data_4V3I # _entry.id 4V3I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4V3I PDBE EBI-62053 WWPDB D_1290062053 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4V3I _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-10-19 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jeong, J.H.' 1 'Kim, Y.G.' 2 # _citation.id primary _citation.title 'Crystal structure of the bacterial type VI secretion system component TssL from Vibrio cholerae.' _citation.journal_abbrev 'J. Microbiol.' _citation.journal_volume 53 _citation.page_first 32 _citation.page_last 37 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country KR _citation.journal_id_ISSN 1976-3794 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25471186 _citation.pdbx_database_id_DOI 10.1007/s12275-015-4539-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chang, J.H.' 1 primary 'Kim, Y.G.' 2 # _cell.entry_id 4V3I _cell.length_a 78.361 _cell.length_b 78.361 _cell.length_c 49.456 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4V3I _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man VCA0115 29711.797 1 ? ? ? ? 2 polymer man VCA0115 601.673 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 67 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTIEEIKAIEIEL TEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCL ILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRAKYTLSRQMPVWSVFAGFIVLWVGLFLGYSY VLHSKSSDVLNQLNQIL ; ;MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTIEEIKAIEIEL TEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCL ILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRAKYTLSRQMPVWSVFAGFIVLWVGLFLGYSY VLHSKSSDVLNQLNQIL ; A ? 2 'polypeptide(L)' no no DLTRP DLTRP B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 SER n 1 5 LYS n 1 6 LYS n 1 7 GLU n 1 8 THR n 1 9 PRO n 1 10 LEU n 1 11 ALA n 1 12 SER n 1 13 LEU n 1 14 LEU n 1 15 PHE n 1 16 ASP n 1 17 ASP n 1 18 VAL n 1 19 GLU n 1 20 LYS n 1 21 ILE n 1 22 ASN n 1 23 HIS n 1 24 ASP n 1 25 GLN n 1 26 ASP n 1 27 TYR n 1 28 TRP n 1 29 PHE n 1 30 GLN n 1 31 LEU n 1 32 ARG n 1 33 GLY n 1 34 ASP n 1 35 ASN n 1 36 PRO n 1 37 ASN n 1 38 VAL n 1 39 LEU n 1 40 ILE n 1 41 ASP n 1 42 ALA n 1 43 ALA n 1 44 THR n 1 45 PRO n 1 46 LEU n 1 47 PHE n 1 48 GLY n 1 49 LEU n 1 50 SER n 1 51 LEU n 1 52 ARG n 1 53 VAL n 1 54 ARG n 1 55 THR n 1 56 LEU n 1 57 THR n 1 58 GLU n 1 59 CYS n 1 60 ASP n 1 61 ASN n 1 62 ILE n 1 63 GLU n 1 64 GLN n 1 65 ILE n 1 66 TYR n 1 67 ARG n 1 68 GLN n 1 69 THR n 1 70 ILE n 1 71 GLU n 1 72 GLU n 1 73 ILE n 1 74 LYS n 1 75 ALA n 1 76 ILE n 1 77 GLU n 1 78 ILE n 1 79 GLU n 1 80 LEU n 1 81 THR n 1 82 GLU n 1 83 GLN n 1 84 GLY n 1 85 TYR n 1 86 GLU n 1 87 HIS n 1 88 ALA n 1 89 ILE n 1 90 LEU n 1 91 MET n 1 92 ALA n 1 93 TYR n 1 94 ARG n 1 95 TYR n 1 96 ILE n 1 97 LEU n 1 98 CYS n 1 99 ALA n 1 100 PHE n 1 101 LEU n 1 102 ASP n 1 103 GLU n 1 104 SER n 1 105 VAL n 1 106 MET n 1 107 GLY n 1 108 THR n 1 109 GLU n 1 110 TRP n 1 111 GLY n 1 112 ALA n 1 113 SER n 1 114 SER n 1 115 LEU n 1 116 TRP n 1 117 ALA n 1 118 GLU n 1 119 HIS n 1 120 SER n 1 121 MET n 1 122 LEU n 1 123 SER n 1 124 ARG n 1 125 PHE n 1 126 HIS n 1 127 ASN n 1 128 GLU n 1 129 THR n 1 130 TRP n 1 131 GLY n 1 132 GLY n 1 133 GLU n 1 134 LYS n 1 135 VAL n 1 136 PHE n 1 137 THR n 1 138 ILE n 1 139 LEU n 1 140 SER n 1 141 ARG n 1 142 LEU n 1 143 GLU n 1 144 GLY n 1 145 GLU n 1 146 PRO n 1 147 HIS n 1 148 ARG n 1 149 TYR n 1 150 GLN n 1 151 ALA n 1 152 LEU n 1 153 LEU n 1 154 ALA n 1 155 PHE n 1 156 ILE n 1 157 TYR n 1 158 HIS n 1 159 CYS n 1 160 LEU n 1 161 ILE n 1 162 LEU n 1 163 GLY n 1 164 PHE n 1 165 GLU n 1 166 GLY n 1 167 LYS n 1 168 TYR n 1 169 ARG n 1 170 VAL n 1 171 MET n 1 172 GLU n 1 173 GLY n 1 174 GLY n 1 175 GLN n 1 176 ALA n 1 177 GLU n 1 178 ARG n 1 179 GLU n 1 180 LYS n 1 181 VAL n 1 182 ILE n 1 183 SER n 1 184 ARG n 1 185 LEU n 1 186 HIS n 1 187 GLN n 1 188 LEU n 1 189 LEU n 1 190 SER n 1 191 SER n 1 192 LEU n 1 193 GLU n 1 194 GLU n 1 195 SER n 1 196 GLU n 1 197 PRO n 1 198 GLN n 1 199 ASP n 1 200 LEU n 1 201 THR n 1 202 ARG n 1 203 PRO n 1 204 THR n 1 205 ASP n 1 206 HIS n 1 207 VAL n 1 208 VAL n 1 209 ARG n 1 210 ALA n 1 211 LYS n 1 212 TYR n 1 213 THR n 1 214 LEU n 1 215 SER n 1 216 ARG n 1 217 GLN n 1 218 MET n 1 219 PRO n 1 220 VAL n 1 221 TRP n 1 222 SER n 1 223 VAL n 1 224 PHE n 1 225 ALA n 1 226 GLY n 1 227 PHE n 1 228 ILE n 1 229 VAL n 1 230 LEU n 1 231 TRP n 1 232 VAL n 1 233 GLY n 1 234 LEU n 1 235 PHE n 1 236 LEU n 1 237 GLY n 1 238 TYR n 1 239 SER n 1 240 TYR n 1 241 VAL n 1 242 LEU n 1 243 HIS n 1 244 SER n 1 245 LYS n 1 246 SER n 1 247 SER n 1 248 ASP n 1 249 VAL n 1 250 LEU n 1 251 ASN n 1 252 GLN n 1 253 LEU n 1 254 ASN n 1 255 GLN n 1 256 ILE n 1 257 LEU n 2 1 ASP n 2 2 LEU n 2 3 THR n 2 4 ARG n 2 5 PRO n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'VIBRIO CHOLERAE' 666 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET30A ? ? 2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'VIBRIO CHOLERAE' 666 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET30A ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP Q9KN50_VIBCH 1 ? ? Q9KN50 ? 2 UNP Q9KN50_VIBCH 2 ? ? Q9KN50 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4V3I A 1 ? 257 ? Q9KN50 1 ? 257 ? 1 257 2 2 4V3I B 1 ? 5 ? Q9KN50 199 ? 203 ? 199 203 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4V3I _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_percent_sol 52.3 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.4 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.8 M SODIUM CHLORIDE, 0.1 M SODIUM POTASSIUM PHOSPHATE PH 6.4' # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2013-06-04 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE CRYSTAL MONOCHROMATER' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_wavelength 0.9795 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4V3I _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.50 _reflns.number_obs 27803 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 59.00 _reflns.B_iso_Wilson_estimate 14.82 _reflns.pdbx_redundancy 11.0 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.53 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.34 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.63 _reflns_shell.pdbx_redundancy 8.5 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4V3I _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 27800 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.58 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.979 _refine.ls_d_res_high 1.499 _refine.ls_percent_reflns_obs 99.75 _refine.ls_R_factor_obs 0.1804 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1793 _refine.ls_R_factor_R_free 0.1939 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.2 _refine.ls_number_reflns_R_free 2012 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 3U66' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.12 _refine.pdbx_overall_phase_error 19.30 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1281 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 1354 _refine_hist.d_res_high 1.499 _refine_hist.d_res_low 27.979 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 1312 'X-RAY DIFFRACTION' ? f_angle_d 1.191 ? ? 1769 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.623 ? ? 482 'X-RAY DIFFRACTION' ? f_chiral_restr 0.049 ? ? 194 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 224 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.4990 1.5365 1839 0.2327 100.00 0.2471 . . 145 . . 'X-RAY DIFFRACTION' . 1.5365 1.5780 1824 0.2055 100.00 0.2160 . . 142 . . 'X-RAY DIFFRACTION' . 1.5780 1.6245 1844 0.1951 100.00 0.2379 . . 135 . . 'X-RAY DIFFRACTION' . 1.6245 1.6769 1844 0.1786 100.00 0.2234 . . 142 . . 'X-RAY DIFFRACTION' . 1.6769 1.7368 1819 0.1750 100.00 0.1831 . . 146 . . 'X-RAY DIFFRACTION' . 1.7368 1.8063 1855 0.1709 100.00 0.1763 . . 144 . . 'X-RAY DIFFRACTION' . 1.8063 1.8885 1829 0.1748 100.00 0.2115 . . 143 . . 'X-RAY DIFFRACTION' . 1.8885 1.9881 1809 0.1788 100.00 0.2178 . . 147 . . 'X-RAY DIFFRACTION' . 1.9881 2.1126 1857 0.1652 100.00 0.2097 . . 142 . . 'X-RAY DIFFRACTION' . 2.1126 2.2756 1842 0.1688 100.00 0.1780 . . 145 . . 'X-RAY DIFFRACTION' . 2.2756 2.5045 1857 0.1795 100.00 0.1922 . . 144 . . 'X-RAY DIFFRACTION' . 2.5045 2.8666 1860 0.1852 100.00 0.1946 . . 141 . . 'X-RAY DIFFRACTION' . 2.8666 3.6104 1857 0.1788 100.00 0.1782 . . 148 . . 'X-RAY DIFFRACTION' . 3.6104 27.9841 1852 0.1762 97.00 0.1856 . . 148 . . # _struct.entry_id 4V3I _struct.title 'Crystal Structure of TssL from Vibrio cholerae.' _struct.pdbx_descriptor VCA0115 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4V3I _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'UNKNOWN FUNCTION, T6SS, VIBRIO CHOLERAE, TSSL, VCA0115' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 37 ? VAL A 53 ? ASN A 37 VAL A 53 1 ? 17 HELX_P HELX_P2 2 ASN A 61 ? GLN A 83 ? ASN A 61 GLN A 83 1 ? 23 HELX_P HELX_P3 3 GLU A 86 ? GLY A 107 ? GLU A 86 GLY A 107 1 ? 22 HELX_P HELX_P4 4 SER A 114 ? HIS A 119 ? SER A 114 HIS A 119 1 ? 6 HELX_P HELX_P5 5 SER A 120 ? ASN A 127 ? SER A 120 ASN A 127 1 ? 8 HELX_P HELX_P6 6 GLU A 133 ? GLU A 145 ? GLU A 133 GLU A 145 1 ? 13 HELX_P HELX_P7 7 TYR A 149 ? LEU A 162 ? TYR A 149 LEU A 162 1 ? 14 HELX_P HELX_P8 8 GLU A 165 ? VAL A 170 ? GLU A 165 VAL A 170 5 ? 6 HELX_P HELX_P9 9 GLY A 173 ? LEU A 192 ? GLY A 173 LEU A 192 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE GOL A 1194' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 74 ? LYS A 74 . ? 1_555 ? 2 AC1 4 ARG A 94 ? ARG A 94 . ? 1_555 ? 3 AC1 4 PHE A 125 ? PHE A 125 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 2065 . ? 1_555 ? # _database_PDB_matrix.entry_id 4V3I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4V3I _atom_sites.fract_transf_matrix[1][1] 0.012761 _atom_sites.fract_transf_matrix[1][2] 0.007368 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014736 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020220 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 LEU 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 PHE 15 15 ? ? ? A . n A 1 16 ASP 16 16 ? ? ? A . n A 1 17 ASP 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 LYS 20 20 ? ? ? A . n A 1 21 ILE 21 21 ? ? ? A . n A 1 22 ASN 22 22 ? ? ? A . n A 1 23 HIS 23 23 ? ? ? A . n A 1 24 ASP 24 24 ? ? ? A . n A 1 25 GLN 25 25 ? ? ? A . n A 1 26 ASP 26 26 ? ? ? A . n A 1 27 TYR 27 27 ? ? ? A . n A 1 28 TRP 28 28 ? ? ? A . n A 1 29 PHE 29 29 ? ? ? A . n A 1 30 GLN 30 30 ? ? ? A . n A 1 31 LEU 31 31 ? ? ? A . n A 1 32 ARG 32 32 ? ? ? A . n A 1 33 GLY 33 33 ? ? ? A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ARG 54 54 ? ? ? A . n A 1 55 THR 55 55 ? ? ? A . n A 1 56 LEU 56 56 ? ? ? A . n A 1 57 THR 57 57 ? ? ? A . n A 1 58 GLU 58 58 ? ? ? A . n A 1 59 CYS 59 59 ? ? ? A . n A 1 60 ASP 60 60 ? ? ? A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 TRP 116 116 116 TRP TRP A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 HIS 158 158 158 HIS HIS A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLU 194 194 ? ? ? A . n A 1 195 SER 195 195 ? ? ? A . n A 1 196 GLU 196 196 ? ? ? A . n A 1 197 PRO 197 197 ? ? ? A . n A 1 198 GLN 198 198 ? ? ? A . n A 1 199 ASP 199 199 ? ? ? A . n A 1 200 LEU 200 200 ? ? ? A . n A 1 201 THR 201 201 ? ? ? A . n A 1 202 ARG 202 202 ? ? ? A . n A 1 203 PRO 203 203 ? ? ? A . n A 1 204 THR 204 204 ? ? ? A . n A 1 205 ASP 205 205 ? ? ? A . n A 1 206 HIS 206 206 ? ? ? A . n A 1 207 VAL 207 207 ? ? ? A . n A 1 208 VAL 208 208 ? ? ? A . n A 1 209 ARG 209 209 ? ? ? A . n A 1 210 ALA 210 210 ? ? ? A . n A 1 211 LYS 211 211 ? ? ? A . n A 1 212 TYR 212 212 ? ? ? A . n A 1 213 THR 213 213 ? ? ? A . n A 1 214 LEU 214 214 ? ? ? A . n A 1 215 SER 215 215 ? ? ? A . n A 1 216 ARG 216 216 ? ? ? A . n A 1 217 GLN 217 217 ? ? ? A . n A 1 218 MET 218 218 ? ? ? A . n A 1 219 PRO 219 219 ? ? ? A . n A 1 220 VAL 220 220 ? ? ? A . n A 1 221 TRP 221 221 ? ? ? A . n A 1 222 SER 222 222 ? ? ? A . n A 1 223 VAL 223 223 ? ? ? A . n A 1 224 PHE 224 224 ? ? ? A . n A 1 225 ALA 225 225 ? ? ? A . n A 1 226 GLY 226 226 ? ? ? A . n A 1 227 PHE 227 227 ? ? ? A . n A 1 228 ILE 228 228 ? ? ? A . n A 1 229 VAL 229 229 ? ? ? A . n A 1 230 LEU 230 230 ? ? ? A . n A 1 231 TRP 231 231 ? ? ? A . n A 1 232 VAL 232 232 ? ? ? A . n A 1 233 GLY 233 233 ? ? ? A . n A 1 234 LEU 234 234 ? ? ? A . n A 1 235 PHE 235 235 ? ? ? A . n A 1 236 LEU 236 236 ? ? ? A . n A 1 237 GLY 237 237 ? ? ? A . n A 1 238 TYR 238 238 ? ? ? A . n A 1 239 SER 239 239 ? ? ? A . n A 1 240 TYR 240 240 ? ? ? A . n A 1 241 VAL 241 241 ? ? ? A . n A 1 242 LEU 242 242 ? ? ? A . n A 1 243 HIS 243 243 ? ? ? A . n A 1 244 SER 244 244 ? ? ? A . n A 1 245 LYS 245 245 ? ? ? A . n A 1 246 SER 246 246 ? ? ? A . n A 1 247 SER 247 247 ? ? ? A . n A 1 248 ASP 248 248 ? ? ? A . n A 1 249 VAL 249 249 ? ? ? A . n A 1 250 LEU 250 250 ? ? ? A . n A 1 251 ASN 251 251 ? ? ? A . n A 1 252 GLN 252 252 ? ? ? A . n A 1 253 LEU 253 253 ? ? ? A . n A 1 254 ASN 254 254 ? ? ? A . n A 1 255 GLN 255 255 ? ? ? A . n A 1 256 ILE 256 256 ? ? ? A . n A 1 257 LEU 257 257 ? ? ? A . n B 2 1 ASP 1 199 199 ASP ASP B . n B 2 2 LEU 2 200 200 LEU LEU B . n B 2 3 THR 3 201 201 THR THR B . n B 2 4 ARG 4 202 202 ARG ARG B . n B 2 5 PRO 5 203 203 PRO PRO B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 1194 1194 GOL GOL A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . E 4 HOH 1 2001 2001 HOH HOH B . E 4 HOH 2 2002 2002 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 820 ? 1 MORE -3.6 ? 1 'SSA (A^2)' 8510 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-12-17 2 'Structure model' 1 1 2015-01-21 3 'Structure model' 1 2 2017-05-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 4.8855 _pdbx_refine_tls.origin_y 27.9566 _pdbx_refine_tls.origin_z -2.3660 _pdbx_refine_tls.T[1][1] 0.0725 _pdbx_refine_tls.T[2][2] 0.0809 _pdbx_refine_tls.T[3][3] 0.1153 _pdbx_refine_tls.T[1][2] -0.0092 _pdbx_refine_tls.T[1][3] 0.0295 _pdbx_refine_tls.T[2][3] 0.0073 _pdbx_refine_tls.L[1][1] 2.5907 _pdbx_refine_tls.L[2][2] 2.0716 _pdbx_refine_tls.L[3][3] 1.2541 _pdbx_refine_tls.L[1][2] -0.7914 _pdbx_refine_tls.L[1][3] -0.1423 _pdbx_refine_tls.L[2][3] 0.4406 _pdbx_refine_tls.S[1][1] -0.0190 _pdbx_refine_tls.S[1][2] -0.0243 _pdbx_refine_tls.S[1][3] -0.1254 _pdbx_refine_tls.S[2][1] 0.0048 _pdbx_refine_tls.S[2][2] 0.0396 _pdbx_refine_tls.S[2][3] -0.0263 _pdbx_refine_tls.S[3][1] 0.0662 _pdbx_refine_tls.S[3][2] 0.0990 _pdbx_refine_tls.S[3][3] -0.0149 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ALL # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 PHASER phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 2026 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2027 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id TRP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 130 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -122.95 _pdbx_validate_torsion.psi -67.60 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2014 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.81 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A LEU 10 ? A LEU 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A PHE 15 ? A PHE 15 16 1 Y 1 A ASP 16 ? A ASP 16 17 1 Y 1 A ASP 17 ? A ASP 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A GLU 19 ? A GLU 19 20 1 Y 1 A LYS 20 ? A LYS 20 21 1 Y 1 A ILE 21 ? A ILE 21 22 1 Y 1 A ASN 22 ? A ASN 22 23 1 Y 1 A HIS 23 ? A HIS 23 24 1 Y 1 A ASP 24 ? A ASP 24 25 1 Y 1 A GLN 25 ? A GLN 25 26 1 Y 1 A ASP 26 ? A ASP 26 27 1 Y 1 A TYR 27 ? A TYR 27 28 1 Y 1 A TRP 28 ? A TRP 28 29 1 Y 1 A PHE 29 ? A PHE 29 30 1 Y 1 A GLN 30 ? A GLN 30 31 1 Y 1 A LEU 31 ? A LEU 31 32 1 Y 1 A ARG 32 ? A ARG 32 33 1 Y 1 A GLY 33 ? A GLY 33 34 1 Y 1 A ARG 54 ? A ARG 54 35 1 Y 1 A THR 55 ? A THR 55 36 1 Y 1 A LEU 56 ? A LEU 56 37 1 Y 1 A THR 57 ? A THR 57 38 1 Y 1 A GLU 58 ? A GLU 58 39 1 Y 1 A CYS 59 ? A CYS 59 40 1 Y 1 A ASP 60 ? A ASP 60 41 1 Y 1 A GLU 194 ? A GLU 194 42 1 Y 1 A SER 195 ? A SER 195 43 1 Y 1 A GLU 196 ? A GLU 196 44 1 Y 1 A PRO 197 ? A PRO 197 45 1 Y 1 A GLN 198 ? A GLN 198 46 1 Y 1 A ASP 199 ? A ASP 199 47 1 Y 1 A LEU 200 ? A LEU 200 48 1 Y 1 A THR 201 ? A THR 201 49 1 Y 1 A ARG 202 ? A ARG 202 50 1 Y 1 A PRO 203 ? A PRO 203 51 1 Y 1 A THR 204 ? A THR 204 52 1 Y 1 A ASP 205 ? A ASP 205 53 1 Y 1 A HIS 206 ? A HIS 206 54 1 Y 1 A VAL 207 ? A VAL 207 55 1 Y 1 A VAL 208 ? A VAL 208 56 1 Y 1 A ARG 209 ? A ARG 209 57 1 Y 1 A ALA 210 ? A ALA 210 58 1 Y 1 A LYS 211 ? A LYS 211 59 1 Y 1 A TYR 212 ? A TYR 212 60 1 Y 1 A THR 213 ? A THR 213 61 1 Y 1 A LEU 214 ? A LEU 214 62 1 Y 1 A SER 215 ? A SER 215 63 1 Y 1 A ARG 216 ? A ARG 216 64 1 Y 1 A GLN 217 ? A GLN 217 65 1 Y 1 A MET 218 ? A MET 218 66 1 Y 1 A PRO 219 ? A PRO 219 67 1 Y 1 A VAL 220 ? A VAL 220 68 1 Y 1 A TRP 221 ? A TRP 221 69 1 Y 1 A SER 222 ? A SER 222 70 1 Y 1 A VAL 223 ? A VAL 223 71 1 Y 1 A PHE 224 ? A PHE 224 72 1 Y 1 A ALA 225 ? A ALA 225 73 1 Y 1 A GLY 226 ? A GLY 226 74 1 Y 1 A PHE 227 ? A PHE 227 75 1 Y 1 A ILE 228 ? A ILE 228 76 1 Y 1 A VAL 229 ? A VAL 229 77 1 Y 1 A LEU 230 ? A LEU 230 78 1 Y 1 A TRP 231 ? A TRP 231 79 1 Y 1 A VAL 232 ? A VAL 232 80 1 Y 1 A GLY 233 ? A GLY 233 81 1 Y 1 A LEU 234 ? A LEU 234 82 1 Y 1 A PHE 235 ? A PHE 235 83 1 Y 1 A LEU 236 ? A LEU 236 84 1 Y 1 A GLY 237 ? A GLY 237 85 1 Y 1 A TYR 238 ? A TYR 238 86 1 Y 1 A SER 239 ? A SER 239 87 1 Y 1 A TYR 240 ? A TYR 240 88 1 Y 1 A VAL 241 ? A VAL 241 89 1 Y 1 A LEU 242 ? A LEU 242 90 1 Y 1 A HIS 243 ? A HIS 243 91 1 Y 1 A SER 244 ? A SER 244 92 1 Y 1 A LYS 245 ? A LYS 245 93 1 Y 1 A SER 246 ? A SER 246 94 1 Y 1 A SER 247 ? A SER 247 95 1 Y 1 A ASP 248 ? A ASP 248 96 1 Y 1 A VAL 249 ? A VAL 249 97 1 Y 1 A LEU 250 ? A LEU 250 98 1 Y 1 A ASN 251 ? A ASN 251 99 1 Y 1 A GLN 252 ? A GLN 252 100 1 Y 1 A LEU 253 ? A LEU 253 101 1 Y 1 A ASN 254 ? A ASN 254 102 1 Y 1 A GLN 255 ? A GLN 255 103 1 Y 1 A ILE 256 ? A ILE 256 104 1 Y 1 A LEU 257 ? A LEU 257 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 water HOH #