOH A . D 3 HOH 24 924 24 HOH HOH A . D 3 HOH 25 925 25 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 420 ? 1 MORE -15 ? 1 'SSA (A^2)' 15360 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-09-24 2 'Structure model' 1 1 2014-12-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -2.6330 20.6700 16.1560 0.3342 ? -0.0828 ? -0.0111 ? 0.1428 ? 0.0084 ? 0.1528 ? 3.9408 ? -0.6847 ? 1.5670 ? 8.4902 ? -1.9767 ? 5.4260 ? 0.1980 ? -0.4344 ? -0.5288 ? 0.5651 ? -0.0973 ? -0.3502 ? 0.5699 ? 0.1480 ? -0.1006 ? 2 'X-RAY DIFFRACTION' ? refined -13.0780 25.6770 -9.3020 0.1182 ? 0.0172 ? -0.0222 ? 0.1015 ? -0.0636 ? 0.1159 ? 2.7238 ? 0.8548 ? -0.5534 ? 2.2813 ? -0.5122 ? 4.1982 ? 0.1680 ? 0.2392 ? -0.2905 ? -0.0217 ? -0.0525 ? -0.1545 ? 0.2625 ? 0.2385 ? -0.1154 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 451 ? ? A 552 ? ? 2 'X-RAY DIFFRACTION' 2 ? ? A 553 ? ? A 753 ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.6.0117 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 471 ? ? 39.43 67.12 2 1 PHE A 478 ? ? 57.99 15.30 3 1 ARG A 493 ? ? -118.91 74.26 4 1 ASN A 508 ? ? -69.22 73.64 5 1 GLU A 543 ? ? -87.56 45.96 6 1 LEU A 584 ? ? -109.69 62.46 7 1 TYR A 642 ? ? -107.34 54.69 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LEU 452 ? CD1 ? A LEU 10 CD1 2 1 Y 0 A LEU 452 ? CD2 ? A LEU 10 CD2 3 1 Y 0 A LEU 454 ? CD1 ? A LEU 12 CD1 4 1 Y 0 A LEU 454 ? CD2 ? A LEU 12 CD2 5 1 Y 0 A ASP 465 ? CG ? A ASP 23 CG 6 1 Y 0 A ASP 465 ? OD1 ? A ASP 23 OD1 7 1 Y 0 A ASP 465 ? OD2 ? A ASP 23 OD2 8 1 Y 0 A LYS 471 ? CE ? A LYS 29 CE 9 1 Y 0 A LYS 471 ? NZ ? A LYS 29 NZ 10 1 Y 0 A PHE 478 ? CG ? A PHE 36 CG 11 1 Y 0 A PHE 478 ? CD1 ? A PHE 36 CD1 12 1 Y 0 A PHE 478 ? CD2 ? A PHE 36 CD2 13 1 Y 0 A PHE 478 ? CE1 ? A PHE 36 CE1 14 1 Y 0 A PHE 478 ? CE2 ? A PHE 36 CE2 15 1 Y 0 A PHE 478 ? CZ ? A PHE 36 CZ 16 1 Y 0 A ARG 483 ? CZ ? A ARG 41 CZ 17 1 Y 0 A ARG 483 ? NH1 ? A ARG 41 NH1 18 1 Y 0 A ARG 483 ? NH2 ? A ARG 41 NH2 19 1 Y 0 A GLU 485 ? CD ? A GLU 43 CD 20 1 Y 0 A GLU 485 ? OE1 ? A GLU 43 OE1 21 1 Y 0 A GLU 485 ? OE2 ? A GLU 43 OE2 22 1 Y 0 A ARG 493 ? CD ? A ARG 51 CD 23 1 Y 0 A ARG 493 ? NE ? A ARG 51 NE 24 1 Y 0 A ARG 493 ? CZ ? A ARG 51 CZ 25 1 Y 0 A ARG 493 ? NH1 ? A ARG 51 NH1 26 1 Y 0 A ARG 493 ? NH2 ? A ARG 51 NH2 27 1 Y 0 A ASP 495 ? CG ? A ASP 53 CG 28 1 Y 0 A ASP 495 ? OD1 ? A ASP 53 OD1 29 1 Y 0 A ASP 495 ? OD2 ? A ASP 53 OD2 30 1 Y 0 A GLN 496 ? CD ? A GLN 54 CD 31 1 Y 0 A GLN 496 ? OE1 ? A GLN 54 OE1 32 1 Y 0 A GLN 496 ? NE2 ? A GLN 54 NE2 33 1 Y 0 A LYS 506 ? CE ? A LYS 64 CE 34 1 Y 0 A LYS 506 ? NZ ? A LYS 64 NZ 35 1 Y 0 A ASP 507 ? CG ? A ASP 65 CG 36 1 Y 0 A ASP 507 ? OD1 ? A ASP 65 OD1 37 1 Y 0 A ASP 507 ? OD2 ? A ASP 65 OD2 38 1 Y 0 A ASP 511 ? CG ? A ASP 69 CG 39 1 Y 0 A ASP 511 ? OD1 ? A ASP 69 OD1 40 1 Y 0 A ASP 511 ? OD2 ? A ASP 69 OD2 41 1 Y 0 A LYS 512 ? CG ? A LYS 70 CG 42 1 Y 0 A LYS 512 ? CD ? A LYS 70 CD 43 1 Y 0 A LYS 512 ? CE ? A LYS 70 CE 44 1 Y 0 A LYS 512 ? NZ ? A LYS 70 NZ 45 1 Y 0 A VAL 518 ? CG1 ? A VAL 76 CG1 46 1 Y 0 A VAL 518 ? CG2 ? A VAL 76 CG2 47 1 Y 0 A GLU 543 ? CG ? A GLU 101 CG 48 1 Y 0 A GLU 543 ? CD ? A GLU 101 CD 49 1 Y 0 A GLU 543 ? OE1 ? A GLU 101 OE1 50 1 Y 0 A GLU 543 ? OE2 ? A GLU 101 OE2 51 1 Y 0 A SER 573 ? OG ? A SER 131 OG 52 1 Y 0 A LYS 607 ? CD ? A LYS 165 CD 53 1 Y 0 A LYS 607 ? CE ? A LYS 165 CE 54 1 Y 0 A LYS 607 ? NZ ? A LYS 165 NZ 55 1 Y 0 A ILE 609 ? CD1 ? A ILE 167 CD1 56 1 Y 0 A ARG 611 ? CG ? A ARG 169 CG 57 1 Y 0 A ARG 611 ? CD ? A ARG 169 CD 58 1 Y 0 A ARG 611 ? NE ? A ARG 169 NE 59 1 Y 0 A ARG 611 ? CZ ? A ARG 169 CZ 60 1 Y 0 A ARG 611 ? NH1 ? A ARG 169 NH1 61 1 Y 0 A ARG 611 ? NH2 ? A ARG 169 NH2 62 1 Y 0 A GLU 622 ? CD ? A GLU 180 CD 63 1 Y 0 A GLU 622 ? OE1 ? A GLU 180 OE1 64 1 Y 0 A GLU 622 ? OE2 ? A GLU 180 OE2 65 1 Y 0 A ILE 640 ? CG1 ? A ILE 198 CG1 66 1 Y 0 A ILE 640 ? CG2 ? A ILE 198 CG2 67 1 Y 0 A ILE 640 ? CD1 ? A ILE 198 CD1 68 1 Y 0 A LEU 651 ? CD1 ? A LEU 209 CD1 69 1 Y 0 A LEU 651 ? CD2 ? A LEU 209 CD2 70 1 Y 0 A LYS 654 ? CE ? A LYS 212 CE 71 1 Y 0 A LYS 654 ? NZ ? A LYS 212 NZ 72 1 Y 0 A GLU 696 ? CD ? A GLU 254 CD 73 1 Y 0 A GLU 696 ? OE1 ? A GLU 254 OE1 74 1 Y 0 A GLU 696 ? OE2 ? A GLU 254 OE2 75 1 Y 0 A GLU 697 ? CG ? A GLU 255 CG 76 1 Y 0 A GLU 697 ? CD ? A GLU 255 CD 77 1 Y 0 A GLU 697 ? OE1 ? A GLU 255 OE1 78 1 Y 0 A GLU 697 ? OE2 ? A GLU 255 OE2 79 1 Y 0 A LEU 701 ? CD1 ? A LEU 259 CD1 80 1 Y 0 A LEU 701 ? CD2 ? A LEU 259 CD2 81 1 Y 0 A GLU 717 ? CD ? A GLU 275 CD 82 1 Y 0 A GLU 717 ? OE1 ? A GLU 275 OE1 83 1 Y 0 A GLU 717 ? OE2 ? A GLU 275 OE2 84 1 Y 0 A LYS 737 ? NZ ? A LYS 295 NZ 85 1 Y 0 A LYS 745 ? NZ ? A LYS 303 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 443 ? A ALA 1 2 1 Y 1 A MET 444 ? A MET 2 3 1 Y 1 A GLY 445 ? A GLY 3 4 1 Y 1 A SER 446 ? A SER 4 5 1 Y 1 A ALA 447 ? A ALA 5 6 1 Y 1 A GLY 448 ? A GLY 6 7 1 Y 1 A LEU 449 ? A LEU 7 8 1 Y 1 A VAL 450 ? A VAL 8 9 1 Y 1 A PRO 577 ? A PRO 135 10 1 Y 1 A ARG 578 ? A ARG 136 11 1 Y 1 A SER 579 ? A SER 137 12 1 Y 1 A SER 580 ? A SER 138 13 1 Y 1 A LYS 644 ? A LYS 202 14 1 Y 1 A LYS 645 ? A LYS 203 15 1 Y 1 A THR 646 ? A THR 204 16 1 Y 1 A SER 647 ? A SER 205 17 1 Y 1 A ASN 648 ? A ASN 206 18 1 Y 1 A GLY 649 ? A GLY 207 19 1 Y 1 A ARG 650 ? A ARG 208 # _pdbx_audit_support.funding_organization 'German Federal Ministry of Education and Research (BMBF)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 16EX1022L _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH #