data_4X1L # _entry.id 4X1L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4X1L WWPDB D_1000204778 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4X1M PDB . unspecified 4X25 PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4X1L _pdbx_database_status.recvd_initial_deposition_date 2014-11-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Silvas, T.V.' 1 'Shandilya, S.M.D.' 2 'Schiffer, C.A.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 112 _citation.language ? _citation.page_first 7984 _citation.page_last 7989 _citation.title 'Structural basis for mutation-induced destabilization of profilin 1 in ALS.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1424108112 _citation.pdbx_database_id_PubMed 26056300 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Boopathy, S.' 1 ? primary 'Silvas, T.V.' 2 ? primary 'Tischbein, M.' 3 ? primary 'Jansen, S.' 4 ? primary 'Shandilya, S.M.' 5 ? primary 'Zitzewitz, J.A.' 6 ? primary 'Landers, J.E.' 7 ? primary 'Goode, B.L.' 8 ? primary 'Schiffer, C.A.' 9 ? primary 'Bosco, D.A.' 10 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 122.66 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4X1L _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.260 _cell.length_a_esd ? _cell.length_b 31.840 _cell.length_b_esd ? _cell.length_c 61.020 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4X1L _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Profilin-1 15071.222 1 ? ? ? ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 water nat water 18.015 64 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epididymis tissue protein Li 184a,Profilin I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQ DGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY ; _entity_poly.pdbx_seq_one_letter_code_can ;MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQ DGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLY n 1 4 TRP n 1 5 ASN n 1 6 ALA n 1 7 TYR n 1 8 ILE n 1 9 ASP n 1 10 ASN n 1 11 LEU n 1 12 MET n 1 13 ALA n 1 14 ASP n 1 15 GLY n 1 16 THR n 1 17 CYS n 1 18 GLN n 1 19 ASP n 1 20 ALA n 1 21 ALA n 1 22 ILE n 1 23 VAL n 1 24 GLY n 1 25 TYR n 1 26 LYS n 1 27 ASP n 1 28 SER n 1 29 PRO n 1 30 SER n 1 31 VAL n 1 32 TRP n 1 33 ALA n 1 34 ALA n 1 35 VAL n 1 36 PRO n 1 37 GLY n 1 38 LYS n 1 39 THR n 1 40 PHE n 1 41 VAL n 1 42 ASN n 1 43 ILE n 1 44 THR n 1 45 PRO n 1 46 ALA n 1 47 GLU n 1 48 VAL n 1 49 GLY n 1 50 VAL n 1 51 LEU n 1 52 VAL n 1 53 GLY n 1 54 LYS n 1 55 ASP n 1 56 ARG n 1 57 SER n 1 58 SER n 1 59 PHE n 1 60 TYR n 1 61 VAL n 1 62 ASN n 1 63 GLY n 1 64 LEU n 1 65 THR n 1 66 LEU n 1 67 GLY n 1 68 GLY n 1 69 GLN n 1 70 LYS n 1 71 CYS n 1 72 SER n 1 73 VAL n 1 74 ILE n 1 75 ARG n 1 76 ASP n 1 77 SER n 1 78 LEU n 1 79 LEU n 1 80 GLN n 1 81 ASP n 1 82 GLY n 1 83 GLU n 1 84 PHE n 1 85 SER n 1 86 MET n 1 87 ASP n 1 88 LEU n 1 89 ARG n 1 90 THR n 1 91 LYS n 1 92 SER n 1 93 THR n 1 94 GLY n 1 95 GLY n 1 96 ALA n 1 97 PRO n 1 98 THR n 1 99 PHE n 1 100 ASN n 1 101 VAL n 1 102 THR n 1 103 VAL n 1 104 THR n 1 105 LYS n 1 106 THR n 1 107 ASP n 1 108 LYS n 1 109 THR n 1 110 LEU n 1 111 VAL n 1 112 LEU n 1 113 LEU n 1 114 MET n 1 115 GLY n 1 116 LYS n 1 117 GLU n 1 118 GLY n 1 119 VAL n 1 120 HIS n 1 121 GLY n 1 122 GLY n 1 123 LEU n 1 124 ILE n 1 125 ASN n 1 126 LYS n 1 127 LYS n 1 128 CYS n 1 129 TYR n 1 130 GLU n 1 131 MET n 1 132 ALA n 1 133 SER n 1 134 HIS n 1 135 LEU n 1 136 ARG n 1 137 ARG n 1 138 SER n 1 139 GLN n 1 140 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PFN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PROF1_HUMAN _struct_ref.pdbx_db_accession P07737 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQ DGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4X1L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07737 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4X1L _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;PFN1 crystals were grown by hanging drop vapor diffusion after mixing the PFN1 protein with a 1:1 ratio of reservoir solution at 298K for WT. Reservoir solution for WT contained 50 mM KH2PO4, 36% (wt/vol) PEG 8,000 and 100 mM MES pH 6.0. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details Cryostream _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'Osmic Mirrors' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4X1L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.16 _reflns.d_resolution_low 27.9 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 6584 _reflns.number_obs 6584 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -2 _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.16 _reflns_shell.d_res_low 2.24 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.589 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4X1L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.160 _refine.ls_d_res_low 27.895 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6579 _refine.ls_number_reflns_R_free 308 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.28 _refine.ls_percent_reflns_R_free 4.68 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2173 _refine.ls_R_factor_R_free 0.2469 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2159 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1FIK _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.80 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.30 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 906 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 975 _refine_hist.d_res_high 2.160 _refine_hist.d_res_low 27.895 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 924 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.616 ? 1256 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.829 ? 309 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.023 ? 150 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 158 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1601 2.7211 . . 146 3104 99.00 . . . 0.2837 . 0.2592 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7211 27.8975 . . 162 3167 99.00 . . . 0.2338 . 0.2001 . . . . . . . . . . # _struct.entry_id 4X1L _struct.title 'Structural basis for mutation-induced destabilization of Profilin 1 in ALS' _struct.pdbx_descriptor 'Human Profilin-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4X1L _struct_keywords.text 'ALS, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TRP A 4 ? MET A 12 ? TRP A 4 MET A 12 1 ? 9 HELX_P HELX_P2 AA2 THR A 39 ? ILE A 43 ? THR A 39 ILE A 43 5 ? 5 HELX_P HELX_P3 AA3 THR A 44 ? VAL A 52 ? THR A 44 VAL A 52 1 ? 9 HELX_P HELX_P4 AA4 HIS A 120 ? ARG A 137 ? HIS A 120 ARG A 137 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 30 ? ALA A 34 ? SER A 30 ALA A 34 AA1 2 CYS A 17 ? GLY A 24 ? CYS A 17 GLY A 24 AA1 3 THR A 109 ? GLY A 115 ? THR A 109 GLY A 115 AA1 4 ASN A 100 ? LYS A 105 ? ASN A 100 LYS A 105 AA1 5 SER A 85 ? THR A 90 ? SER A 85 THR A 90 AA1 6 GLN A 69 ? SER A 77 ? GLN A 69 SER A 77 AA1 7 LEU A 64 ? LEU A 66 ? LEU A 64 LEU A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 33 ? O ALA A 33 N ILE A 22 ? N ILE A 22 AA1 2 3 N ASP A 19 ? N ASP A 19 O MET A 114 ? O MET A 114 AA1 3 4 O VAL A 111 ? O VAL A 111 N THR A 104 ? N THR A 104 AA1 4 5 O VAL A 101 ? O VAL A 101 N LEU A 88 ? N LEU A 88 AA1 5 6 O ARG A 89 ? O ARG A 89 N SER A 72 ? N SER A 72 AA1 6 7 O CYS A 71 ? O CYS A 71 N LEU A 64 ? N LEU A 64 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PO4 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue PO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASN A 100 ? ASN A 100 . ? 1_555 ? 2 AC1 4 HIS A 120 ? HIS A 120 . ? 1_555 ? 3 AC1 4 HIS A 120 ? HIS A 120 . ? 2_655 ? 4 AC1 4 GLY A 121 ? GLY A 121 . ? 1_555 ? # _atom_sites.entry_id 4X1L _atom_sites.fract_transf_matrix[1][1] 0.013466 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008632 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.031407 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019466 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 SER 57 57 ? ? ? A . n A 1 58 SER 58 58 ? ? ? A . n A 1 59 PHE 59 59 ? ? ? A . n A 1 60 TYR 60 60 ? ? ? A . n A 1 61 VAL 61 61 ? ? ? A . n A 1 62 ASN 62 62 ? ? ? A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 SER 92 92 ? ? ? A . n A 1 93 THR 93 93 ? ? ? A . n A 1 94 GLY 94 94 ? ? ? A . n A 1 95 GLY 95 95 ? ? ? A . n A 1 96 ALA 96 96 ? ? ? A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 TYR 140 140 140 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 201 141 PO4 PO4 A . C 3 HOH 1 301 19 HOH HOH A . C 3 HOH 2 302 30 HOH HOH A . C 3 HOH 3 303 4 HOH HOH A . C 3 HOH 4 304 7 HOH HOH A . C 3 HOH 5 305 42 HOH HOH A . C 3 HOH 6 306 32 HOH HOH A . C 3 HOH 7 307 56 HOH HOH A . C 3 HOH 8 308 29 HOH HOH A . C 3 HOH 9 309 21 HOH HOH A . C 3 HOH 10 310 31 HOH HOH A . C 3 HOH 11 311 47 HOH HOH A . C 3 HOH 12 312 43 HOH HOH A . C 3 HOH 13 313 33 HOH HOH A . C 3 HOH 14 314 11 HOH HOH A . C 3 HOH 15 315 52 HOH HOH A . C 3 HOH 16 316 59 HOH HOH A . C 3 HOH 17 317 61 HOH HOH A . C 3 HOH 18 318 53 HOH HOH A . C 3 HOH 19 319 14 HOH HOH A . C 3 HOH 20 320 37 HOH HOH A . C 3 HOH 21 321 22 HOH HOH A . C 3 HOH 22 322 6 HOH HOH A . C 3 HOH 23 323 45 HOH HOH A . C 3 HOH 24 324 50 HOH HOH A . C 3 HOH 25 325 35 HOH HOH A . C 3 HOH 26 326 44 HOH HOH A . C 3 HOH 27 327 46 HOH HOH A . C 3 HOH 28 328 25 HOH HOH A . C 3 HOH 29 329 1 HOH HOH A . C 3 HOH 30 330 2 HOH HOH A . C 3 HOH 31 331 3 HOH HOH A . C 3 HOH 32 332 5 HOH HOH A . C 3 HOH 33 333 8 HOH HOH A . C 3 HOH 34 334 9 HOH HOH A . C 3 HOH 35 335 10 HOH HOH A . C 3 HOH 36 336 12 HOH HOH A . C 3 HOH 37 337 13 HOH HOH A . C 3 HOH 38 338 15 HOH HOH A . C 3 HOH 39 339 16 HOH HOH A . C 3 HOH 40 340 17 HOH HOH A . C 3 HOH 41 341 18 HOH HOH A . C 3 HOH 42 342 20 HOH HOH A . C 3 HOH 43 343 23 HOH HOH A . C 3 HOH 44 344 24 HOH HOH A . C 3 HOH 45 345 26 HOH HOH A . C 3 HOH 46 346 27 HOH HOH A . C 3 HOH 47 347 28 HOH HOH A . C 3 HOH 48 348 34 HOH HOH A . C 3 HOH 49 349 36 HOH HOH A . C 3 HOH 50 350 38 HOH HOH A . C 3 HOH 51 351 39 HOH HOH A . C 3 HOH 52 352 40 HOH HOH A . C 3 HOH 53 353 41 HOH HOH A . C 3 HOH 54 354 48 HOH HOH A . C 3 HOH 55 355 49 HOH HOH A . C 3 HOH 56 356 51 HOH HOH A . C 3 HOH 57 357 54 HOH HOH A . C 3 HOH 58 358 55 HOH HOH A . C 3 HOH 59 359 57 HOH HOH A . C 3 HOH 60 360 58 HOH HOH A . C 3 HOH 61 361 60 HOH HOH A . C 3 HOH 62 362 62 HOH HOH A . C 3 HOH 63 363 63 HOH HOH A . C 3 HOH 64 364 64 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-06-10 2 'Structure model' 1 1 2015-07-01 3 'Structure model' 1 2 2015-07-15 4 'Structure model' 1 3 2017-09-13 5 'Structure model' 1 4 2017-11-22 6 'Structure model' 1 5 2019-12-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Refinement description' 9 6 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' entity_src_gen 3 4 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_keywords 7 5 'Structure model' software 8 6 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 4 'Structure model' '_pdbx_audit_support.funding_organization' 4 4 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 4 'Structure model' '_struct_keywords.text' 7 5 'Structure model' '_software.classification' 8 6 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 7 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 327 ? ? O A HOH 352 ? ? 1.87 2 1 O A HOH 355 ? ? O A HOH 360 ? ? 2.05 3 1 O A HOH 323 ? ? O A HOH 358 ? ? 2.13 4 1 O A HOH 360 ? ? O A HOH 361 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 27 ? ? 59.82 -69.73 2 1 LYS A 38 ? ? -117.32 -146.93 3 1 LYS A 108 ? ? -143.18 -4.17 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 54 ? CG ? A LYS 54 CG 2 1 Y 1 A LYS 54 ? CD ? A LYS 54 CD 3 1 Y 1 A LYS 54 ? CE ? A LYS 54 CE 4 1 Y 1 A LYS 54 ? NZ ? A LYS 54 NZ 5 1 Y 1 A LYS 70 ? CG ? A LYS 70 CG 6 1 Y 1 A LYS 70 ? CD ? A LYS 70 CD 7 1 Y 1 A LYS 70 ? CE ? A LYS 70 CE 8 1 Y 1 A LYS 70 ? NZ ? A LYS 70 NZ 9 1 Y 1 A ILE 74 ? CG1 ? A ILE 74 CG1 10 1 Y 1 A ILE 74 ? CG2 ? A ILE 74 CG2 11 1 Y 1 A ILE 74 ? CD1 ? A ILE 74 CD1 12 1 Y 1 A ARG 75 ? CG ? A ARG 75 CG 13 1 Y 1 A ARG 75 ? CD ? A ARG 75 CD 14 1 Y 1 A ARG 75 ? NE ? A ARG 75 NE 15 1 Y 1 A ARG 75 ? CZ ? A ARG 75 CZ 16 1 Y 1 A ARG 75 ? NH1 ? A ARG 75 NH1 17 1 Y 1 A ARG 75 ? NH2 ? A ARG 75 NH2 18 1 Y 1 A LEU 79 ? CG ? A LEU 79 CG 19 1 Y 1 A LEU 79 ? CD1 ? A LEU 79 CD1 20 1 Y 1 A LEU 79 ? CD2 ? A LEU 79 CD2 21 1 Y 1 A GLN 80 ? CG ? A GLN 80 CG 22 1 Y 1 A GLN 80 ? CD ? A GLN 80 CD 23 1 Y 1 A GLN 80 ? OE1 ? A GLN 80 OE1 24 1 Y 1 A GLN 80 ? NE2 ? A GLN 80 NE2 25 1 Y 1 A ASP 81 ? CG ? A ASP 81 CG 26 1 Y 1 A ASP 81 ? OD1 ? A ASP 81 OD1 27 1 Y 1 A ASP 81 ? OD2 ? A ASP 81 OD2 28 1 Y 1 A GLU 83 ? CG ? A GLU 83 CG 29 1 Y 1 A GLU 83 ? CD ? A GLU 83 CD 30 1 Y 1 A GLU 83 ? OE1 ? A GLU 83 OE1 31 1 Y 1 A GLU 83 ? OE2 ? A GLU 83 OE2 32 1 Y 1 A ARG 89 ? CG ? A ARG 89 CG 33 1 Y 1 A ARG 89 ? CD ? A ARG 89 CD 34 1 Y 1 A ARG 89 ? NE ? A ARG 89 NE 35 1 Y 1 A ARG 89 ? CZ ? A ARG 89 CZ 36 1 Y 1 A ARG 89 ? NH1 ? A ARG 89 NH1 37 1 Y 1 A ARG 89 ? NH2 ? A ARG 89 NH2 38 1 Y 1 A LYS 91 ? CG ? A LYS 91 CG 39 1 Y 1 A LYS 91 ? CD ? A LYS 91 CD 40 1 Y 1 A LYS 91 ? CE ? A LYS 91 CE 41 1 Y 1 A LYS 91 ? NZ ? A LYS 91 NZ 42 1 Y 1 A LYS 108 ? CG ? A LYS 108 CG 43 1 Y 1 A LYS 108 ? CD ? A LYS 108 CD 44 1 Y 1 A LYS 108 ? CE ? A LYS 108 CE 45 1 Y 1 A LYS 108 ? NZ ? A LYS 108 NZ 46 1 Y 1 A GLU 117 ? CG ? A GLU 117 CG 47 1 Y 1 A GLU 117 ? CD ? A GLU 117 CD 48 1 Y 1 A GLU 117 ? OE1 ? A GLU 117 OE1 49 1 Y 1 A GLU 117 ? OE2 ? A GLU 117 OE2 50 1 Y 1 A ARG 137 ? CG ? A ARG 137 CG 51 1 Y 1 A ARG 137 ? CD ? A ARG 137 CD 52 1 Y 1 A ARG 137 ? NE ? A ARG 137 NE 53 1 Y 1 A ARG 137 ? CZ ? A ARG 137 CZ 54 1 Y 1 A ARG 137 ? NH1 ? A ARG 137 NH1 55 1 Y 1 A ARG 137 ? NH2 ? A ARG 137 NH2 56 1 Y 1 A GLN 139 ? CG ? A GLN 139 CG 57 1 Y 1 A GLN 139 ? CD ? A GLN 139 CD 58 1 Y 1 A GLN 139 ? OE1 ? A GLN 139 OE1 59 1 Y 1 A GLN 139 ? NE2 ? A GLN 139 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 57 ? A SER 57 4 1 Y 1 A SER 58 ? A SER 58 5 1 Y 1 A PHE 59 ? A PHE 59 6 1 Y 1 A TYR 60 ? A TYR 60 7 1 Y 1 A VAL 61 ? A VAL 61 8 1 Y 1 A ASN 62 ? A ASN 62 9 1 Y 1 A SER 92 ? A SER 92 10 1 Y 1 A THR 93 ? A THR 93 11 1 Y 1 A GLY 94 ? A GLY 94 12 1 Y 1 A GLY 95 ? A GLY 95 13 1 Y 1 A ALA 96 ? A ALA 96 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' 'R01 NS090352' 1 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' 'R01 NS078145' 2 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' 'R01 NS067206' 3 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' 'R01 NS073873' 4 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'P01 GM091743' 5 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'P01 GM091743-03S1' 6 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM53846' 7 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH #