data_4U9R # _entry.id 4U9R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4U9R pdb_00004u9r 10.2210/pdb4u9r/pdb WWPDB D_1000203047 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-08 2 'Structure model' 1 1 2015-08-05 3 'Structure model' 1 2 2015-09-02 4 'Structure model' 1 3 2017-09-27 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_oper_list 2 4 'Structure model' software 3 5 'Structure model' chem_comp_atom 4 5 'Structure model' chem_comp_bond 5 5 'Structure model' database_2 6 5 'Structure model' diffrn_radiation_wavelength # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 2 4 'Structure model' '_software.name' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4U9R _pdbx_database_status.recvd_initial_deposition_date 2014-08-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Smith, A.T.' 1 'Rosenzweig, A.C.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 678 _citation.page_last 684 _citation.title 'A new metal binding domain involved in cadmium, cobalt and zinc transport.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nchembio.1863 _citation.pdbx_database_id_PubMed 26192600 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Smith, A.T.' 1 ? primary 'Barupala, D.' 2 ? primary 'Stemmler, T.L.' 3 ? primary 'Rosenzweig, A.C.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CzcP cation efflux P1-ATPase' 22545.195 1 ? ? 'ferredoxin-like domain' ? 2 non-polymer syn 'CADMIUM ION' 112.411 2 ? ? ? ? 3 non-polymer syn ;3,3',3''-phosphanetriyltripropanoic acid ; 250.186 1 ? ? ? ? 4 water nat water 18.015 12 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASWSHPQFEKGAENLYFQSNATEKLRLDIPVLLPGLPDSSDPCVERLLSELRGKEGVEAAHIKTANVDSDSQICVHYDP AAISLARIRELVTSTGAVISSRFGHVLWQLKGVWHERRARTVASQLRALPGVIEAEVSASGIARVEFDNDRISAAGIEQA LSKRGLAPVEIGARKSGHADHEHREGVKDHAHGEGEGHEAHAHGSVFG ; _entity_poly.pdbx_seq_one_letter_code_can ;MASWSHPQFEKGAENLYFQSNATEKLRLDIPVLLPGLPDSSDPCVERLLSELRGKEGVEAAHIKTANVDSDSQICVHYDP AAISLARIRELVTSTGAVISSRFGHVLWQLKGVWHERRARTVASQLRALPGVIEAEVSASGIARVEFDNDRISAAGIEQA LSKRGLAPVEIGARKSGHADHEHREGVKDHAHGEGEGHEAHAHGSVFG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CADMIUM ION' CD 3 ;3,3',3''-phosphanetriyltripropanoic acid ; TCE 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 TRP n 1 5 SER n 1 6 HIS n 1 7 PRO n 1 8 GLN n 1 9 PHE n 1 10 GLU n 1 11 LYS n 1 12 GLY n 1 13 ALA n 1 14 GLU n 1 15 ASN n 1 16 LEU n 1 17 TYR n 1 18 PHE n 1 19 GLN n 1 20 SER n 1 21 ASN n 1 22 ALA n 1 23 THR n 1 24 GLU n 1 25 LYS n 1 26 LEU n 1 27 ARG n 1 28 LEU n 1 29 ASP n 1 30 ILE n 1 31 PRO n 1 32 VAL n 1 33 LEU n 1 34 LEU n 1 35 PRO n 1 36 GLY n 1 37 LEU n 1 38 PRO n 1 39 ASP n 1 40 SER n 1 41 SER n 1 42 ASP n 1 43 PRO n 1 44 CYS n 1 45 VAL n 1 46 GLU n 1 47 ARG n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 GLU n 1 52 LEU n 1 53 ARG n 1 54 GLY n 1 55 LYS n 1 56 GLU n 1 57 GLY n 1 58 VAL n 1 59 GLU n 1 60 ALA n 1 61 ALA n 1 62 HIS n 1 63 ILE n 1 64 LYS n 1 65 THR n 1 66 ALA n 1 67 ASN n 1 68 VAL n 1 69 ASP n 1 70 SER n 1 71 ASP n 1 72 SER n 1 73 GLN n 1 74 ILE n 1 75 CYS n 1 76 VAL n 1 77 HIS n 1 78 TYR n 1 79 ASP n 1 80 PRO n 1 81 ALA n 1 82 ALA n 1 83 ILE n 1 84 SER n 1 85 LEU n 1 86 ALA n 1 87 ARG n 1 88 ILE n 1 89 ARG n 1 90 GLU n 1 91 LEU n 1 92 VAL n 1 93 THR n 1 94 SER n 1 95 THR n 1 96 GLY n 1 97 ALA n 1 98 VAL n 1 99 ILE n 1 100 SER n 1 101 SER n 1 102 ARG n 1 103 PHE n 1 104 GLY n 1 105 HIS n 1 106 VAL n 1 107 LEU n 1 108 TRP n 1 109 GLN n 1 110 LEU n 1 111 LYS n 1 112 GLY n 1 113 VAL n 1 114 TRP n 1 115 HIS n 1 116 GLU n 1 117 ARG n 1 118 ARG n 1 119 ALA n 1 120 ARG n 1 121 THR n 1 122 VAL n 1 123 ALA n 1 124 SER n 1 125 GLN n 1 126 LEU n 1 127 ARG n 1 128 ALA n 1 129 LEU n 1 130 PRO n 1 131 GLY n 1 132 VAL n 1 133 ILE n 1 134 GLU n 1 135 ALA n 1 136 GLU n 1 137 VAL n 1 138 SER n 1 139 ALA n 1 140 SER n 1 141 GLY n 1 142 ILE n 1 143 ALA n 1 144 ARG n 1 145 VAL n 1 146 GLU n 1 147 PHE n 1 148 ASP n 1 149 ASN n 1 150 ASP n 1 151 ARG n 1 152 ILE n 1 153 SER n 1 154 ALA n 1 155 ALA n 1 156 GLY n 1 157 ILE n 1 158 GLU n 1 159 GLN n 1 160 ALA n 1 161 LEU n 1 162 SER n 1 163 LYS n 1 164 ARG n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 PRO n 1 169 VAL n 1 170 GLU n 1 171 ILE n 1 172 GLY n 1 173 ALA n 1 174 ARG n 1 175 LYS n 1 176 SER n 1 177 GLY n 1 178 HIS n 1 179 ALA n 1 180 ASP n 1 181 HIS n 1 182 GLU n 1 183 HIS n 1 184 ARG n 1 185 GLU n 1 186 GLY n 1 187 VAL n 1 188 LYS n 1 189 ASP n 1 190 HIS n 1 191 ALA n 1 192 HIS n 1 193 GLY n 1 194 GLU n 1 195 GLY n 1 196 GLU n 1 197 GLY n 1 198 HIS n 1 199 GLU n 1 200 ALA n 1 201 HIS n 1 202 ALA n 1 203 HIS n 1 204 GLY n 1 205 SER n 1 206 VAL n 1 207 PHE n 1 208 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 208 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'czcP, Rmet_5970' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'CH34 / ATCC 43123 / DSM 2839' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ralstonia metallidurans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 266264 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Top10 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pBAD Strep TEV LIC 8R' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TCE non-polymer . ;3,3',3''-phosphanetriyltripropanoic acid ; '3-[bis(2-carboxyethyl)phosphanyl]propanoic acid' 'C9 H15 O6 P' 250.186 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 TRP 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 PHE 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 GLU 14 14 ? ? ? A . n A 1 15 ASN 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 TYR 17 17 ? ? ? A . n A 1 18 PHE 18 18 ? ? ? A . n A 1 19 GLN 19 19 ? ? ? A . n A 1 20 SER 20 20 ? ? ? A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 TRP 114 114 114 TRP TRP A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 PRO 168 168 ? ? ? A . n A 1 169 VAL 169 169 ? ? ? A . n A 1 170 GLU 170 170 ? ? ? A . n A 1 171 ILE 171 171 ? ? ? A . n A 1 172 GLY 172 172 ? ? ? A . n A 1 173 ALA 173 173 ? ? ? A . n A 1 174 ARG 174 174 ? ? ? A . n A 1 175 LYS 175 175 ? ? ? A . n A 1 176 SER 176 176 ? ? ? A . n A 1 177 GLY 177 177 ? ? ? A . n A 1 178 HIS 178 178 ? ? ? A . n A 1 179 ALA 179 179 ? ? ? A . n A 1 180 ASP 180 180 ? ? ? A . n A 1 181 HIS 181 181 ? ? ? A . n A 1 182 GLU 182 182 ? ? ? A . n A 1 183 HIS 183 183 ? ? ? A . n A 1 184 ARG 184 184 ? ? ? A . n A 1 185 GLU 185 185 ? ? ? A . n A 1 186 GLY 186 186 ? ? ? A . n A 1 187 VAL 187 187 ? ? ? A . n A 1 188 LYS 188 188 ? ? ? A . n A 1 189 ASP 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n A 1 191 ALA 191 191 ? ? ? A . n A 1 192 HIS 192 192 ? ? ? A . n A 1 193 GLY 193 193 ? ? ? A . n A 1 194 GLU 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 GLU 196 196 ? ? ? A . n A 1 197 GLY 197 197 ? ? ? A . n A 1 198 HIS 198 198 ? ? ? A . n A 1 199 GLU 199 199 ? ? ? A . n A 1 200 ALA 200 200 ? ? ? A . n A 1 201 HIS 201 201 ? ? ? A . n A 1 202 ALA 202 202 ? ? ? A . n A 1 203 HIS 203 203 ? ? ? A . n A 1 204 GLY 204 204 ? ? ? A . n A 1 205 SER 205 205 ? ? ? A . n A 1 206 VAL 206 206 ? ? ? A . n A 1 207 PHE 207 207 ? ? ? A . n A 1 208 GLY 208 208 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CD 1 301 1 CD CD A . C 2 CD 1 302 2 CD CD A . D 3 TCE 1 303 1 TCE TCP A . E 4 HOH 1 401 10 HOH HOH A . E 4 HOH 2 402 3 HOH HOH A . E 4 HOH 3 403 2 HOH HOH A . E 4 HOH 4 404 7 HOH HOH A . E 4 HOH 5 405 5 HOH HOH A . E 4 HOH 6 406 9 HOH HOH A . E 4 HOH 7 407 11 HOH HOH A . E 4 HOH 8 408 1 HOH HOH A . E 4 HOH 9 409 4 HOH HOH A . E 4 HOH 10 410 6 HOH HOH A . E 4 HOH 11 411 8 HOH HOH A . E 4 HOH 12 412 12 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0069 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.14 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 # _cell.length_a 58.160 _cell.length_b 58.160 _cell.length_c 72.010 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4U9R _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4U9R _symmetry.cell_setting ? _symmetry.Int_Tables_number 76 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4U9R _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.7 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 4000, 1 mM CdSO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-07-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03322 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03322 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 46.473 _reflns.entry_id 4U9R _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.170 _reflns.d_resolution_low 36.010 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12757 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.300 _reflns.pdbx_Rmerge_I_obs 0.053 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.016 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 144365 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.170 2.230 ? 4.000 10281 ? ? 920 ? 99.700 ? ? ? ? 0.719 ? ? ? ? ? ? ? ? 11.200 ? ? ? ? ? 0.223 0 1 1 ? ? 9.710 36.010 ? 80.200 1598 ? ? 150 ? 97.400 ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 10.700 ? ? ? ? ? 0.007 0 2 1 ? ? # _refine.aniso_B[1][1] 1.5200 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 1.5200 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -3.0400 _refine.B_iso_max 139.570 _refine.B_iso_mean 64.8510 _refine.B_iso_min 25.720 _refine.correlation_coeff_Fo_to_Fc 0.9380 _refine.correlation_coeff_Fo_to_Fc_free 0.9220 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4U9R _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1700 _refine.ls_d_res_low 36.0100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12503 _refine.ls_number_reflns_R_free 1233 _refine.ls_number_reflns_R_work 11270 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.9800 _refine.ls_percent_reflns_R_free 9.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2313 _refine.ls_R_factor_R_free 0.2661 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2275 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2130 _refine.pdbx_overall_ESU_R_Free 0.1920 _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.0930 _refine.overall_SU_ML 0.1340 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1700 _refine_hist.d_res_low 36.0100 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 1145 _refine_hist.pdbx_number_residues_total 147 _refine_hist.pdbx_B_iso_mean_ligand 79.40 _refine_hist.pdbx_B_iso_mean_solvent 44.46 _refine_hist.pdbx_number_atoms_protein 1115 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 1154 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1135 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.465 1.975 1551 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.795 3.002 2601 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.574 5.000 146 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.231 22.708 48 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.774 15.000 195 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.369 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.074 0.200 182 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 1289 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 248 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 4.368 6.231 588 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.335 6.221 586 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.923 9.307 732 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1700 _refine_ls_shell.d_res_low 2.2260 _refine_ls_shell.number_reflns_all 877 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 91 _refine_ls_shell.number_reflns_R_work 786 _refine_ls_shell.percent_reflns_obs 95.1200 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2640 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2510 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? # _struct.entry_id 4U9R _struct.title 'Structure of the N-terminal Extension from Cupriavidus metallidurans CzcP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4U9R _struct_keywords.text 'ferredoxin-like domain, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1LAJ7_RALME _struct_ref.pdbx_db_accession Q1LAJ7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TEKLRLDIPVLLPGLPDSSDPCVERLLSELRGKEGVEAAHIKTANVDSDSQICVHYDPAAISLARIRELVTSTGAVISSR FGHVLWQLKGVWHERRARTVASQLRALPGVIEAEVSASGIARVEFDNDRISAAGIEQALSKRGLAPVEIGARKSGHADHE HREGVKDHAHGEGEGHEAHAHGSVFG ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4U9R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 208 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1LAJ7 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 187 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 208 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4U9R MET A 1 ? UNP Q1LAJ7 ? ? 'expression tag' 1 1 1 4U9R ALA A 2 ? UNP Q1LAJ7 ? ? 'expression tag' 2 2 1 4U9R SER A 3 ? UNP Q1LAJ7 ? ? 'expression tag' 3 3 1 4U9R TRP A 4 ? UNP Q1LAJ7 ? ? 'expression tag' 4 4 1 4U9R SER A 5 ? UNP Q1LAJ7 ? ? 'expression tag' 5 5 1 4U9R HIS A 6 ? UNP Q1LAJ7 ? ? 'expression tag' 6 6 1 4U9R PRO A 7 ? UNP Q1LAJ7 ? ? 'expression tag' 7 7 1 4U9R GLN A 8 ? UNP Q1LAJ7 ? ? 'expression tag' 8 8 1 4U9R PHE A 9 ? UNP Q1LAJ7 ? ? 'expression tag' 9 9 1 4U9R GLU A 10 ? UNP Q1LAJ7 ? ? 'expression tag' 10 10 1 4U9R LYS A 11 ? UNP Q1LAJ7 ? ? 'expression tag' 11 11 1 4U9R GLY A 12 ? UNP Q1LAJ7 ? ? 'expression tag' 12 12 1 4U9R ALA A 13 ? UNP Q1LAJ7 ? ? 'expression tag' 13 13 1 4U9R GLU A 14 ? UNP Q1LAJ7 ? ? 'expression tag' 14 14 1 4U9R ASN A 15 ? UNP Q1LAJ7 ? ? 'expression tag' 15 15 1 4U9R LEU A 16 ? UNP Q1LAJ7 ? ? 'expression tag' 16 16 1 4U9R TYR A 17 ? UNP Q1LAJ7 ? ? 'expression tag' 17 17 1 4U9R PHE A 18 ? UNP Q1LAJ7 ? ? 'expression tag' 18 18 1 4U9R GLN A 19 ? UNP Q1LAJ7 ? ? 'expression tag' 19 19 1 4U9R SER A 20 ? UNP Q1LAJ7 ? ? 'expression tag' 20 20 1 4U9R ASN A 21 ? UNP Q1LAJ7 ? ? 'expression tag' 21 21 1 4U9R ALA A 22 ? UNP Q1LAJ7 ? ? 'expression tag' 22 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.details 'biological unit is the same as asym.' _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.pdbx_formula_weight ? _struct_biol.pdbx_formula_weight_method ? _struct_biol.pdbx_aggregation_state ? _struct_biol.pdbx_assembly_method ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 30 ? LEU A 34 ? ILE A 30 LEU A 34 1 ? 5 HELX_P HELX_P2 AA2 ASP A 42 ? GLY A 54 ? ASP A 42 GLY A 54 1 ? 13 HELX_P HELX_P3 AA3 VAL A 68 ? ASP A 71 ? VAL A 68 ASP A 71 5 ? 4 HELX_P HELX_P4 AA4 SER A 84 ? ARG A 102 ? SER A 84 ARG A 102 1 ? 19 HELX_P HELX_P5 AA5 HIS A 115 ? ALA A 128 ? HIS A 115 ALA A 128 1 ? 14 HELX_P HELX_P6 AA6 SER A 153 ? LYS A 163 ? SER A 153 LYS A 163 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 42 OD1 ? ? ? 1_555 B CD . CD ? ? A ASP 42 A CD 301 1_555 ? ? ? ? ? ? ? 2.104 ? ? metalc2 metalc ? ? A CYS 44 SG ? ? ? 1_555 B CD . CD ? ? A CYS 44 A CD 301 1_555 ? ? ? ? ? ? ? 2.590 ? ? metalc3 metalc ? ? A HIS 62 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 62 A CD 302 1_555 ? ? ? ? ? ? ? 2.220 ? ? metalc4 metalc ? ? A CYS 75 SG ? ? ? 1_555 C CD . CD ? ? A CYS 75 A CD 302 1_555 ? ? ? ? ? ? ? 2.506 ? ? metalc5 metalc ? ? A HIS 77 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 77 A CD 302 1_555 ? ? ? ? ? ? ? 2.167 ? ? metalc6 metalc ? ? A HIS 105 NE2 ? ? ? 1_555 B CD . CD ? ? A HIS 105 A CD 301 1_555 ? ? ? ? ? ? ? 2.215 ? ? metalc7 metalc ? ? A GLU 146 OE1 ? ? ? 1_555 B CD . CD ? ? A GLU 146 A CD 301 1_555 ? ? ? ? ? ? ? 2.652 ? ? metalc8 metalc ? ? A GLU 146 OE2 ? ? ? 1_555 B CD . CD ? ? A GLU 146 A CD 301 1_555 ? ? ? ? ? ? ? 2.123 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 99.9 ? 2 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 116.4 ? 3 SG ? A CYS 44 ? A CYS 44 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 101.3 ? 4 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 OE1 ? A GLU 146 ? A GLU 146 ? 1_555 87.4 ? 5 SG ? A CYS 44 ? A CYS 44 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 OE1 ? A GLU 146 ? A GLU 146 ? 1_555 133.3 ? 6 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 OE1 ? A GLU 146 ? A GLU 146 ? 1_555 116.5 ? 7 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 OE2 ? A GLU 146 ? A GLU 146 ? 1_555 124.2 ? 8 SG ? A CYS 44 ? A CYS 44 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 OE2 ? A GLU 146 ? A GLU 146 ? 1_555 86.8 ? 9 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 OE2 ? A GLU 146 ? A GLU 146 ? 1_555 116.2 ? 10 OE1 ? A GLU 146 ? A GLU 146 ? 1_555 CD ? B CD . ? A CD 301 ? 1_555 OE2 ? A GLU 146 ? A GLU 146 ? 1_555 53.1 ? 11 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 CD ? C CD . ? A CD 302 ? 1_555 SG ? A CYS 75 ? A CYS 75 ? 1_555 113.5 ? 12 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 CD ? C CD . ? A CD 302 ? 1_555 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 99.1 ? 13 SG ? A CYS 75 ? A CYS 75 ? 1_555 CD ? C CD . ? A CD 302 ? 1_555 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 101.3 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 24 ? ASP A 29 ? GLU A 24 ASP A 29 AA1 2 GLN A 73 ? TYR A 78 ? GLN A 73 TYR A 78 AA1 3 VAL A 58 ? LYS A 64 ? VAL A 58 LYS A 64 AA2 1 PHE A 103 ? GLN A 109 ? PHE A 103 GLN A 109 AA2 2 ILE A 142 ? ASP A 148 ? ILE A 142 ASP A 148 AA2 3 VAL A 132 ? VAL A 137 ? VAL A 132 VAL A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 24 ? N GLU A 24 O TYR A 78 ? O TYR A 78 AA1 2 3 O CYS A 75 ? O CYS A 75 N HIS A 62 ? N HIS A 62 AA2 1 2 N TRP A 108 ? N TRP A 108 O ALA A 143 ? O ALA A 143 AA2 2 3 O GLU A 146 ? O GLU A 146 N ILE A 133 ? N ILE A 133 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CD 301 ? 4 'binding site for residue CD A 301' AC2 Software A CD 302 ? 4 'binding site for residue CD A 302' AC3 Software A TCE 303 ? 7 'binding site for residue TCE A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 42 ? ASP A 42 . ? 1_555 ? 2 AC1 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 3 AC1 4 HIS A 105 ? HIS A 105 . ? 1_555 ? 4 AC1 4 GLU A 146 ? GLU A 146 . ? 1_555 ? 5 AC2 4 HIS A 62 ? HIS A 62 . ? 1_555 ? 6 AC2 4 CYS A 75 ? CYS A 75 . ? 1_555 ? 7 AC2 4 HIS A 77 ? HIS A 77 . ? 1_555 ? 8 AC2 4 TCE D . ? TCE A 303 . ? 1_555 ? 9 AC3 7 LYS A 25 ? LYS A 25 . ? 1_555 ? 10 AC3 7 ARG A 27 ? ARG A 27 . ? 1_555 ? 11 AC3 7 GLU A 46 ? GLU A 46 . ? 3_565 ? 12 AC3 7 HIS A 62 ? HIS A 62 . ? 1_555 ? 13 AC3 7 LYS A 64 ? LYS A 64 . ? 1_555 ? 14 AC3 7 HIS A 77 ? HIS A 77 . ? 1_555 ? 15 AC3 7 CD C . ? CD A 302 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 140 ? ? 83.63 1.82 2 1 ARG A 164 ? ? -93.46 -78.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A TRP 4 ? A TRP 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A PHE 9 ? A PHE 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A GLU 14 ? A GLU 14 15 1 Y 1 A ASN 15 ? A ASN 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A TYR 17 ? A TYR 17 18 1 Y 1 A PHE 18 ? A PHE 18 19 1 Y 1 A GLN 19 ? A GLN 19 20 1 Y 1 A SER 20 ? A SER 20 21 1 Y 1 A PRO 168 ? A PRO 168 22 1 Y 1 A VAL 169 ? A VAL 169 23 1 Y 1 A GLU 170 ? A GLU 170 24 1 Y 1 A ILE 171 ? A ILE 171 25 1 Y 1 A GLY 172 ? A GLY 172 26 1 Y 1 A ALA 173 ? A ALA 173 27 1 Y 1 A ARG 174 ? A ARG 174 28 1 Y 1 A LYS 175 ? A LYS 175 29 1 Y 1 A SER 176 ? A SER 176 30 1 Y 1 A GLY 177 ? A GLY 177 31 1 Y 1 A HIS 178 ? A HIS 178 32 1 Y 1 A ALA 179 ? A ALA 179 33 1 Y 1 A ASP 180 ? A ASP 180 34 1 Y 1 A HIS 181 ? A HIS 181 35 1 Y 1 A GLU 182 ? A GLU 182 36 1 Y 1 A HIS 183 ? A HIS 183 37 1 Y 1 A ARG 184 ? A ARG 184 38 1 Y 1 A GLU 185 ? A GLU 185 39 1 Y 1 A GLY 186 ? A GLY 186 40 1 Y 1 A VAL 187 ? A VAL 187 41 1 Y 1 A LYS 188 ? A LYS 188 42 1 Y 1 A ASP 189 ? A ASP 189 43 1 Y 1 A HIS 190 ? A HIS 190 44 1 Y 1 A ALA 191 ? A ALA 191 45 1 Y 1 A HIS 192 ? A HIS 192 46 1 Y 1 A GLY 193 ? A GLY 193 47 1 Y 1 A GLU 194 ? A GLU 194 48 1 Y 1 A GLY 195 ? A GLY 195 49 1 Y 1 A GLU 196 ? A GLU 196 50 1 Y 1 A GLY 197 ? A GLY 197 51 1 Y 1 A HIS 198 ? A HIS 198 52 1 Y 1 A GLU 199 ? A GLU 199 53 1 Y 1 A ALA 200 ? A ALA 200 54 1 Y 1 A HIS 201 ? A HIS 201 55 1 Y 1 A ALA 202 ? A ALA 202 56 1 Y 1 A HIS 203 ? A HIS 203 57 1 Y 1 A GLY 204 ? A GLY 204 58 1 Y 1 A SER 205 ? A SER 205 59 1 Y 1 A VAL 206 ? A VAL 206 60 1 Y 1 A PHE 207 ? A PHE 207 61 1 Y 1 A GLY 208 ? A GLY 208 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CD CD CD N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 TCE O16 O N N 305 TCE C14 C N N 306 TCE O15 O N N 307 TCE C5 C N N 308 TCE C2 C N N 309 TCE P P N N 310 TCE C3 C N N 311 TCE C6 C N N 312 TCE C8 C N N 313 TCE O10 O N N 314 TCE O9 O N N 315 TCE C1 C N N 316 TCE C4 C N N 317 TCE C11 C N N 318 TCE O12 O N N 319 TCE O13 O N N 320 TCE HO15 H N N 321 TCE H5 H N N 322 TCE H5A H N N 323 TCE H2 H N N 324 TCE H2A H N N 325 TCE H3 H N N 326 TCE H3A H N N 327 TCE H6 H N N 328 TCE H6A H N N 329 TCE HO9 H N N 330 TCE H1 H N N 331 TCE H1A H N N 332 TCE H4 H N N 333 TCE H4A H N N 334 TCE HO12 H N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TRP N N N N 353 TRP CA C N S 354 TRP C C N N 355 TRP O O N N 356 TRP CB C N N 357 TRP CG C Y N 358 TRP CD1 C Y N 359 TRP CD2 C Y N 360 TRP NE1 N Y N 361 TRP CE2 C Y N 362 TRP CE3 C Y N 363 TRP CZ2 C Y N 364 TRP CZ3 C Y N 365 TRP CH2 C Y N 366 TRP OXT O N N 367 TRP H H N N 368 TRP H2 H N N 369 TRP HA H N N 370 TRP HB2 H N N 371 TRP HB3 H N N 372 TRP HD1 H N N 373 TRP HE1 H N N 374 TRP HE3 H N N 375 TRP HZ2 H N N 376 TRP HZ3 H N N 377 TRP HH2 H N N 378 TRP HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 TCE O16 C14 doub N N 290 TCE C14 O15 sing N N 291 TCE C14 C5 sing N N 292 TCE O15 HO15 sing N N 293 TCE C2 C5 sing N N 294 TCE C5 H5 sing N N 295 TCE C5 H5A sing N N 296 TCE C2 P sing N N 297 TCE C2 H2 sing N N 298 TCE C2 H2A sing N N 299 TCE C1 P sing N N 300 TCE P C3 sing N N 301 TCE C3 C6 sing N N 302 TCE C3 H3 sing N N 303 TCE C3 H3A sing N N 304 TCE C6 C8 sing N N 305 TCE C6 H6 sing N N 306 TCE C6 H6A sing N N 307 TCE O10 C8 doub N N 308 TCE C8 O9 sing N N 309 TCE O9 HO9 sing N N 310 TCE C4 C1 sing N N 311 TCE C1 H1 sing N N 312 TCE C1 H1A sing N N 313 TCE C11 C4 sing N N 314 TCE C4 H4 sing N N 315 TCE C4 H4A sing N N 316 TCE O13 C11 doub N N 317 TCE O12 C11 sing N N 318 TCE O12 HO12 sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _atom_sites.entry_id 4U9R _atom_sites.fract_transf_matrix[1][1] 0.017194 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017194 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013887 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CD N O P S # loop_