data_4U3K # _entry.id 4U3K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4U3K WWPDB D_1000202740 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2018-01-24 _pdbx_database_PDB_obs_spr.pdb_id 5MY3 _pdbx_database_PDB_obs_spr.replace_pdb_id 4U3K _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4U3K _pdbx_database_status.recvd_initial_deposition_date 2014-07-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martinez, D.M.' 1 ;Langlois d'Estaintot, B. ; 2 'Granier, T.' 3 'Prouzet-Mauleon, V.' 4 'Hugues, M.' 5 'Dufourc, E.J.' 6 'Gallois, B.' 7 'Doignon, F.' 8 'Odaert, B.' 9 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the RhoGAP domain of Rgd1p at 2.19 Angstroms resolution' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Martinez, D.M.' 1 primary ;Langlois d'Estaintot, B. ; 2 primary 'Granier, T.' 3 primary 'Prouzet-Mauleon, V.' 4 primary 'Hugues, M.' 5 primary 'Dufourc, E.J.' 6 primary 'Gallois, B.' 7 primary 'Doignon, F.' 8 primary 'Odaert, B.' 9 # _cell.entry_id 4U3K _cell.length_a 63.230 _cell.length_b 63.230 _cell.length_c 99.730 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4U3K _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RHO GTPase-activating protein RGD1' 25723.566 1 ? ? 'UNP residues 450-666' ? 2 water nat water 18.015 36 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RhoGAP,Related GAP domain protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MISHIQTNNNMPPGVQKNFKTFGVPLESLIEFEQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPA NISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFH LKRVLAHEAQNRMNLRALCIIWGPTIAPANPDDANDVNFQIMAMEVLLEVSDQAFEPELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MISHIQTNNNMPPGVQKNFKTFGVPLESLIEFEQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPA NISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFH LKRVLAHEAQNRMNLRALCIIWGPTIAPANPDDANDVNFQIMAMEVLLEVSDQAFEPELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 SER n 1 4 HIS n 1 5 ILE n 1 6 GLN n 1 7 THR n 1 8 ASN n 1 9 ASN n 1 10 ASN n 1 11 MET n 1 12 PRO n 1 13 PRO n 1 14 GLY n 1 15 VAL n 1 16 GLN n 1 17 LYS n 1 18 ASN n 1 19 PHE n 1 20 LYS n 1 21 THR n 1 22 PHE n 1 23 GLY n 1 24 VAL n 1 25 PRO n 1 26 LEU n 1 27 GLU n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 GLU n 1 32 PHE n 1 33 GLU n 1 34 GLN n 1 35 ASP n 1 36 MET n 1 37 VAL n 1 38 PRO n 1 39 ALA n 1 40 ILE n 1 41 VAL n 1 42 ARG n 1 43 GLN n 1 44 CYS n 1 45 ILE n 1 46 TYR n 1 47 VAL n 1 48 ILE n 1 49 ASP n 1 50 LYS n 1 51 PHE n 1 52 GLY n 1 53 LEU n 1 54 ASP n 1 55 GLN n 1 56 GLU n 1 57 GLY n 1 58 ILE n 1 59 TYR n 1 60 ARG n 1 61 LYS n 1 62 SER n 1 63 ALA n 1 64 ASN n 1 65 VAL n 1 66 LEU n 1 67 ASP n 1 68 VAL n 1 69 SER n 1 70 LYS n 1 71 LEU n 1 72 LYS n 1 73 GLU n 1 74 GLU n 1 75 ILE n 1 76 ASP n 1 77 LYS n 1 78 ASP n 1 79 PRO n 1 80 ALA n 1 81 ASN n 1 82 ILE n 1 83 SER n 1 84 MET n 1 85 ILE n 1 86 LEU n 1 87 PRO n 1 88 SER n 1 89 LYS n 1 90 PRO n 1 91 HIS n 1 92 SER n 1 93 ASP n 1 94 SER n 1 95 ASP n 1 96 ILE n 1 97 TYR n 1 98 LEU n 1 99 VAL n 1 100 GLY n 1 101 SER n 1 102 LEU n 1 103 LEU n 1 104 LYS n 1 105 THR n 1 106 PHE n 1 107 PHE n 1 108 ALA n 1 109 SER n 1 110 LEU n 1 111 PRO n 1 112 ASP n 1 113 SER n 1 114 VAL n 1 115 LEU n 1 116 PRO n 1 117 LYS n 1 118 ALA n 1 119 LEU n 1 120 SER n 1 121 SER n 1 122 GLU n 1 123 ILE n 1 124 LYS n 1 125 VAL n 1 126 CYS n 1 127 LEU n 1 128 GLN n 1 129 ILE n 1 130 GLU n 1 131 ASP n 1 132 PRO n 1 133 THR n 1 134 THR n 1 135 ARG n 1 136 LYS n 1 137 ASN n 1 138 PHE n 1 139 MET n 1 140 HIS n 1 141 GLY n 1 142 LEU n 1 143 ILE n 1 144 TYR n 1 145 ASN n 1 146 LEU n 1 147 PRO n 1 148 ASP n 1 149 ALA n 1 150 GLN n 1 151 TYR n 1 152 TRP n 1 153 THR n 1 154 LEU n 1 155 ARG n 1 156 ALA n 1 157 LEU n 1 158 VAL n 1 159 PHE n 1 160 HIS n 1 161 LEU n 1 162 LYS n 1 163 ARG n 1 164 VAL n 1 165 LEU n 1 166 ALA n 1 167 HIS n 1 168 GLU n 1 169 ALA n 1 170 GLN n 1 171 ASN n 1 172 ARG n 1 173 MET n 1 174 ASN n 1 175 LEU n 1 176 ARG n 1 177 ALA n 1 178 LEU n 1 179 CYS n 1 180 ILE n 1 181 ILE n 1 182 TRP n 1 183 GLY n 1 184 PRO n 1 185 THR n 1 186 ILE n 1 187 ALA n 1 188 PRO n 1 189 ALA n 1 190 ASN n 1 191 PRO n 1 192 ASP n 1 193 ASP n 1 194 ALA n 1 195 ASN n 1 196 ASP n 1 197 VAL n 1 198 ASN n 1 199 PHE n 1 200 GLN n 1 201 ILE n 1 202 MET n 1 203 ALA n 1 204 MET n 1 205 GLU n 1 206 VAL n 1 207 LEU n 1 208 LEU n 1 209 GLU n 1 210 VAL n 1 211 SER n 1 212 ASP n 1 213 GLN n 1 214 ALA n 1 215 PHE n 1 216 GLU n 1 217 PRO n 1 218 GLU n 1 219 LEU n 1 220 GLU n 1 221 HIS n 1 222 HIS n 1 223 HIS n 1 224 HIS n 1 225 HIS n 1 226 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 226 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RGD1, YBR260C, YBR1728' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RGD1_YEAST _struct_ref.pdbx_db_accession P38339 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ISHIQTNNNMPPGVQKNFKTFGVPLESLIEFEQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPAN ISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFHL KRVLAHEAQNRMNLRALCIIWGPTIAPANPDDANDVNFQIMAMEVLLEVSDQAFEPE ; _struct_ref.pdbx_align_begin 450 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4U3K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 218 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38339 _struct_ref_seq.db_align_beg 450 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 666 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 218 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4U3K MET A 1 ? UNP P38339 ? ? 'initiating methionine' 1 1 1 4U3K LEU A 219 ? UNP P38339 ? ? 'expression tag' 219 2 1 4U3K GLU A 220 ? UNP P38339 ? ? 'expression tag' 220 3 1 4U3K HIS A 221 ? UNP P38339 ? ? 'expression tag' 221 4 1 4U3K HIS A 222 ? UNP P38339 ? ? 'expression tag' 222 5 1 4U3K HIS A 223 ? UNP P38339 ? ? 'expression tag' 223 6 1 4U3K HIS A 224 ? UNP P38339 ? ? 'expression tag' 224 7 1 4U3K HIS A 225 ? UNP P38339 ? ? 'expression tag' 225 8 1 4U3K HIS A 226 ? UNP P38339 ? ? 'expression tag' 226 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4U3K _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.00 _exptl_crystal.description Hexagonal _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.56 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'HEPES, PEG3350, NaN3, Tris, DTT' _exptl_crystal_grow.pdbx_pH_range 7.2-7.9 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-04-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Silicon 111 crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.953700 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.953700 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 50.8 _reflns.entry_id 4U3K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.19 _reflns.d_resolution_low 54.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11616 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.52 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.57 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 1.058 _reflns_shell.d_res_high 2.19 _reflns_shell.d_res_low 2.25 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 2.29 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 1831 _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 97.9 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.aniso_B[1][1] 0.23 _refine.aniso_B[1][2] 0.12 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 0.23 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.75 _refine.B_iso_max ? _refine.B_iso_mean 56.648 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.937 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4U3K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.19 _refine.ls_d_res_low 54.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11068 _refine.ls_number_reflns_R_free 548 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.56 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18926 _refine.ls_R_factor_R_free 0.24104 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18666 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1RGP _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.241 _refine.pdbx_overall_ESU_R_Free 0.203 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.2043 _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.2492 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1535 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 1571 _refine_hist.d_res_high 2.19 _refine_hist.d_res_low 54.76 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 0.019 1580 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.014 0.020 1510 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.742 1.974 2146 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 3.513 3.000 3477 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.978 5.000 196 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 44.005 25.224 67 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.210 15.000 262 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.089 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.094 0.200 252 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 1756 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 332 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.627 5.513 799 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.627 5.510 798 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.431 8.219 990 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.428 8.223 991 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.563 6.014 781 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.560 6.014 782 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.374 8.799 1157 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 10.597 43.664 1806 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 10.565 43.684 1795 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.190 _refine_ls_shell.d_res_low 2.246 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_R_work 778 _refine_ls_shell.percent_reflns_obs 95.24 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.269 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.293 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? # _struct.entry_id 4U3K _struct.title 'Crystal structure of the RhoGAP domain of Rgd1p at 2.19 Angstroms resolution' _struct.pdbx_descriptor 'Rgd1-RhoGAP domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4U3K _struct_keywords.text 'RhoGAP, RGD1, polarized growth, cytokinesis, cell cycle' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 25 ? ILE A 30 ? PRO A 25 ILE A 30 1 ? 6 HELX_P HELX_P2 AA2 PRO A 38 ? GLY A 52 ? PRO A 38 GLY A 52 1 ? 15 HELX_P HELX_P3 AA3 ASN A 64 ? ASP A 78 ? ASN A 64 ASP A 78 1 ? 15 HELX_P HELX_P4 AA4 PRO A 79 ? LEU A 86 ? PRO A 79 LEU A 86 5 ? 8 HELX_P HELX_P5 AA5 SER A 92 ? SER A 109 ? SER A 92 SER A 109 1 ? 18 HELX_P HELX_P6 AA6 PRO A 116 ? ALA A 118 ? PRO A 116 ALA A 118 5 ? 3 HELX_P HELX_P7 AA7 LEU A 119 ? ILE A 129 ? LEU A 119 ILE A 129 1 ? 11 HELX_P HELX_P8 AA8 ASP A 131 ? ASN A 145 ? ASP A 131 ASN A 145 1 ? 15 HELX_P HELX_P9 AA9 PRO A 147 ? HIS A 167 ? PRO A 147 HIS A 167 1 ? 21 HELX_P HELX_P10 AB1 HIS A 167 ? ARG A 172 ? HIS A 167 ARG A 172 1 ? 6 HELX_P HELX_P11 AB2 ASN A 174 ? ALA A 187 ? ASN A 174 ALA A 187 1 ? 14 HELX_P HELX_P12 AB3 VAL A 197 ? PHE A 215 ? VAL A 197 PHE A 215 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 4U3K _atom_sites.fract_transf_matrix[1][1] 0.015815 _atom_sites.fract_transf_matrix[1][2] 0.009131 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018262 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010027 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 ASN 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 MET 11 11 ? ? ? A . n A 1 12 PRO 12 12 ? ? ? A . n A 1 13 PRO 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 GLN 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 ASN 18 18 ? ? ? A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLU 33 33 ? ? ? A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 LYS 89 89 ? ? ? A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 MET 173 173 173 MET MET A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ASN 195 195 195 ASN ALA A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 MET 202 202 202 MET MET A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 GLN 213 213 213 GLN GLN A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 GLU 220 220 ? ? ? A . n A 1 221 HIS 221 221 ? ? ? A . n A 1 222 HIS 222 222 ? ? ? A . n A 1 223 HIS 223 223 ? ? ? A . n A 1 224 HIS 224 224 ? ? ? A . n A 1 225 HIS 225 225 ? ? ? A . n A 1 226 HIS 226 226 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 10 HOH HOH A . B 2 HOH 2 302 5 HOH HOH A . B 2 HOH 3 303 9 HOH HOH A . B 2 HOH 4 304 19 HOH HOH A . B 2 HOH 5 305 37 HOH HOH A . B 2 HOH 6 306 7 HOH HOH A . B 2 HOH 7 307 26 HOH HOH A . B 2 HOH 8 308 17 HOH HOH A . B 2 HOH 9 309 29 HOH HOH A . B 2 HOH 10 310 6 HOH HOH A . B 2 HOH 11 311 18 HOH HOH A . B 2 HOH 12 312 30 HOH HOH A . B 2 HOH 13 313 31 HOH HOH A . B 2 HOH 14 314 1 HOH HOH A . B 2 HOH 15 315 2 HOH HOH A . B 2 HOH 16 316 3 HOH HOH A . B 2 HOH 17 317 4 HOH HOH A . B 2 HOH 18 318 8 HOH HOH A . B 2 HOH 19 319 11 HOH HOH A . B 2 HOH 20 320 12 HOH HOH A . B 2 HOH 21 321 13 HOH HOH A . B 2 HOH 22 322 14 HOH HOH A . B 2 HOH 23 323 15 HOH HOH A . B 2 HOH 24 324 16 HOH HOH A . B 2 HOH 25 325 20 HOH HOH A . B 2 HOH 26 326 21 HOH HOH A . B 2 HOH 27 327 22 HOH HOH A . B 2 HOH 28 328 23 HOH HOH A . B 2 HOH 29 329 24 HOH HOH A . B 2 HOH 30 330 25 HOH HOH A . B 2 HOH 31 331 27 HOH HOH A . B 2 HOH 32 332 32 HOH HOH A . B 2 HOH 33 333 33 HOH HOH A . B 2 HOH 34 334 34 HOH HOH A . B 2 HOH 35 335 35 HOH HOH A . B 2 HOH 36 336 38 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details Monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9490 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-29 2 'Structure model' 1 1 2018-01-24 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_PDB_obs_spr 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code' 2 2 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ALA 63 ? ? HG A SER 101 ? ? 1.16 2 1 O A GLY 141 ? ? HD22 A ASN 145 ? ? 1.52 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id TYR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 59 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 70.83 _pdbx_validate_torsion.psi -11.94 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 19 ? CB ? A PHE 19 CB 2 1 Y 1 A PHE 19 ? CG ? A PHE 19 CG 3 1 Y 1 A PHE 19 ? CD1 ? A PHE 19 CD1 4 1 Y 1 A PHE 19 ? CD2 ? A PHE 19 CD2 5 1 Y 1 A PHE 19 ? CE1 ? A PHE 19 CE1 6 1 Y 1 A PHE 19 ? CE2 ? A PHE 19 CE2 7 1 Y 1 A PHE 19 ? CZ ? A PHE 19 CZ 8 1 Y 1 A SER 28 ? OG ? A SER 28 OG 9 1 Y 1 A PHE 32 ? CG ? A PHE 32 CG 10 1 Y 1 A PHE 32 ? CD1 ? A PHE 32 CD1 11 1 Y 1 A PHE 32 ? CD2 ? A PHE 32 CD2 12 1 Y 1 A PHE 32 ? CE1 ? A PHE 32 CE1 13 1 Y 1 A PHE 32 ? CE2 ? A PHE 32 CE2 14 1 Y 1 A PHE 32 ? CZ ? A PHE 32 CZ 15 1 Y 1 A MET 36 ? CE ? A MET 36 CE 16 1 Y 1 A LYS 61 ? CD ? A LYS 61 CD 17 1 Y 1 A LYS 61 ? CE ? A LYS 61 CE 18 1 Y 1 A LYS 61 ? NZ ? A LYS 61 NZ 19 1 Y 1 A LYS 77 ? CG ? A LYS 77 CG 20 1 Y 1 A LYS 77 ? CD ? A LYS 77 CD 21 1 Y 1 A LYS 77 ? CE ? A LYS 77 CE 22 1 Y 1 A LYS 77 ? NZ ? A LYS 77 NZ 23 1 Y 1 A MET 84 ? CE ? A MET 84 CE 24 1 Y 1 A GLU 130 ? CG ? A GLU 130 CG 25 1 Y 1 A GLU 130 ? CD ? A GLU 130 CD 26 1 Y 1 A GLU 130 ? OE1 ? A GLU 130 OE1 27 1 Y 1 A GLU 130 ? OE2 ? A GLU 130 OE2 28 1 Y 1 A LYS 136 ? CE ? A LYS 136 CE 29 1 Y 1 A LYS 136 ? NZ ? A LYS 136 NZ 30 1 Y 1 A ARG 172 ? CZ ? A ARG 172 CZ 31 1 Y 1 A ARG 172 ? NH1 ? A ARG 172 NH1 32 1 Y 1 A ARG 172 ? NH2 ? A ARG 172 NH2 33 1 Y 1 A MET 173 ? CE ? A MET 173 CE 34 1 Y 1 A ASN 195 ? CG ? A ASN 195 CG 35 1 Y 1 A ASN 195 ? OD1 ? A ASN 195 OD1 36 1 Y 1 A ASN 195 ? ND2 ? A ASN 195 ND2 37 1 Y 1 A VAL 197 ? CG1 ? A VAL 197 CG1 38 1 Y 1 A VAL 197 ? CG2 ? A VAL 197 CG2 39 1 Y 1 A GLU 209 ? CG ? A GLU 209 CG 40 1 Y 1 A GLU 209 ? CD ? A GLU 209 CD 41 1 Y 1 A GLU 209 ? OE1 ? A GLU 209 OE1 42 1 Y 1 A GLU 209 ? OE2 ? A GLU 209 OE2 43 1 Y 1 A LEU 219 ? CG ? A LEU 219 CG 44 1 Y 1 A LEU 219 ? CD1 ? A LEU 219 CD1 45 1 Y 1 A LEU 219 ? CD2 ? A LEU 219 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A ASN 9 ? A ASN 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A MET 11 ? A MET 11 12 1 Y 1 A PRO 12 ? A PRO 12 13 1 Y 1 A PRO 13 ? A PRO 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A GLN 16 ? A GLN 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A ASN 18 ? A ASN 18 19 1 Y 1 A GLU 33 ? A GLU 33 20 1 Y 1 A LYS 89 ? A LYS 89 21 1 Y 1 A GLU 220 ? A GLU 220 22 1 Y 1 A HIS 221 ? A HIS 221 23 1 Y 1 A HIS 222 ? A HIS 222 24 1 Y 1 A HIS 223 ? A HIS 223 25 1 Y 1 A HIS 224 ? A HIS 224 26 1 Y 1 A HIS 225 ? A HIS 225 27 1 Y 1 A HIS 226 ? A HIS 226 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #