data_4WMK # _entry.id 4WMK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4WMK pdb_00004wmk 10.2210/pdb4wmk/pdb WWPDB D_1000204075 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-30 2 'Structure model' 1 1 2016-04-20 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2023-12-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Non-polymer description' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' atom_site 2 3 'Structure model' chem_comp 3 3 'Structure model' entity 4 3 'Structure model' pdbx_branch_scheme 5 3 'Structure model' pdbx_chem_comp_identifier 6 3 'Structure model' pdbx_entity_branch 7 3 'Structure model' pdbx_entity_branch_descriptor 8 3 'Structure model' pdbx_entity_branch_link 9 3 'Structure model' pdbx_entity_branch_list 10 3 'Structure model' pdbx_entity_nonpoly 11 3 'Structure model' pdbx_nonpoly_scheme 12 3 'Structure model' pdbx_struct_conn_angle 13 3 'Structure model' pdbx_struct_oper_list 14 3 'Structure model' struct_conn 15 3 'Structure model' struct_conn_type 16 3 'Structure model' struct_site 17 3 'Structure model' struct_site_gen 18 4 'Structure model' chem_comp 19 4 'Structure model' chem_comp_atom 20 4 'Structure model' chem_comp_bond 21 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_atom_site.B_iso_or_equiv' 2 3 'Structure model' '_atom_site.Cartn_x' 3 3 'Structure model' '_atom_site.Cartn_y' 4 3 'Structure model' '_atom_site.Cartn_z' 5 3 'Structure model' '_atom_site.auth_asym_id' 6 3 'Structure model' '_atom_site.auth_atom_id' 7 3 'Structure model' '_atom_site.auth_comp_id' 8 3 'Structure model' '_atom_site.auth_seq_id' 9 3 'Structure model' '_atom_site.label_asym_id' 10 3 'Structure model' '_atom_site.label_atom_id' 11 3 'Structure model' '_atom_site.label_comp_id' 12 3 'Structure model' '_atom_site.label_entity_id' 13 3 'Structure model' '_atom_site.type_symbol' 14 3 'Structure model' '_chem_comp.formula' 15 3 'Structure model' '_chem_comp.formula_weight' 16 3 'Structure model' '_chem_comp.id' 17 3 'Structure model' '_chem_comp.mon_nstd_flag' 18 3 'Structure model' '_chem_comp.name' 19 3 'Structure model' '_chem_comp.type' 20 3 'Structure model' '_entity.formula_weight' 21 3 'Structure model' '_entity.pdbx_description' 22 3 'Structure model' '_entity.src_method' 23 3 'Structure model' '_entity.type' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 27 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 28 3 'Structure model' '_struct_conn_type.id' 29 4 'Structure model' '_chem_comp.pdbx_synonyms' 30 4 'Structure model' '_database_2.pdbx_DOI' 31 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4WMK _pdbx_database_status.recvd_initial_deposition_date 2014-10-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 4WLG unspecified PDB . 4WLM unspecified PDB . 4WLZ unspecified PDB . 4WM0 unspecified PDB . 4WMA unspecified PDB . 4WMB unspecified PDB . 4WMI unspecified PDB . 4WN2 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yu, H.' 1 'Li, H.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 847 _citation.page_last 854 _citation.title 'Notch-modifying xylosyltransferase structures support an SNi-like retaining mechanism.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nchembio.1927 _citation.pdbx_database_id_PubMed 26414444 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, H.' 1 ? primary 'Takeuchi, M.' 2 ? primary 'LeBarron, J.' 3 ? primary 'Kantharia, J.' 4 ? primary 'London, E.' 5 ? primary 'Bakker, H.' 6 ? primary 'Haltiwanger, R.S.' 7 ? primary 'Li, H.' 8 ? primary 'Takeuchi, H.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Xyloside xylosyltransferase 1' 35295.500 1 2.4.2.- ? 'unp residues 87-392' ? 2 polymer man 'Coagulation factor IX' 5710.229 1 3.4.21.22 ? 'unp residues 92-130' ? 3 branched man 'alpha-D-xylopyranose-(1-3)-alpha-D-xylopyranose-(1-3)-beta-D-glucopyranose' 444.386 1 ? ? ? ? 4 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 5 non-polymer syn "URIDINE-5'-DIPHOSPHATE" 404.161 1 ? ? ? ? 6 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 7 water nat water 18.015 86 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase' 2 'Christmas factor,Plasma thromboplastin component,PTC' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SLEGGVVVPVDYHLLMMFTKAEHNAPLQAKARVALSSLLRLAKFEAHEVLNLHFVSEEASREVAKALLRELLPPAAGFKC KVIFHDVAVLTDKLFPVVEAMQKYFSAGSGTYYSDSIFFLSVAMHQIMPKEIPRIIQLDLDLKYKTNIRELFEEFDNFLP GAVIGIAREMQPVYRHTFWQFRHENPKTRVGDPPPEGLPGFNSGVMLLNLEAMRQSPLYSHLLEPSWVQQLADKYHFRGH LGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWRDHGYSDVFQAYFRCEGHVKIYHGNCNTPIPED ; ;SLEGGVVVPVDYHLLMMFTKAEHNAPLQAKARVALSSLLRLAKFEAHEVLNLHFVSEEASREVAKALLRELLPPAAGFKC KVIFHDVAVLTDKLFPVVEAMQKYFSAGSGTYYSDSIFFLSVAMHQIMPKEIPRIIQLDLDLKYKTNIRELFEEFDNFLP GAVIGIAREMQPVYRHTFWQFRHENPKTRVGDPPPEGLPGFNSGVMLLNLEAMRQSPLYSHLLEPSWVQQLADKYHFRGH LGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWRDHGYSDVFQAYFRCEGHVKIYHGNCNTPIPED ; A ? 2 'polypeptide(L)' no no MDIVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELLEHHHHHH MDIVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELLEHHHHHH D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'MANGANESE (II) ION' MN 5 "URIDINE-5'-DIPHOSPHATE" UDP 6 'SULFATE ION' SO4 7 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 GLU n 1 4 GLY n 1 5 GLY n 1 6 VAL n 1 7 VAL n 1 8 VAL n 1 9 PRO n 1 10 VAL n 1 11 ASP n 1 12 TYR n 1 13 HIS n 1 14 LEU n 1 15 LEU n 1 16 MET n 1 17 MET n 1 18 PHE n 1 19 THR n 1 20 LYS n 1 21 ALA n 1 22 GLU n 1 23 HIS n 1 24 ASN n 1 25 ALA n 1 26 PRO n 1 27 LEU n 1 28 GLN n 1 29 ALA n 1 30 LYS n 1 31 ALA n 1 32 ARG n 1 33 VAL n 1 34 ALA n 1 35 LEU n 1 36 SER n 1 37 SER n 1 38 LEU n 1 39 LEU n 1 40 ARG n 1 41 LEU n 1 42 ALA n 1 43 LYS n 1 44 PHE n 1 45 GLU n 1 46 ALA n 1 47 HIS n 1 48 GLU n 1 49 VAL n 1 50 LEU n 1 51 ASN n 1 52 LEU n 1 53 HIS n 1 54 PHE n 1 55 VAL n 1 56 SER n 1 57 GLU n 1 58 GLU n 1 59 ALA n 1 60 SER n 1 61 ARG n 1 62 GLU n 1 63 VAL n 1 64 ALA n 1 65 LYS n 1 66 ALA n 1 67 LEU n 1 68 LEU n 1 69 ARG n 1 70 GLU n 1 71 LEU n 1 72 LEU n 1 73 PRO n 1 74 PRO n 1 75 ALA n 1 76 ALA n 1 77 GLY n 1 78 PHE n 1 79 LYS n 1 80 CYS n 1 81 LYS n 1 82 VAL n 1 83 ILE n 1 84 PHE n 1 85 HIS n 1 86 ASP n 1 87 VAL n 1 88 ALA n 1 89 VAL n 1 90 LEU n 1 91 THR n 1 92 ASP n 1 93 LYS n 1 94 LEU n 1 95 PHE n 1 96 PRO n 1 97 VAL n 1 98 VAL n 1 99 GLU n 1 100 ALA n 1 101 MET n 1 102 GLN n 1 103 LYS n 1 104 TYR n 1 105 PHE n 1 106 SER n 1 107 ALA n 1 108 GLY n 1 109 SER n 1 110 GLY n 1 111 THR n 1 112 TYR n 1 113 TYR n 1 114 SER n 1 115 ASP n 1 116 SER n 1 117 ILE n 1 118 PHE n 1 119 PHE n 1 120 LEU n 1 121 SER n 1 122 VAL n 1 123 ALA n 1 124 MET n 1 125 HIS n 1 126 GLN n 1 127 ILE n 1 128 MET n 1 129 PRO n 1 130 LYS n 1 131 GLU n 1 132 ILE n 1 133 PRO n 1 134 ARG n 1 135 ILE n 1 136 ILE n 1 137 GLN n 1 138 LEU n 1 139 ASP n 1 140 LEU n 1 141 ASP n 1 142 LEU n 1 143 LYS n 1 144 TYR n 1 145 LYS n 1 146 THR n 1 147 ASN n 1 148 ILE n 1 149 ARG n 1 150 GLU n 1 151 LEU n 1 152 PHE n 1 153 GLU n 1 154 GLU n 1 155 PHE n 1 156 ASP n 1 157 ASN n 1 158 PHE n 1 159 LEU n 1 160 PRO n 1 161 GLY n 1 162 ALA n 1 163 VAL n 1 164 ILE n 1 165 GLY n 1 166 ILE n 1 167 ALA n 1 168 ARG n 1 169 GLU n 1 170 MET n 1 171 GLN n 1 172 PRO n 1 173 VAL n 1 174 TYR n 1 175 ARG n 1 176 HIS n 1 177 THR n 1 178 PHE n 1 179 TRP n 1 180 GLN n 1 181 PHE n 1 182 ARG n 1 183 HIS n 1 184 GLU n 1 185 ASN n 1 186 PRO n 1 187 LYS n 1 188 THR n 1 189 ARG n 1 190 VAL n 1 191 GLY n 1 192 ASP n 1 193 PRO n 1 194 PRO n 1 195 PRO n 1 196 GLU n 1 197 GLY n 1 198 LEU n 1 199 PRO n 1 200 GLY n 1 201 PHE n 1 202 ASN n 1 203 SER n 1 204 GLY n 1 205 VAL n 1 206 MET n 1 207 LEU n 1 208 LEU n 1 209 ASN n 1 210 LEU n 1 211 GLU n 1 212 ALA n 1 213 MET n 1 214 ARG n 1 215 GLN n 1 216 SER n 1 217 PRO n 1 218 LEU n 1 219 TYR n 1 220 SER n 1 221 HIS n 1 222 LEU n 1 223 LEU n 1 224 GLU n 1 225 PRO n 1 226 SER n 1 227 TRP n 1 228 VAL n 1 229 GLN n 1 230 GLN n 1 231 LEU n 1 232 ALA n 1 233 ASP n 1 234 LYS n 1 235 TYR n 1 236 HIS n 1 237 PHE n 1 238 ARG n 1 239 GLY n 1 240 HIS n 1 241 LEU n 1 242 GLY n 1 243 ASP n 1 244 GLN n 1 245 ASP n 1 246 PHE n 1 247 PHE n 1 248 THR n 1 249 MET n 1 250 ILE n 1 251 GLY n 1 252 MET n 1 253 GLU n 1 254 HIS n 1 255 PRO n 1 256 GLU n 1 257 LEU n 1 258 PHE n 1 259 HIS n 1 260 VAL n 1 261 LEU n 1 262 ASP n 1 263 CYS n 1 264 THR n 1 265 TRP n 1 266 ASN n 1 267 ARG n 1 268 GLN n 1 269 LEU n 1 270 CYS n 1 271 THR n 1 272 TRP n 1 273 TRP n 1 274 ARG n 1 275 ASP n 1 276 HIS n 1 277 GLY n 1 278 TYR n 1 279 SER n 1 280 ASP n 1 281 VAL n 1 282 PHE n 1 283 GLN n 1 284 ALA n 1 285 TYR n 1 286 PHE n 1 287 ARG n 1 288 CYS n 1 289 GLU n 1 290 GLY n 1 291 HIS n 1 292 VAL n 1 293 LYS n 1 294 ILE n 1 295 TYR n 1 296 HIS n 1 297 GLY n 1 298 ASN n 1 299 CYS n 1 300 ASN n 1 301 THR n 1 302 PRO n 1 303 ILE n 1 304 PRO n 1 305 GLU n 1 306 ASP n 2 1 MET n 2 2 ASP n 2 3 ILE n 2 4 VAL n 2 5 ASP n 2 6 GLY n 2 7 ASP n 2 8 GLN n 2 9 CYS n 2 10 GLU n 2 11 SER n 2 12 ASN n 2 13 PRO n 2 14 CYS n 2 15 LEU n 2 16 ASN n 2 17 GLY n 2 18 GLY n 2 19 SER n 2 20 CYS n 2 21 LYS n 2 22 ASP n 2 23 ASP n 2 24 ILE n 2 25 ASN n 2 26 SER n 2 27 TYR n 2 28 GLU n 2 29 CYS n 2 30 TRP n 2 31 CYS n 2 32 PRO n 2 33 PHE n 2 34 GLY n 2 35 PHE n 2 36 GLU n 2 37 GLY n 2 38 LYS n 2 39 ASN n 2 40 CYS n 2 41 GLU n 2 42 LEU n 2 43 LEU n 2 44 GLU n 2 45 HIS n 2 46 HIS n 2 47 HIS n 2 48 HIS n 2 49 HIS n 2 50 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 306 Mouse ? Xxylt1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 50 Human ? F9 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # _pdbx_entity_branch.entity_id 3 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 3 DXylpa1-3DXylpa1-3DGlcpb1- 'Glycam Condensed Sequence' GMML 1.0 2 3 'WURCS=2.0/2,3,2/[a2122h-1b_1-5][a212h-1a_1-5]/1-2-2/a3-b1_b3-c1' WURCS PDB2Glycan 1.1.0 3 3 '[]{[(3+1)][b-D-Glcp]{[(3+1)][a-D-Xylp]{[(3+1)][a-D-Xylp]{}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 3 2 XYS C1 O1 1 BGC O3 HO3 sing ? 2 3 3 XYS C1 O1 2 XYS O3 HO3 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose 'beta-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UDP 'RNA linking' . "URIDINE-5'-DIPHOSPHATE" ? 'C9 H14 N2 O12 P2' 404.161 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XYS 'D-saccharide, alpha linking' . alpha-D-xylopyranose 'alpha-D-xylose; D-xylose; xylose; XYLOPYRANOSE' 'C5 H10 O5' 150.130 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc XYS 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DXylpa XYS 'COMMON NAME' GMML 1.0 a-D-xylopyranose XYS 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Xylp XYS 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Xyl # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 87 ? ? ? A . n A 1 2 LEU 2 88 ? ? ? A . n A 1 3 GLU 3 89 ? ? ? A . n A 1 4 GLY 4 90 ? ? ? A . n A 1 5 GLY 5 91 ? ? ? A . n A 1 6 VAL 6 92 ? ? ? A . n A 1 7 VAL 7 93 93 VAL VAL A . n A 1 8 VAL 8 94 94 VAL VAL A . n A 1 9 PRO 9 95 95 PRO PRO A . n A 1 10 VAL 10 96 96 VAL VAL A . n A 1 11 ASP 11 97 97 ASP ASP A . n A 1 12 TYR 12 98 98 TYR TYR A . n A 1 13 HIS 13 99 99 HIS HIS A . n A 1 14 LEU 14 100 100 LEU LEU A . n A 1 15 LEU 15 101 101 LEU LEU A . n A 1 16 MET 16 102 102 MET MET A . n A 1 17 MET 17 103 103 MET MET A . n A 1 18 PHE 18 104 104 PHE PHE A . n A 1 19 THR 19 105 105 THR THR A . n A 1 20 LYS 20 106 106 LYS LYS A . n A 1 21 ALA 21 107 107 ALA ALA A . n A 1 22 GLU 22 108 108 GLU GLU A . n A 1 23 HIS 23 109 109 HIS HIS A . n A 1 24 ASN 24 110 110 ASN ASN A . n A 1 25 ALA 25 111 111 ALA ALA A . n A 1 26 PRO 26 112 112 PRO PRO A . n A 1 27 LEU 27 113 113 LEU LEU A . n A 1 28 GLN 28 114 114 GLN GLN A . n A 1 29 ALA 29 115 115 ALA ALA A . n A 1 30 LYS 30 116 116 LYS LYS A . n A 1 31 ALA 31 117 117 ALA ALA A . n A 1 32 ARG 32 118 118 ARG ARG A . n A 1 33 VAL 33 119 119 VAL VAL A . n A 1 34 ALA 34 120 120 ALA ALA A . n A 1 35 LEU 35 121 121 LEU LEU A . n A 1 36 SER 36 122 122 SER SER A . n A 1 37 SER 37 123 123 SER SER A . n A 1 38 LEU 38 124 124 LEU LEU A . n A 1 39 LEU 39 125 125 LEU LEU A . n A 1 40 ARG 40 126 126 ARG ARG A . n A 1 41 LEU 41 127 127 LEU LEU A . n A 1 42 ALA 42 128 128 ALA ALA A . n A 1 43 LYS 43 129 129 LYS LYS A . n A 1 44 PHE 44 130 130 PHE PHE A . n A 1 45 GLU 45 131 131 GLU GLU A . n A 1 46 ALA 46 132 132 ALA ALA A . n A 1 47 HIS 47 133 133 HIS HIS A . n A 1 48 GLU 48 134 134 GLU GLU A . n A 1 49 VAL 49 135 135 VAL VAL A . n A 1 50 LEU 50 136 136 LEU LEU A . n A 1 51 ASN 51 137 137 ASN ASN A . n A 1 52 LEU 52 138 138 LEU LEU A . n A 1 53 HIS 53 139 139 HIS HIS A . n A 1 54 PHE 54 140 140 PHE PHE A . n A 1 55 VAL 55 141 141 VAL VAL A . n A 1 56 SER 56 142 142 SER SER A . n A 1 57 GLU 57 143 143 GLU GLU A . n A 1 58 GLU 58 144 144 GLU GLU A . n A 1 59 ALA 59 145 145 ALA ALA A . n A 1 60 SER 60 146 146 SER SER A . n A 1 61 ARG 61 147 147 ARG ARG A . n A 1 62 GLU 62 148 148 GLU GLU A . n A 1 63 VAL 63 149 149 VAL VAL A . n A 1 64 ALA 64 150 150 ALA ALA A . n A 1 65 LYS 65 151 151 LYS LYS A . n A 1 66 ALA 66 152 152 ALA ALA A . n A 1 67 LEU 67 153 153 LEU LEU A . n A 1 68 LEU 68 154 154 LEU LEU A . n A 1 69 ARG 69 155 155 ARG ARG A . n A 1 70 GLU 70 156 156 GLU GLU A . n A 1 71 LEU 71 157 157 LEU LEU A . n A 1 72 LEU 72 158 158 LEU LEU A . n A 1 73 PRO 73 159 159 PRO PRO A . n A 1 74 PRO 74 160 160 PRO PRO A . n A 1 75 ALA 75 161 161 ALA ALA A . n A 1 76 ALA 76 162 162 ALA ALA A . n A 1 77 GLY 77 163 163 GLY GLY A . n A 1 78 PHE 78 164 164 PHE PHE A . n A 1 79 LYS 79 165 165 LYS LYS A . n A 1 80 CYS 80 166 166 CYS CYS A . n A 1 81 LYS 81 167 167 LYS LYS A . n A 1 82 VAL 82 168 168 VAL VAL A . n A 1 83 ILE 83 169 169 ILE ILE A . n A 1 84 PHE 84 170 170 PHE PHE A . n A 1 85 HIS 85 171 171 HIS HIS A . n A 1 86 ASP 86 172 172 ASP ASP A . n A 1 87 VAL 87 173 173 VAL VAL A . n A 1 88 ALA 88 174 174 ALA ALA A . n A 1 89 VAL 89 175 175 VAL VAL A . n A 1 90 LEU 90 176 176 LEU LEU A . n A 1 91 THR 91 177 177 THR THR A . n A 1 92 ASP 92 178 178 ASP ASP A . n A 1 93 LYS 93 179 179 LYS LYS A . n A 1 94 LEU 94 180 180 LEU LEU A . n A 1 95 PHE 95 181 181 PHE PHE A . n A 1 96 PRO 96 182 182 PRO PRO A . n A 1 97 VAL 97 183 183 VAL VAL A . n A 1 98 VAL 98 184 184 VAL VAL A . n A 1 99 GLU 99 185 185 GLU GLU A . n A 1 100 ALA 100 186 186 ALA ALA A . n A 1 101 MET 101 187 187 MET MET A . n A 1 102 GLN 102 188 188 GLN GLN A . n A 1 103 LYS 103 189 189 LYS LYS A . n A 1 104 TYR 104 190 190 TYR TYR A . n A 1 105 PHE 105 191 191 PHE PHE A . n A 1 106 SER 106 192 192 SER SER A . n A 1 107 ALA 107 193 193 ALA ALA A . n A 1 108 GLY 108 194 194 GLY GLY A . n A 1 109 SER 109 195 195 SER SER A . n A 1 110 GLY 110 196 196 GLY GLY A . n A 1 111 THR 111 197 197 THR THR A . n A 1 112 TYR 112 198 198 TYR TYR A . n A 1 113 TYR 113 199 199 TYR TYR A . n A 1 114 SER 114 200 200 SER SER A . n A 1 115 ASP 115 201 201 ASP ASP A . n A 1 116 SER 116 202 202 SER SER A . n A 1 117 ILE 117 203 203 ILE ILE A . n A 1 118 PHE 118 204 204 PHE PHE A . n A 1 119 PHE 119 205 205 PHE PHE A . n A 1 120 LEU 120 206 206 LEU LEU A . n A 1 121 SER 121 207 207 SER SER A . n A 1 122 VAL 122 208 208 VAL VAL A . n A 1 123 ALA 123 209 209 ALA ALA A . n A 1 124 MET 124 210 210 MET MET A . n A 1 125 HIS 125 211 211 HIS HIS A . n A 1 126 GLN 126 212 212 GLN GLN A . n A 1 127 ILE 127 213 213 ILE ILE A . n A 1 128 MET 128 214 214 MET MET A . n A 1 129 PRO 129 215 215 PRO PRO A . n A 1 130 LYS 130 216 216 LYS LYS A . n A 1 131 GLU 131 217 217 GLU GLU A . n A 1 132 ILE 132 218 218 ILE ILE A . n A 1 133 PRO 133 219 219 PRO PRO A . n A 1 134 ARG 134 220 220 ARG ARG A . n A 1 135 ILE 135 221 221 ILE ILE A . n A 1 136 ILE 136 222 222 ILE ILE A . n A 1 137 GLN 137 223 223 GLN GLN A . n A 1 138 LEU 138 224 224 LEU LEU A . n A 1 139 ASP 139 225 225 ASP ASP A . n A 1 140 LEU 140 226 226 LEU LEU A . n A 1 141 ASP 141 227 227 ASP ASP A . n A 1 142 LEU 142 228 228 LEU LEU A . n A 1 143 LYS 143 229 229 LYS LYS A . n A 1 144 TYR 144 230 230 TYR TYR A . n A 1 145 LYS 145 231 231 LYS LYS A . n A 1 146 THR 146 232 232 THR THR A . n A 1 147 ASN 147 233 233 ASN ASN A . n A 1 148 ILE 148 234 234 ILE ILE A . n A 1 149 ARG 149 235 235 ARG ARG A . n A 1 150 GLU 150 236 236 GLU GLU A . n A 1 151 LEU 151 237 237 LEU LEU A . n A 1 152 PHE 152 238 238 PHE PHE A . n A 1 153 GLU 153 239 239 GLU GLU A . n A 1 154 GLU 154 240 240 GLU GLU A . n A 1 155 PHE 155 241 241 PHE PHE A . n A 1 156 ASP 156 242 242 ASP ASP A . n A 1 157 ASN 157 243 243 ASN ASN A . n A 1 158 PHE 158 244 244 PHE PHE A . n A 1 159 LEU 159 245 245 LEU LEU A . n A 1 160 PRO 160 246 246 PRO PRO A . n A 1 161 GLY 161 247 247 GLY GLY A . n A 1 162 ALA 162 248 248 ALA ALA A . n A 1 163 VAL 163 249 249 VAL VAL A . n A 1 164 ILE 164 250 250 ILE ILE A . n A 1 165 GLY 165 251 251 GLY GLY A . n A 1 166 ILE 166 252 252 ILE ILE A . n A 1 167 ALA 167 253 253 ALA ALA A . n A 1 168 ARG 168 254 254 ARG ARG A . n A 1 169 GLU 169 255 255 GLU GLU A . n A 1 170 MET 170 256 256 MET MET A . n A 1 171 GLN 171 257 257 GLN GLN A . n A 1 172 PRO 172 258 258 PRO PRO A . n A 1 173 VAL 173 259 259 VAL VAL A . n A 1 174 TYR 174 260 260 TYR TYR A . n A 1 175 ARG 175 261 261 ARG ARG A . n A 1 176 HIS 176 262 262 HIS HIS A . n A 1 177 THR 177 263 263 THR THR A . n A 1 178 PHE 178 264 264 PHE PHE A . n A 1 179 TRP 179 265 265 TRP TRP A . n A 1 180 GLN 180 266 266 GLN GLN A . n A 1 181 PHE 181 267 267 PHE PHE A . n A 1 182 ARG 182 268 268 ARG ARG A . n A 1 183 HIS 183 269 269 HIS HIS A . n A 1 184 GLU 184 270 270 GLU GLU A . n A 1 185 ASN 185 271 271 ASN ASN A . n A 1 186 PRO 186 272 272 PRO PRO A . n A 1 187 LYS 187 273 273 LYS LYS A . n A 1 188 THR 188 274 274 THR THR A . n A 1 189 ARG 189 275 275 ARG ARG A . n A 1 190 VAL 190 276 276 VAL VAL A . n A 1 191 GLY 191 277 277 GLY GLY A . n A 1 192 ASP 192 278 278 ASP ASP A . n A 1 193 PRO 193 279 279 PRO PRO A . n A 1 194 PRO 194 280 280 PRO PRO A . n A 1 195 PRO 195 281 281 PRO PRO A . n A 1 196 GLU 196 282 282 GLU GLU A . n A 1 197 GLY 197 283 283 GLY GLY A . n A 1 198 LEU 198 284 284 LEU LEU A . n A 1 199 PRO 199 285 285 PRO PRO A . n A 1 200 GLY 200 286 286 GLY GLY A . n A 1 201 PHE 201 287 287 PHE PHE A . n A 1 202 ASN 202 288 288 ASN ASN A . n A 1 203 SER 203 289 289 SER SER A . n A 1 204 GLY 204 290 290 GLY GLY A . n A 1 205 VAL 205 291 291 VAL VAL A . n A 1 206 MET 206 292 292 MET MET A . n A 1 207 LEU 207 293 293 LEU LEU A . n A 1 208 LEU 208 294 294 LEU LEU A . n A 1 209 ASN 209 295 295 ASN ASN A . n A 1 210 LEU 210 296 296 LEU LEU A . n A 1 211 GLU 211 297 297 GLU GLU A . n A 1 212 ALA 212 298 298 ALA ALA A . n A 1 213 MET 213 299 299 MET MET A . n A 1 214 ARG 214 300 300 ARG ARG A . n A 1 215 GLN 215 301 301 GLN GLN A . n A 1 216 SER 216 302 302 SER SER A . n A 1 217 PRO 217 303 303 PRO PRO A . n A 1 218 LEU 218 304 304 LEU LEU A . n A 1 219 TYR 219 305 305 TYR TYR A . n A 1 220 SER 220 306 306 SER SER A . n A 1 221 HIS 221 307 307 HIS HIS A . n A 1 222 LEU 222 308 308 LEU LEU A . n A 1 223 LEU 223 309 309 LEU LEU A . n A 1 224 GLU 224 310 310 GLU GLU A . n A 1 225 PRO 225 311 311 PRO PRO A . n A 1 226 SER 226 312 312 SER SER A . n A 1 227 TRP 227 313 313 TRP TRP A . n A 1 228 VAL 228 314 314 VAL VAL A . n A 1 229 GLN 229 315 315 GLN GLN A . n A 1 230 GLN 230 316 316 GLN GLN A . n A 1 231 LEU 231 317 317 LEU LEU A . n A 1 232 ALA 232 318 318 ALA ALA A . n A 1 233 ASP 233 319 319 ASP ASP A . n A 1 234 LYS 234 320 320 LYS LYS A . n A 1 235 TYR 235 321 321 TYR TYR A . n A 1 236 HIS 236 322 322 HIS HIS A . n A 1 237 PHE 237 323 323 PHE PHE A . n A 1 238 ARG 238 324 324 ARG ARG A . n A 1 239 GLY 239 325 325 GLY GLY A . n A 1 240 HIS 240 326 326 HIS HIS A . n A 1 241 LEU 241 327 327 LEU LEU A . n A 1 242 GLY 242 328 328 GLY GLY A . n A 1 243 ASP 243 329 329 ASP ASP A . n A 1 244 GLN 244 330 330 GLN GLN A . n A 1 245 ASP 245 331 331 ASP ASP A . n A 1 246 PHE 246 332 332 PHE PHE A . n A 1 247 PHE 247 333 333 PHE PHE A . n A 1 248 THR 248 334 334 THR THR A . n A 1 249 MET 249 335 335 MET MET A . n A 1 250 ILE 250 336 336 ILE ILE A . n A 1 251 GLY 251 337 337 GLY GLY A . n A 1 252 MET 252 338 338 MET MET A . n A 1 253 GLU 253 339 339 GLU GLU A . n A 1 254 HIS 254 340 340 HIS HIS A . n A 1 255 PRO 255 341 341 PRO PRO A . n A 1 256 GLU 256 342 342 GLU GLU A . n A 1 257 LEU 257 343 343 LEU LEU A . n A 1 258 PHE 258 344 344 PHE PHE A . n A 1 259 HIS 259 345 345 HIS HIS A . n A 1 260 VAL 260 346 346 VAL VAL A . n A 1 261 LEU 261 347 347 LEU LEU A . n A 1 262 ASP 262 348 348 ASP ASP A . n A 1 263 CYS 263 349 349 CYS CYS A . n A 1 264 THR 264 350 350 THR THR A . n A 1 265 TRP 265 351 351 TRP TRP A . n A 1 266 ASN 266 352 352 ASN ASN A . n A 1 267 ARG 267 353 353 ARG ARG A . n A 1 268 GLN 268 354 354 GLN GLN A . n A 1 269 LEU 269 355 355 LEU LEU A . n A 1 270 CYS 270 356 356 CYS CYS A . n A 1 271 THR 271 357 357 THR THR A . n A 1 272 TRP 272 358 358 TRP TRP A . n A 1 273 TRP 273 359 359 TRP TRP A . n A 1 274 ARG 274 360 360 ARG ARG A . n A 1 275 ASP 275 361 361 ASP ASP A . n A 1 276 HIS 276 362 362 HIS HIS A . n A 1 277 GLY 277 363 363 GLY GLY A . n A 1 278 TYR 278 364 364 TYR TYR A . n A 1 279 SER 279 365 365 SER SER A . n A 1 280 ASP 280 366 366 ASP ASP A . n A 1 281 VAL 281 367 367 VAL VAL A . n A 1 282 PHE 282 368 368 PHE PHE A . n A 1 283 GLN 283 369 369 GLN GLN A . n A 1 284 ALA 284 370 370 ALA ALA A . n A 1 285 TYR 285 371 371 TYR TYR A . n A 1 286 PHE 286 372 372 PHE PHE A . n A 1 287 ARG 287 373 373 ARG ARG A . n A 1 288 CYS 288 374 374 CYS CYS A . n A 1 289 GLU 289 375 375 GLU GLU A . n A 1 290 GLY 290 376 376 GLY GLY A . n A 1 291 HIS 291 377 377 HIS HIS A . n A 1 292 VAL 292 378 378 VAL VAL A . n A 1 293 LYS 293 379 379 LYS LYS A . n A 1 294 ILE 294 380 380 ILE ILE A . n A 1 295 TYR 295 381 381 TYR TYR A . n A 1 296 HIS 296 382 382 HIS HIS A . n A 1 297 GLY 297 383 383 GLY GLY A . n A 1 298 ASN 298 384 384 ASN ASN A . n A 1 299 CYS 299 385 385 CYS CYS A . n A 1 300 ASN 300 386 386 ASN ASN A . n A 1 301 THR 301 387 387 THR THR A . n A 1 302 PRO 302 388 388 PRO PRO A . n A 1 303 ILE 303 389 389 ILE ILE A . n A 1 304 PRO 304 390 390 PRO PRO A . n A 1 305 GLU 305 391 391 GLU GLU A . n A 1 306 ASP 306 392 ? ? ? A . n B 2 1 MET 1 43 ? ? ? D . n B 2 2 ASP 2 44 ? ? ? D . n B 2 3 ILE 3 45 ? ? ? D . n B 2 4 VAL 4 46 ? ? ? D . n B 2 5 ASP 5 47 ? ? ? D . n B 2 6 GLY 6 48 ? ? ? D . n B 2 7 ASP 7 49 ? ? ? D . n B 2 8 GLN 8 50 50 GLN GLN D . n B 2 9 CYS 9 51 51 CYS CYS D . n B 2 10 GLU 10 52 52 GLU GLU D . n B 2 11 SER 11 53 53 SER SER D . n B 2 12 ASN 12 54 54 ASN ASN D . n B 2 13 PRO 13 55 55 PRO PRO D . n B 2 14 CYS 14 56 56 CYS CYS D . n B 2 15 LEU 15 57 57 LEU LEU D . n B 2 16 ASN 16 58 58 ASN ASN D . n B 2 17 GLY 17 59 59 GLY GLY D . n B 2 18 GLY 18 60 60 GLY GLY D . n B 2 19 SER 19 61 61 SER SER D . n B 2 20 CYS 20 62 62 CYS CYS D . n B 2 21 LYS 21 63 63 LYS LYS D . n B 2 22 ASP 22 64 64 ASP ASP D . n B 2 23 ASP 23 65 65 ASP ASP D . n B 2 24 ILE 24 66 66 ILE ILE D . n B 2 25 ASN 25 67 67 ASN ASN D . n B 2 26 SER 26 68 68 SER SER D . n B 2 27 TYR 27 69 69 TYR TYR D . n B 2 28 GLU 28 70 70 GLU GLU D . n B 2 29 CYS 29 71 71 CYS CYS D . n B 2 30 TRP 30 72 72 TRP TRP D . n B 2 31 CYS 31 73 73 CYS CYS D . n B 2 32 PRO 32 74 74 PRO PRO D . n B 2 33 PHE 33 75 75 PHE PHE D . n B 2 34 GLY 34 76 76 GLY GLY D . n B 2 35 PHE 35 77 77 PHE PHE D . n B 2 36 GLU 36 78 78 GLU GLU D . n B 2 37 GLY 37 79 79 GLY GLY D . n B 2 38 LYS 38 80 80 LYS LYS D . n B 2 39 ASN 39 81 81 ASN ASN D . n B 2 40 CYS 40 82 82 CYS CYS D . n B 2 41 GLU 41 83 83 GLU GLU D . n B 2 42 LEU 42 84 84 LEU LEU D . n B 2 43 LEU 43 85 ? ? ? D . n B 2 44 GLU 44 86 ? ? ? D . n B 2 45 HIS 45 87 ? ? ? D . n B 2 46 HIS 46 88 ? ? ? D . n B 2 47 HIS 47 89 ? ? ? D . n B 2 48 HIS 48 90 ? ? ? D . n B 2 49 HIS 49 91 ? ? ? D . n B 2 50 HIS 50 92 ? ? ? D . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 3 BGC 1 B BGC 1 C GXX 1 n C 3 XYS 2 B XYS 2 C GXX 1 n C 3 XYS 3 B XYS 3 C GXX 1 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 MN 1 401 1 MN MN A . E 5 UDP 1 402 1 UDP UDP A . F 6 SO4 1 403 1 SO4 SO4 A . G 7 HOH 1 501 77 HOH HOH A . G 7 HOH 2 502 64 HOH HOH A . G 7 HOH 3 503 54 HOH HOH A . G 7 HOH 4 504 14 HOH HOH A . G 7 HOH 5 505 13 HOH HOH A . G 7 HOH 6 506 50 HOH HOH A . G 7 HOH 7 507 49 HOH HOH A . G 7 HOH 8 508 78 HOH HOH A . G 7 HOH 9 509 11 HOH HOH A . G 7 HOH 10 510 55 HOH HOH A . G 7 HOH 11 511 24 HOH HOH A . G 7 HOH 12 512 87 HOH HOH A . G 7 HOH 13 513 102 HOH HOH A . G 7 HOH 14 514 100 HOH HOH A . G 7 HOH 15 515 1 HOH HOH A . G 7 HOH 16 516 2 HOH HOH A . G 7 HOH 17 517 3 HOH HOH A . G 7 HOH 18 518 4 HOH HOH A . G 7 HOH 19 519 5 HOH HOH A . G 7 HOH 20 520 6 HOH HOH A . G 7 HOH 21 521 7 HOH HOH A . G 7 HOH 22 522 8 HOH HOH A . G 7 HOH 23 523 9 HOH HOH A . G 7 HOH 24 524 10 HOH HOH A . G 7 HOH 25 525 12 HOH HOH A . G 7 HOH 26 526 15 HOH HOH A . G 7 HOH 27 527 16 HOH HOH A . G 7 HOH 28 528 17 HOH HOH A . G 7 HOH 29 529 18 HOH HOH A . G 7 HOH 30 530 19 HOH HOH A . G 7 HOH 31 531 20 HOH HOH A . G 7 HOH 32 532 21 HOH HOH A . G 7 HOH 33 533 22 HOH HOH A . G 7 HOH 34 534 23 HOH HOH A . G 7 HOH 35 535 25 HOH HOH A . G 7 HOH 36 536 26 HOH HOH A . G 7 HOH 37 537 27 HOH HOH A . G 7 HOH 38 538 28 HOH HOH A . G 7 HOH 39 539 30 HOH HOH A . G 7 HOH 40 540 31 HOH HOH A . G 7 HOH 41 541 32 HOH HOH A . G 7 HOH 42 542 33 HOH HOH A . G 7 HOH 43 543 34 HOH HOH A . G 7 HOH 44 544 36 HOH HOH A . G 7 HOH 45 545 37 HOH HOH A . G 7 HOH 46 546 38 HOH HOH A . G 7 HOH 47 547 39 HOH HOH A . G 7 HOH 48 548 41 HOH HOH A . G 7 HOH 49 549 43 HOH HOH A . G 7 HOH 50 550 44 HOH HOH A . G 7 HOH 51 551 47 HOH HOH A . G 7 HOH 52 552 48 HOH HOH A . G 7 HOH 53 553 51 HOH HOH A . G 7 HOH 54 554 52 HOH HOH A . G 7 HOH 55 555 56 HOH HOH A . G 7 HOH 56 556 57 HOH HOH A . G 7 HOH 57 557 58 HOH HOH A . G 7 HOH 58 558 59 HOH HOH A . G 7 HOH 59 559 60 HOH HOH A . G 7 HOH 60 560 61 HOH HOH A . G 7 HOH 61 561 62 HOH HOH A . G 7 HOH 62 562 67 HOH HOH A . G 7 HOH 63 563 69 HOH HOH A . G 7 HOH 64 564 70 HOH HOH A . G 7 HOH 65 565 71 HOH HOH A . G 7 HOH 66 566 72 HOH HOH A . G 7 HOH 67 567 73 HOH HOH A . G 7 HOH 68 568 74 HOH HOH A . G 7 HOH 69 569 79 HOH HOH A . G 7 HOH 70 570 81 HOH HOH A . G 7 HOH 71 571 82 HOH HOH A . G 7 HOH 72 572 83 HOH HOH A . G 7 HOH 73 573 91 HOH HOH A . G 7 HOH 74 574 93 HOH HOH A . G 7 HOH 75 575 94 HOH HOH A . G 7 HOH 76 576 99 HOH HOH A . G 7 HOH 77 577 101 HOH HOH A . G 7 HOH 78 578 103 HOH HOH A . H 7 HOH 1 201 84 HOH HOH D . H 7 HOH 2 202 29 HOH HOH D . H 7 HOH 3 203 40 HOH HOH D . H 7 HOH 4 204 45 HOH HOH D . H 7 HOH 5 205 46 HOH HOH D . H 7 HOH 6 206 63 HOH HOH D . H 7 HOH 7 207 66 HOH HOH D . H 7 HOH 8 208 75 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 93 ? CG1 ? A VAL 7 CG1 2 1 Y 1 A VAL 93 ? CG2 ? A VAL 7 CG2 3 1 Y 1 D GLN 50 ? CG ? B GLN 8 CG 4 1 Y 1 D GLN 50 ? CD ? B GLN 8 CD 5 1 Y 1 D GLN 50 ? OE1 ? B GLN 8 OE1 6 1 Y 1 D GLN 50 ? NE2 ? B GLN 8 NE2 # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name REFMAC _software.os ? _software.os_version ? _software.type ? _software.version 5.6.0117 _software.pdbx_ordinal 1 # _cell.entry_id 4WMK _cell.length_a 88.911 _cell.length_b 88.911 _cell.length_c 42.683 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 3 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4WMK _symmetry.space_group_name_H-M 'P 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 143 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4WMK _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Li2SO4, 0.1 M Bis-Tris, and 21% PEG3350' _exptl_crystal_grow.pdbx_pH_range 6.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X25' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.1000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X25 _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4WMK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.08 _reflns.d_resolution_low 40 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22674 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.6 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.08 _reflns_shell.d_res_low 2.15 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 84.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.412 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4WMK _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 21021 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40 _refine.ls_d_res_high 2.08 _refine.ls_percent_reflns_obs 97.69 _refine.ls_R_factor_obs 0.19389 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19119 _refine.ls_R_factor_R_free 0.24571 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1128 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.928 _refine.B_iso_mean 32.348 _refine.aniso_B[1][1] -0.63 _refine.aniso_B[2][2] -0.63 _refine.aniso_B[3][3] 0.95 _refine.aniso_B[1][2] -0.32 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.222 _refine.pdbx_overall_ESU_R_Free 0.193 _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2703 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.number_atoms_solvent 86 _refine_hist.number_atoms_total 2849 _refine_hist.d_res_high 2.08 _refine_hist.d_res_low 40 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.009 0.020 ? 2851 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.375 1.969 ? 3877 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.807 5.000 ? 332 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.398 23.741 ? 139 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.041 15.000 ? 454 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 17.125 15.000 ? 15 'X-RAY DIFFRACTION' ? r_chiral_restr 0.100 0.200 ? 410 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.021 ? 2177 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.081 _refine_ls_shell.d_res_low 2.135 _refine_ls_shell.number_reflns_R_work 1311 _refine_ls_shell.R_factor_R_work 0.271 _refine_ls_shell.percent_reflns_obs 81.18 _refine_ls_shell.R_factor_R_free 0.325 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 78 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 4WMK _struct.title 'Crystal structure of mouse Xyloside xylosyltransferase 1 complexed with manganese, product ligand and UDP (Product complex II)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4WMK _struct_keywords.text 'glycosyltransferase, transferase-protein binding complex' _struct_keywords.pdbx_keywords 'transferase/protein binding' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 7 ? H N N 7 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP XXLT1_MOUSE Q3U4G3 ? 1 ;SLEGGVVVPVDYHLLMMFTKAEHNAPLQAKARVALSSLLRLAKFEAHEVLNLHFVSEEASREVAKALLRELLPPAAGFKC KVIFHDVAVLTDKLFPVVEAMQKYFSAGSGTYYSDSIFFLSVAMHQIMPKEIPRIIQLDLDLKYKTNIRELFEEFDNFLP GAVIGIAREMQPVYRHTFWQFRHENPKTRVGDPPPEGLPGFNSGVMLLNLEAMRQSPLYSHLLEPSWVQQLADKYHFRGH LGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWRDHGYSDVFQAYFRCEGHVKIYHGNCNTPIPED ; 87 2 UNP FA9_HUMAN P00740 ? 2 VDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL 92 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4WMK A 1 ? 306 ? Q3U4G3 87 ? 392 ? 87 392 2 2 4WMK D 4 ? 42 ? P00740 92 ? 130 ? 46 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 4WMK MET D 1 ? UNP P00740 ? ? 'initiating methionine' 43 1 2 4WMK ASP D 2 ? UNP P00740 ? ? 'expression tag' 44 2 2 4WMK ILE D 3 ? UNP P00740 ? ? 'expression tag' 45 3 2 4WMK LEU D 43 ? UNP P00740 ? ? 'expression tag' 85 4 2 4WMK GLU D 44 ? UNP P00740 ? ? 'expression tag' 86 5 2 4WMK HIS D 45 ? UNP P00740 ? ? 'expression tag' 87 6 2 4WMK HIS D 46 ? UNP P00740 ? ? 'expression tag' 88 7 2 4WMK HIS D 47 ? UNP P00740 ? ? 'expression tag' 89 8 2 4WMK HIS D 48 ? UNP P00740 ? ? 'expression tag' 90 9 2 4WMK HIS D 49 ? UNP P00740 ? ? 'expression tag' 91 10 2 4WMK HIS D 50 ? UNP P00740 ? ? 'expression tag' 92 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2840 ? 1 MORE -41 ? 1 'SSA (A^2)' 15350 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 24 ? ALA A 42 ? ASN A 110 ALA A 128 1 ? 19 HELX_P HELX_P2 AA2 GLU A 57 ? LEU A 72 ? GLU A 143 LEU A 158 1 ? 16 HELX_P HELX_P3 AA3 VAL A 87 ? GLU A 99 ? VAL A 173 GLU A 185 1 ? 13 HELX_P HELX_P4 AA4 MET A 101 ? SER A 106 ? MET A 187 SER A 192 1 ? 6 HELX_P HELX_P5 AA5 TYR A 112 ? ILE A 117 ? TYR A 198 ILE A 203 1 ? 6 HELX_P HELX_P6 AA6 PHE A 118 ? VAL A 122 ? PHE A 204 VAL A 208 5 ? 5 HELX_P HELX_P7 AA7 ALA A 123 ? MET A 128 ? ALA A 209 MET A 214 1 ? 6 HELX_P HELX_P8 AA8 ASN A 147 ? PHE A 158 ? ASN A 233 PHE A 244 5 ? 12 HELX_P HELX_P9 AA9 PRO A 172 ? PHE A 178 ? PRO A 258 PHE A 264 1 ? 7 HELX_P HELX_P10 AB1 PHE A 178 ? ASN A 185 ? PHE A 264 ASN A 271 1 ? 8 HELX_P HELX_P11 AB2 LEU A 210 ? SER A 216 ? LEU A 296 SER A 302 1 ? 7 HELX_P HELX_P12 AB3 SER A 216 ? LEU A 223 ? SER A 302 LEU A 309 1 ? 8 HELX_P HELX_P13 AB4 GLU A 224 ? HIS A 236 ? GLU A 310 HIS A 322 1 ? 13 HELX_P HELX_P14 AB5 GLY A 242 ? HIS A 254 ? GLY A 328 HIS A 340 1 ? 13 HELX_P HELX_P15 AB6 ASP A 262 ? ASN A 266 ? ASP A 348 ASN A 352 5 ? 5 HELX_P HELX_P16 AB7 THR A 271 ? GLY A 277 ? THR A 357 GLY A 363 5 ? 7 HELX_P HELX_P17 AB8 TYR A 278 ? ARG A 287 ? TYR A 364 ARG A 373 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 263 SG ? ? ? 1_555 A CYS 288 SG ? ? A CYS 349 A CYS 374 1_555 ? ? ? ? ? ? ? 2.052 ? ? disulf2 disulf ? ? A CYS 270 SG ? ? ? 1_555 A CYS 299 SG ? ? A CYS 356 A CYS 385 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf3 disulf ? ? B CYS 9 SG ? ? ? 1_555 B CYS 20 SG ? ? D CYS 51 D CYS 62 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf4 disulf ? ? B CYS 14 SG ? ? ? 1_555 B CYS 29 SG ? ? D CYS 56 D CYS 71 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf5 disulf ? ? B CYS 31 SG ? ? ? 1_555 B CYS 40 SG ? ? D CYS 73 D CYS 82 1_555 ? ? ? ? ? ? ? 2.055 ? ? covale1 covale one ? B SER 11 OG ? ? ? 1_555 C BGC . C1 ? ? D SER 53 B BGC 1 1_555 ? ? ? ? ? ? ? 1.544 ? O-Glycosylation covale2 covale both ? C BGC . O3 ? ? ? 1_555 C XYS . C1 ? ? B BGC 1 B XYS 2 1_555 ? ? ? ? ? ? ? 1.424 sing ? covale3 covale both ? C XYS . O3 ? ? ? 1_555 C XYS . C1 ? ? B XYS 2 B XYS 3 1_555 ? ? ? ? ? ? ? 1.456 sing ? metalc1 metalc ? ? A ASP 139 OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 225 A MN 401 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc2 metalc ? ? A ASP 141 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 227 A MN 401 1_555 ? ? ? ? ? ? ? 2.140 ? ? metalc3 metalc ? ? A ASP 141 OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 227 A MN 401 1_555 ? ? ? ? ? ? ? 2.394 ? ? metalc4 metalc ? ? A HIS 296 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 382 A MN 401 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc5 metalc ? ? D MN . MN ? ? ? 1_555 E UDP . O2A ? ? A MN 401 A UDP 402 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc6 metalc ? ? D MN . MN ? ? ? 1_555 E UDP . O3B ? ? A MN 401 A UDP 402 1_555 ? ? ? ? ? ? ? 1.860 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 139 ? A ASP 225 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD1 ? A ASP 141 ? A ASP 227 ? 1_555 105.6 ? 2 OD2 ? A ASP 139 ? A ASP 225 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 141 ? A ASP 227 ? 1_555 159.8 ? 3 OD1 ? A ASP 141 ? A ASP 227 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 141 ? A ASP 227 ? 1_555 57.0 ? 4 OD2 ? A ASP 139 ? A ASP 225 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 NE2 ? A HIS 296 ? A HIS 382 ? 1_555 94.4 ? 5 OD1 ? A ASP 141 ? A ASP 227 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 NE2 ? A HIS 296 ? A HIS 382 ? 1_555 97.1 ? 6 OD2 ? A ASP 141 ? A ASP 227 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 NE2 ? A HIS 296 ? A HIS 382 ? 1_555 97.9 ? 7 OD2 ? A ASP 139 ? A ASP 225 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O2A ? E UDP . ? A UDP 402 ? 1_555 87.7 ? 8 OD1 ? A ASP 141 ? A ASP 227 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O2A ? E UDP . ? A UDP 402 ? 1_555 82.2 ? 9 OD2 ? A ASP 141 ? A ASP 227 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O2A ? E UDP . ? A UDP 402 ? 1_555 80.0 ? 10 NE2 ? A HIS 296 ? A HIS 382 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O2A ? E UDP . ? A UDP 402 ? 1_555 177.8 ? 11 OD2 ? A ASP 139 ? A ASP 225 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3B ? E UDP . ? A UDP 402 ? 1_555 107.5 ? 12 OD1 ? A ASP 141 ? A ASP 227 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3B ? E UDP . ? A UDP 402 ? 1_555 139.2 ? 13 OD2 ? A ASP 141 ? A ASP 227 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3B ? E UDP . ? A UDP 402 ? 1_555 85.3 ? 14 NE2 ? A HIS 296 ? A HIS 382 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3B ? E UDP . ? A UDP 402 ? 1_555 103.4 ? 15 O2A ? E UDP . ? A UDP 402 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3B ? E UDP . ? A UDP 402 ? 1_555 76.0 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 72 A . ? LEU 158 A PRO 73 A ? PRO 159 A 1 -4.74 2 ALA 107 A . ? ALA 193 A GLY 108 A ? GLY 194 A 1 -19.01 3 SER 109 A . ? SER 195 A GLY 110 A ? GLY 196 A 1 -4.40 4 PRO 194 A . ? PRO 280 A PRO 195 A ? PRO 281 A 1 2.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 79 ? ASP A 86 ? LYS A 165 ASP A 172 AA1 2 GLU A 48 ? SER A 56 ? GLU A 134 SER A 142 AA1 3 VAL A 10 ? MET A 17 ? VAL A 96 MET A 103 AA1 4 ARG A 134 ? LEU A 138 ? ARG A 220 LEU A 224 AA1 5 PHE A 201 ? ASN A 209 ? PHE A 287 ASN A 295 AA1 6 ILE A 164 ? ARG A 168 ? ILE A 250 ARG A 254 AA1 7 PHE A 258 ? LEU A 261 ? PHE A 344 LEU A 347 AA2 1 LEU A 142 ? TYR A 144 ? LEU A 228 TYR A 230 AA2 2 ILE A 294 ? HIS A 296 ? ILE A 380 HIS A 382 AA2 3 ARG A 267 ? GLN A 268 ? ARG A 353 GLN A 354 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 85 ? O HIS A 171 N PHE A 54 ? N PHE A 140 AA1 2 3 O ASN A 51 ? O ASN A 137 N TYR A 12 ? N TYR A 98 AA1 3 4 N LEU A 15 ? N LEU A 101 O ILE A 136 ? O ILE A 222 AA1 4 5 N ILE A 135 ? N ILE A 221 O LEU A 208 ? O LEU A 294 AA1 5 6 O LEU A 207 ? O LEU A 293 N GLY A 165 ? N GLY A 251 AA1 6 7 N ILE A 164 ? N ILE A 250 O HIS A 259 ? O HIS A 345 AA2 1 2 N LYS A 143 ? N LYS A 229 O TYR A 295 ? O TYR A 381 AA2 2 3 O ILE A 294 ? O ILE A 380 N ARG A 267 ? N ARG A 353 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 104 ? ? -150.11 85.87 2 1 ASP A 227 ? ? -99.60 43.38 3 1 PRO A 258 ? ? -79.90 30.86 4 1 HIS A 326 ? ? -143.41 19.33 5 1 ASN A 352 ? ? -158.55 71.22 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 87 ? A SER 1 2 1 Y 1 A LEU 88 ? A LEU 2 3 1 Y 1 A GLU 89 ? A GLU 3 4 1 Y 1 A GLY 90 ? A GLY 4 5 1 Y 1 A GLY 91 ? A GLY 5 6 1 Y 1 A VAL 92 ? A VAL 6 7 1 Y 1 A ASP 392 ? A ASP 306 8 1 Y 1 D MET 43 ? B MET 1 9 1 Y 1 D ASP 44 ? B ASP 2 10 1 Y 1 D ILE 45 ? B ILE 3 11 1 Y 1 D VAL 46 ? B VAL 4 12 1 Y 1 D ASP 47 ? B ASP 5 13 1 Y 1 D GLY 48 ? B GLY 6 14 1 Y 1 D ASP 49 ? B ASP 7 15 1 Y 1 D LEU 85 ? B LEU 43 16 1 Y 1 D GLU 86 ? B GLU 44 17 1 Y 1 D HIS 87 ? B HIS 45 18 1 Y 1 D HIS 88 ? B HIS 46 19 1 Y 1 D HIS 89 ? B HIS 47 20 1 Y 1 D HIS 90 ? B HIS 48 21 1 Y 1 D HIS 91 ? B HIS 49 22 1 Y 1 D HIS 92 ? B HIS 50 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BGC C2 C N R 74 BGC C3 C N S 75 BGC C4 C N S 76 BGC C5 C N R 77 BGC C6 C N N 78 BGC C1 C N R 79 BGC O1 O N N 80 BGC O2 O N N 81 BGC O3 O N N 82 BGC O4 O N N 83 BGC O5 O N N 84 BGC O6 O N N 85 BGC H2 H N N 86 BGC H3 H N N 87 BGC H4 H N N 88 BGC H5 H N N 89 BGC H61 H N N 90 BGC H62 H N N 91 BGC H1 H N N 92 BGC HO1 H N N 93 BGC HO2 H N N 94 BGC HO3 H N N 95 BGC HO4 H N N 96 BGC HO6 H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 MN MN MN N N 274 PHE N N N N 275 PHE CA C N S 276 PHE C C N N 277 PHE O O N N 278 PHE CB C N N 279 PHE CG C Y N 280 PHE CD1 C Y N 281 PHE CD2 C Y N 282 PHE CE1 C Y N 283 PHE CE2 C Y N 284 PHE CZ C Y N 285 PHE OXT O N N 286 PHE H H N N 287 PHE H2 H N N 288 PHE HA H N N 289 PHE HB2 H N N 290 PHE HB3 H N N 291 PHE HD1 H N N 292 PHE HD2 H N N 293 PHE HE1 H N N 294 PHE HE2 H N N 295 PHE HZ H N N 296 PHE HXT H N N 297 PRO N N N N 298 PRO CA C N S 299 PRO C C N N 300 PRO O O N N 301 PRO CB C N N 302 PRO CG C N N 303 PRO CD C N N 304 PRO OXT O N N 305 PRO H H N N 306 PRO HA H N N 307 PRO HB2 H N N 308 PRO HB3 H N N 309 PRO HG2 H N N 310 PRO HG3 H N N 311 PRO HD2 H N N 312 PRO HD3 H N N 313 PRO HXT H N N 314 SER N N N N 315 SER CA C N S 316 SER C C N N 317 SER O O N N 318 SER CB C N N 319 SER OG O N N 320 SER OXT O N N 321 SER H H N N 322 SER H2 H N N 323 SER HA H N N 324 SER HB2 H N N 325 SER HB3 H N N 326 SER HG H N N 327 SER HXT H N N 328 SO4 S S N N 329 SO4 O1 O N N 330 SO4 O2 O N N 331 SO4 O3 O N N 332 SO4 O4 O N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 UDP N1 N N N 402 UDP C2 C N N 403 UDP N3 N N N 404 UDP C4 C N N 405 UDP C5 C N N 406 UDP C6 C N N 407 UDP O2 O N N 408 UDP O4 O N N 409 UDP "C1'" C N R 410 UDP "C2'" C N R 411 UDP "O2'" O N N 412 UDP "C3'" C N S 413 UDP "C4'" C N R 414 UDP "O4'" O N N 415 UDP "O3'" O N N 416 UDP "C5'" C N N 417 UDP "O5'" O N N 418 UDP PA P N N 419 UDP O1A O N N 420 UDP O2A O N N 421 UDP O3A O N N 422 UDP PB P N N 423 UDP O1B O N N 424 UDP O2B O N N 425 UDP O3B O N N 426 UDP HN3 H N N 427 UDP H5 H N N 428 UDP H6 H N N 429 UDP "H1'" H N N 430 UDP "H2'" H N N 431 UDP "HO2'" H N N 432 UDP "H3'" H N N 433 UDP "H4'" H N N 434 UDP "HO3'" H N N 435 UDP "H5'1" H N N 436 UDP "H5'2" H N N 437 UDP HOA2 H N N 438 UDP HOB2 H N N 439 UDP HOB3 H N N 440 VAL N N N N 441 VAL CA C N S 442 VAL C C N N 443 VAL O O N N 444 VAL CB C N N 445 VAL CG1 C N N 446 VAL CG2 C N N 447 VAL OXT O N N 448 VAL H H N N 449 VAL H2 H N N 450 VAL HA H N N 451 VAL HB H N N 452 VAL HG11 H N N 453 VAL HG12 H N N 454 VAL HG13 H N N 455 VAL HG21 H N N 456 VAL HG22 H N N 457 VAL HG23 H N N 458 VAL HXT H N N 459 XYS C1 C N S 460 XYS C2 C N R 461 XYS C3 C N S 462 XYS C4 C N R 463 XYS C5 C N N 464 XYS O1 O N N 465 XYS O2 O N N 466 XYS O3 O N N 467 XYS O4 O N N 468 XYS O5 O N N 469 XYS H1 H N N 470 XYS H2 H N N 471 XYS H3 H N N 472 XYS H4 H N N 473 XYS H51 H N N 474 XYS H52 H N N 475 XYS HO1 H N N 476 XYS HO2 H N N 477 XYS HO3 H N N 478 XYS HO4 H N N 479 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BGC C2 C3 sing N N 70 BGC C2 C1 sing N N 71 BGC C2 O2 sing N N 72 BGC C2 H2 sing N N 73 BGC C3 C4 sing N N 74 BGC C3 O3 sing N N 75 BGC C3 H3 sing N N 76 BGC C4 C5 sing N N 77 BGC C4 O4 sing N N 78 BGC C4 H4 sing N N 79 BGC C5 C6 sing N N 80 BGC C5 O5 sing N N 81 BGC C5 H5 sing N N 82 BGC C6 O6 sing N N 83 BGC C6 H61 sing N N 84 BGC C6 H62 sing N N 85 BGC C1 O1 sing N N 86 BGC C1 O5 sing N N 87 BGC C1 H1 sing N N 88 BGC O1 HO1 sing N N 89 BGC O2 HO2 sing N N 90 BGC O3 HO3 sing N N 91 BGC O4 HO4 sing N N 92 BGC O6 HO6 sing N N 93 CYS N CA sing N N 94 CYS N H sing N N 95 CYS N H2 sing N N 96 CYS CA C sing N N 97 CYS CA CB sing N N 98 CYS CA HA sing N N 99 CYS C O doub N N 100 CYS C OXT sing N N 101 CYS CB SG sing N N 102 CYS CB HB2 sing N N 103 CYS CB HB3 sing N N 104 CYS SG HG sing N N 105 CYS OXT HXT sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HIS N CA sing N N 153 HIS N H sing N N 154 HIS N H2 sing N N 155 HIS CA C sing N N 156 HIS CA CB sing N N 157 HIS CA HA sing N N 158 HIS C O doub N N 159 HIS C OXT sing N N 160 HIS CB CG sing N N 161 HIS CB HB2 sing N N 162 HIS CB HB3 sing N N 163 HIS CG ND1 sing Y N 164 HIS CG CD2 doub Y N 165 HIS ND1 CE1 doub Y N 166 HIS ND1 HD1 sing N N 167 HIS CD2 NE2 sing Y N 168 HIS CD2 HD2 sing N N 169 HIS CE1 NE2 sing Y N 170 HIS CE1 HE1 sing N N 171 HIS NE2 HE2 sing N N 172 HIS OXT HXT sing N N 173 HOH O H1 sing N N 174 HOH O H2 sing N N 175 ILE N CA sing N N 176 ILE N H sing N N 177 ILE N H2 sing N N 178 ILE CA C sing N N 179 ILE CA CB sing N N 180 ILE CA HA sing N N 181 ILE C O doub N N 182 ILE C OXT sing N N 183 ILE CB CG1 sing N N 184 ILE CB CG2 sing N N 185 ILE CB HB sing N N 186 ILE CG1 CD1 sing N N 187 ILE CG1 HG12 sing N N 188 ILE CG1 HG13 sing N N 189 ILE CG2 HG21 sing N N 190 ILE CG2 HG22 sing N N 191 ILE CG2 HG23 sing N N 192 ILE CD1 HD11 sing N N 193 ILE CD1 HD12 sing N N 194 ILE CD1 HD13 sing N N 195 ILE OXT HXT sing N N 196 LEU N CA sing N N 197 LEU N H sing N N 198 LEU N H2 sing N N 199 LEU CA C sing N N 200 LEU CA CB sing N N 201 LEU CA HA sing N N 202 LEU C O doub N N 203 LEU C OXT sing N N 204 LEU CB CG sing N N 205 LEU CB HB2 sing N N 206 LEU CB HB3 sing N N 207 LEU CG CD1 sing N N 208 LEU CG CD2 sing N N 209 LEU CG HG sing N N 210 LEU CD1 HD11 sing N N 211 LEU CD1 HD12 sing N N 212 LEU CD1 HD13 sing N N 213 LEU CD2 HD21 sing N N 214 LEU CD2 HD22 sing N N 215 LEU CD2 HD23 sing N N 216 LEU OXT HXT sing N N 217 LYS N CA sing N N 218 LYS N H sing N N 219 LYS N H2 sing N N 220 LYS CA C sing N N 221 LYS CA CB sing N N 222 LYS CA HA sing N N 223 LYS C O doub N N 224 LYS C OXT sing N N 225 LYS CB CG sing N N 226 LYS CB HB2 sing N N 227 LYS CB HB3 sing N N 228 LYS CG CD sing N N 229 LYS CG HG2 sing N N 230 LYS CG HG3 sing N N 231 LYS CD CE sing N N 232 LYS CD HD2 sing N N 233 LYS CD HD3 sing N N 234 LYS CE NZ sing N N 235 LYS CE HE2 sing N N 236 LYS CE HE3 sing N N 237 LYS NZ HZ1 sing N N 238 LYS NZ HZ2 sing N N 239 LYS NZ HZ3 sing N N 240 LYS OXT HXT sing N N 241 MET N CA sing N N 242 MET N H sing N N 243 MET N H2 sing N N 244 MET CA C sing N N 245 MET CA CB sing N N 246 MET CA HA sing N N 247 MET C O doub N N 248 MET C OXT sing N N 249 MET CB CG sing N N 250 MET CB HB2 sing N N 251 MET CB HB3 sing N N 252 MET CG SD sing N N 253 MET CG HG2 sing N N 254 MET CG HG3 sing N N 255 MET SD CE sing N N 256 MET CE HE1 sing N N 257 MET CE HE2 sing N N 258 MET CE HE3 sing N N 259 MET OXT HXT sing N N 260 PHE N CA sing N N 261 PHE N H sing N N 262 PHE N H2 sing N N 263 PHE CA C sing N N 264 PHE CA CB sing N N 265 PHE CA HA sing N N 266 PHE C O doub N N 267 PHE C OXT sing N N 268 PHE CB CG sing N N 269 PHE CB HB2 sing N N 270 PHE CB HB3 sing N N 271 PHE CG CD1 doub Y N 272 PHE CG CD2 sing Y N 273 PHE CD1 CE1 sing Y N 274 PHE CD1 HD1 sing N N 275 PHE CD2 CE2 doub Y N 276 PHE CD2 HD2 sing N N 277 PHE CE1 CZ doub Y N 278 PHE CE1 HE1 sing N N 279 PHE CE2 CZ sing Y N 280 PHE CE2 HE2 sing N N 281 PHE CZ HZ sing N N 282 PHE OXT HXT sing N N 283 PRO N CA sing N N 284 PRO N CD sing N N 285 PRO N H sing N N 286 PRO CA C sing N N 287 PRO CA CB sing N N 288 PRO CA HA sing N N 289 PRO C O doub N N 290 PRO C OXT sing N N 291 PRO CB CG sing N N 292 PRO CB HB2 sing N N 293 PRO CB HB3 sing N N 294 PRO CG CD sing N N 295 PRO CG HG2 sing N N 296 PRO CG HG3 sing N N 297 PRO CD HD2 sing N N 298 PRO CD HD3 sing N N 299 PRO OXT HXT sing N N 300 SER N CA sing N N 301 SER N H sing N N 302 SER N H2 sing N N 303 SER CA C sing N N 304 SER CA CB sing N N 305 SER CA HA sing N N 306 SER C O doub N N 307 SER C OXT sing N N 308 SER CB OG sing N N 309 SER CB HB2 sing N N 310 SER CB HB3 sing N N 311 SER OG HG sing N N 312 SER OXT HXT sing N N 313 SO4 S O1 doub N N 314 SO4 S O2 doub N N 315 SO4 S O3 sing N N 316 SO4 S O4 sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 UDP N1 C2 sing N N 386 UDP N1 C6 sing N N 387 UDP N1 "C1'" sing N N 388 UDP C2 N3 sing N N 389 UDP C2 O2 doub N N 390 UDP N3 C4 sing N N 391 UDP N3 HN3 sing N N 392 UDP C4 C5 sing N N 393 UDP C4 O4 doub N N 394 UDP C5 C6 doub N N 395 UDP C5 H5 sing N N 396 UDP C6 H6 sing N N 397 UDP "C1'" "C2'" sing N N 398 UDP "C1'" "O4'" sing N N 399 UDP "C1'" "H1'" sing N N 400 UDP "C2'" "O2'" sing N N 401 UDP "C2'" "C3'" sing N N 402 UDP "C2'" "H2'" sing N N 403 UDP "O2'" "HO2'" sing N N 404 UDP "C3'" "C4'" sing N N 405 UDP "C3'" "O3'" sing N N 406 UDP "C3'" "H3'" sing N N 407 UDP "C4'" "O4'" sing N N 408 UDP "C4'" "C5'" sing N N 409 UDP "C4'" "H4'" sing N N 410 UDP "O3'" "HO3'" sing N N 411 UDP "C5'" "O5'" sing N N 412 UDP "C5'" "H5'1" sing N N 413 UDP "C5'" "H5'2" sing N N 414 UDP "O5'" PA sing N N 415 UDP PA O1A doub N N 416 UDP PA O2A sing N N 417 UDP PA O3A sing N N 418 UDP O2A HOA2 sing N N 419 UDP O3A PB sing N N 420 UDP PB O1B doub N N 421 UDP PB O2B sing N N 422 UDP PB O3B sing N N 423 UDP O2B HOB2 sing N N 424 UDP O3B HOB3 sing N N 425 VAL N CA sing N N 426 VAL N H sing N N 427 VAL N H2 sing N N 428 VAL CA C sing N N 429 VAL CA CB sing N N 430 VAL CA HA sing N N 431 VAL C O doub N N 432 VAL C OXT sing N N 433 VAL CB CG1 sing N N 434 VAL CB CG2 sing N N 435 VAL CB HB sing N N 436 VAL CG1 HG11 sing N N 437 VAL CG1 HG12 sing N N 438 VAL CG1 HG13 sing N N 439 VAL CG2 HG21 sing N N 440 VAL CG2 HG22 sing N N 441 VAL CG2 HG23 sing N N 442 VAL OXT HXT sing N N 443 XYS C1 C2 sing N N 444 XYS C1 O1 sing N N 445 XYS C1 O5 sing N N 446 XYS C1 H1 sing N N 447 XYS C2 C3 sing N N 448 XYS C2 O2 sing N N 449 XYS C2 H2 sing N N 450 XYS C3 C4 sing N N 451 XYS C3 O3 sing N N 452 XYS C3 H3 sing N N 453 XYS C4 C5 sing N N 454 XYS C4 O4 sing N N 455 XYS C4 H4 sing N N 456 XYS C5 O5 sing N N 457 XYS C5 H51 sing N N 458 XYS C5 H52 sing N N 459 XYS O1 HO1 sing N N 460 XYS O2 HO2 sing N N 461 XYS O3 HO3 sing N N 462 XYS O4 HO4 sing N N 463 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 3 BGC 1 n 3 XYS 2 n 3 XYS 3 n # _atom_sites.entry_id 4WMK _atom_sites.fract_transf_matrix[1][1] 0.011247 _atom_sites.fract_transf_matrix[1][2] 0.006494 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012987 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023429 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O P S # loop_