data_4XA3 # _entry.id 4XA3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4XA3 WWPDB D_1000205313 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '4XA1 contains the coiled-coil surrounding Skip 1 of MYH7.' 4XA1 unspecified PDB . 4XA4 unspecified PDB . 4XA6 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XA3 _pdbx_database_status.recvd_initial_deposition_date 2014-12-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Taylor, K.C.' 1 'Buvoli, M.' 2 'Korkmaz, E.N.' 3 'Buvoli, A.' 4 'Zheng, Y.' 5 'Heinz, N.T.' 6 'Qiang, C.' 7 'Leinwand, L.A.' 8 'Rayment, I.' 9 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 112 _citation.language ? _citation.page_first E3806 _citation.page_last E3815 _citation.title 'Skip residues modulate the structural properties of the myosin rod and guide thick filament assembly.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1505813112 _citation.pdbx_database_id_PubMed 26150528 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Taylor, K.C.' 1 ? primary 'Buvoli, M.' 2 ? primary 'Korkmaz, E.N.' 3 ? primary 'Buvoli, A.' 4 ? primary 'Zheng, Y.' 5 ? primary 'Heinze, N.T.' 6 ? primary 'Cui, Q.' 7 ? primary 'Leinwand, L.A.' 8 ? primary 'Rayment, I.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4XA3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.462 _cell.length_a_esd ? _cell.length_b 146.115 _cell.length_b_esd ? _cell.length_c 153.443 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XA3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gp7-MYH7(1361-1425)-Eb1 chimera protein' 17765.717 2 ? ? 'UNP P13848 residues 1-49,UNP P12883 residues 1361-1425,UNP Q15691 residues 215-251' ? 2 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'chimera protein of Head morphogenesis protein, Myosin-7 and Microtubule-associated protein RP/EB family member 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GASMPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSLSKANSEVAQWRTKYETDAIQRTEELEE AKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDE ; _entity_poly.pdbx_seq_one_letter_code_can ;GASMPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSLSKANSEVAQWRTKYETDAIQRTEELEE AKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 SER n 1 4 MET n 1 5 PRO n 1 6 LEU n 1 7 LYS n 1 8 PRO n 1 9 GLU n 1 10 GLU n 1 11 HIS n 1 12 GLU n 1 13 ASP n 1 14 ILE n 1 15 LEU n 1 16 ASN n 1 17 LYS n 1 18 LEU n 1 19 LEU n 1 20 ASP n 1 21 PRO n 1 22 GLU n 1 23 LEU n 1 24 ALA n 1 25 GLN n 1 26 SER n 1 27 GLU n 1 28 ARG n 1 29 THR n 1 30 GLU n 1 31 ALA n 1 32 LEU n 1 33 GLN n 1 34 GLN n 1 35 LEU n 1 36 ARG n 1 37 VAL n 1 38 ASN n 1 39 TYR n 1 40 GLY n 1 41 SER n 1 42 PHE n 1 43 VAL n 1 44 SER n 1 45 GLU n 1 46 TYR n 1 47 ASN n 1 48 ASP n 1 49 LEU n 1 50 THR n 1 51 LYS n 1 52 SER n 1 53 LEU n 1 54 SER n 1 55 LYS n 1 56 ALA n 1 57 ASN n 1 58 SER n 1 59 GLU n 1 60 VAL n 1 61 ALA n 1 62 GLN n 1 63 TRP n 1 64 ARG n 1 65 THR n 1 66 LYS n 1 67 TYR n 1 68 GLU n 1 69 THR n 1 70 ASP n 1 71 ALA n 1 72 ILE n 1 73 GLN n 1 74 ARG n 1 75 THR n 1 76 GLU n 1 77 GLU n 1 78 LEU n 1 79 GLU n 1 80 GLU n 1 81 ALA n 1 82 LYS n 1 83 LYS n 1 84 LYS n 1 85 LEU n 1 86 ALA n 1 87 GLN n 1 88 ARG n 1 89 LEU n 1 90 GLN n 1 91 GLU n 1 92 ALA n 1 93 GLU n 1 94 GLU n 1 95 ALA n 1 96 VAL n 1 97 GLU n 1 98 ALA n 1 99 VAL n 1 100 ASN n 1 101 ALA n 1 102 LYS n 1 103 CYS n 1 104 SER n 1 105 SER n 1 106 LEU n 1 107 GLU n 1 108 LYS n 1 109 THR n 1 110 LYS n 1 111 HIS n 1 112 ARG n 1 113 LEU n 1 114 GLN n 1 115 ASN n 1 116 GLU n 1 117 ILE n 1 118 ASP n 1 119 PHE n 1 120 TYR n 1 121 PHE n 1 122 GLY n 1 123 LYS n 1 124 LEU n 1 125 ARG n 1 126 ASN n 1 127 ILE n 1 128 GLU n 1 129 LEU n 1 130 ILE n 1 131 CYS n 1 132 GLN n 1 133 GLU n 1 134 ASN n 1 135 GLU n 1 136 GLY n 1 137 GLU n 1 138 ASN n 1 139 ASP n 1 140 PRO n 1 141 VAL n 1 142 LEU n 1 143 GLN n 1 144 ARG n 1 145 ILE n 1 146 VAL n 1 147 ASP n 1 148 ILE n 1 149 LEU n 1 150 TYR n 1 151 ALA n 1 152 THR n 1 153 ASP n 1 154 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 52 ? ? ? ? ? ? ? ? ? 'Bacillus phage phi29' 10756 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? pET28 ? ? 1 2 sample 'Biological sequence' 53 117 Human ? 'MYH7, MYHCB' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? pET28 ? ? 1 3 sample 'Biological sequence' 118 154 Human ? MAPRE1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? pET28 ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VG7_BPPH2 P13848 ? 1 MPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKS 1 2 UNP MYH7_HUMAN P12883 ? 1 LSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEI 1361 3 UNP MARE1_HUMAN Q15691 ? 1 DFYFGKLRNIELICQENEGENDPVLQRIVDILYATDE 215 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4XA3 A 4 ? 52 ? P13848 1 ? 49 ? 1 49 2 2 4XA3 A 53 ? 117 ? P12883 1361 ? 1425 ? 1361 1425 3 3 4XA3 A 118 ? 154 ? Q15691 215 ? 251 ? 215 251 4 1 4XA3 B 4 ? 52 ? P13848 1 ? 49 ? 1 49 5 2 4XA3 B 53 ? 117 ? P12883 1361 ? 1425 ? 1361 1425 6 3 4XA3 B 118 ? 154 ? Q15691 215 ? 251 ? 215 251 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4XA3 GLY A 1 ? UNP P13848 ? ? 'expression tag' -2 1 1 4XA3 ALA A 2 ? UNP P13848 ? ? 'expression tag' -1 2 1 4XA3 SER A 3 ? UNP P13848 ? ? 'expression tag' 0 3 4 4XA3 GLY B 1 ? UNP P13848 ? ? 'expression tag' -2 4 4 4XA3 ALA B 2 ? UNP P13848 ? ? 'expression tag' -1 5 4 4XA3 SER B 3 ? UNP P13848 ? ? 'expression tag' 0 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XA3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.96 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '4.5% (w/v) polyethylene glycol 8000, 100 mM sodium acetate pH 5.0, 50 mM CaCl2, 2.5% (w/v) 3-methoxy-3-methyl-1-butanol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-12-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Rosenbaum-Rock double-crystal monochromator: Water cooled; sagitally focusing 2nd crystal, Rosenbaum-Rock vertical focusing mirror' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9790 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9790 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 32.5 _reflns.entry_id 4XA3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.54 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11019 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 87 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 24.1 _reflns.pdbx_netI_over_sigmaI 16.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.54 _reflns_shell.d_res_low 2.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 53 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.48 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 45.6 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XA3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.548 _refine.ls_d_res_low 29.726 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11005 _refine.ls_number_reflns_R_free 547 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 76.98 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2690 _refine.ls_R_factor_R_free 0.3114 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2668 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '1NO4, 1YIB' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random Selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.15 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.36 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2313 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 2330 _refine_hist.d_res_high 2.548 _refine_hist.d_res_low 29.726 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2340 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.656 ? 3148 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.470 ? 919 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.025 ? 354 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 414 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5477 2.8039 . . 55 1072 32.00 . . . 0.3167 . 0.3344 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8039 3.2092 . . 136 2478 74.00 . . . 0.3923 . 0.3244 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2092 4.0417 . . 170 3385 100.00 . . . 0.2999 . 0.2679 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0417 29.7281 . . 186 3523 100.00 . . . 0.2908 . 0.2383 . . . . . . . . . . # _struct.entry_id 4XA3 _struct.title 'Crystal structure of the coiled-coil surrounding Skip 2 of MYH7' _struct.pdbx_descriptor 'Gp7-MYH7(1361-1425)-Eb1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XA3 _struct_keywords.text 'Myosin, coiled coil, skip residue, Fusion, Gp7, Eb1, Cardiac, MOTOR PROTEIN' _struct_keywords.pdbx_keywords 'MOTOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 7 ? ASP A 20 ? LYS A 4 ASP A 17 1 ? 14 HELX_P HELX_P2 AA2 ALA A 24 ? ASN A 134 ? ALA A 21 ASN A 231 1 ? 111 HELX_P HELX_P3 AA3 PRO A 140 ? LEU A 149 ? PRO A 237 LEU A 246 1 ? 10 HELX_P HELX_P4 AA4 LYS B 7 ? ASP B 20 ? LYS B 4 ASP B 17 1 ? 14 HELX_P HELX_P5 AA5 ALA B 24 ? TYR B 67 ? ALA B 21 TYR B 1375 1 ? 44 HELX_P HELX_P6 AA6 TYR B 67 ? ASN B 134 ? TYR B 1375 ASN B 231 1 ? 68 HELX_P HELX_P7 AA7 PRO B 140 ? ASP B 147 ? PRO B 237 ASP B 244 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 4XA3 _atom_sites.fract_transf_matrix[1][1] 0.026694 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006844 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006517 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 ALA 2 -1 ? ? ? A . n A 1 3 SER 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 PRO 5 2 2 PRO PRO A . n A 1 6 LEU 6 3 3 LEU LEU A . n A 1 7 LYS 7 4 4 LYS LYS A . n A 1 8 PRO 8 5 5 PRO PRO A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 HIS 11 8 8 HIS HIS A . n A 1 12 GLU 12 9 9 GLU GLU A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 ASN 16 13 13 ASN ASN A . n A 1 17 LYS 17 14 14 LYS LYS A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 ASP 20 17 17 ASP ASP A . n A 1 21 PRO 21 18 18 PRO PRO A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 GLN 25 22 22 GLN GLN A . n A 1 26 SER 26 23 23 SER SER A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 ARG 28 25 25 ARG ARG A . n A 1 29 THR 29 26 26 THR THR A . n A 1 30 GLU 30 27 27 GLU GLU A . n A 1 31 ALA 31 28 28 ALA ALA A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 GLN 33 30 30 GLN GLN A . n A 1 34 GLN 34 31 31 GLN GLN A . n A 1 35 LEU 35 32 32 LEU LEU A . n A 1 36 ARG 36 33 33 ARG ARG A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 ASN 38 35 35 ASN ASN A . n A 1 39 TYR 39 36 36 TYR TYR A . n A 1 40 GLY 40 37 37 GLY GLY A . n A 1 41 SER 41 38 38 SER SER A . n A 1 42 PHE 42 39 39 PHE PHE A . n A 1 43 VAL 43 40 40 VAL VAL A . n A 1 44 SER 44 41 41 SER SER A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 TYR 46 43 43 TYR TYR A . n A 1 47 ASN 47 44 44 ASN ASN A . n A 1 48 ASP 48 45 45 ASP ASP A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 THR 50 47 47 THR THR A . n A 1 51 LYS 51 48 48 LYS LYS A . n A 1 52 SER 52 49 49 SER SER A . n A 1 53 LEU 53 1361 1361 LEU LEU A . n A 1 54 SER 54 1362 1362 SER SER A . n A 1 55 LYS 55 1363 1363 LYS LYS A . n A 1 56 ALA 56 1364 1364 ALA ALA A . n A 1 57 ASN 57 1365 1365 ASN ASN A . n A 1 58 SER 58 1366 1366 SER SER A . n A 1 59 GLU 59 1367 1367 GLU GLU A . n A 1 60 VAL 60 1368 1368 VAL VAL A . n A 1 61 ALA 61 1369 1369 ALA ALA A . n A 1 62 GLN 62 1370 1370 GLN GLN A . n A 1 63 TRP 63 1371 1371 TRP TRP A . n A 1 64 ARG 64 1372 1372 ARG ARG A . n A 1 65 THR 65 1373 1373 THR THR A . n A 1 66 LYS 66 1374 1374 LYS LYS A . n A 1 67 TYR 67 1375 1375 TYR TYR A . n A 1 68 GLU 68 1376 1376 GLU GLU A . n A 1 69 THR 69 1377 1377 THR THR A . n A 1 70 ASP 70 1378 1378 ASP ASP A . n A 1 71 ALA 71 1379 1379 ALA ALA A . n A 1 72 ILE 72 1380 1380 ILE ILE A . n A 1 73 GLN 73 1381 1381 GLN GLN A . n A 1 74 ARG 74 1382 1382 ARG ARG A . n A 1 75 THR 75 1383 1383 THR THR A . n A 1 76 GLU 76 1384 1384 GLU GLU A . n A 1 77 GLU 77 1385 1385 GLU GLU A . n A 1 78 LEU 78 1386 1386 LEU LEU A . n A 1 79 GLU 79 1387 1387 GLU GLU A . n A 1 80 GLU 80 1388 1388 GLU GLU A . n A 1 81 ALA 81 1389 1389 ALA ALA A . n A 1 82 LYS 82 1390 1390 LYS LYS A . n A 1 83 LYS 83 1391 1391 LYS LYS A . n A 1 84 LYS 84 1392 1392 LYS LYS A . n A 1 85 LEU 85 1393 1393 LEU LEU A . n A 1 86 ALA 86 1394 1394 ALA ALA A . n A 1 87 GLN 87 1395 1395 GLN GLN A . n A 1 88 ARG 88 1396 1396 ARG ARG A . n A 1 89 LEU 89 1397 1397 LEU LEU A . n A 1 90 GLN 90 1398 1398 GLN GLN A . n A 1 91 GLU 91 1399 1399 GLU GLU A . n A 1 92 ALA 92 1400 1400 ALA ALA A . n A 1 93 GLU 93 1401 1401 GLU GLU A . n A 1 94 GLU 94 1402 1402 GLU GLU A . n A 1 95 ALA 95 1403 1403 ALA ALA A . n A 1 96 VAL 96 1404 1404 VAL VAL A . n A 1 97 GLU 97 1405 1405 GLU GLU A . n A 1 98 ALA 98 1406 1406 ALA ALA A . n A 1 99 VAL 99 1407 1407 VAL VAL A . n A 1 100 ASN 100 1408 1408 ASN ASN A . n A 1 101 ALA 101 1409 1409 ALA ALA A . n A 1 102 LYS 102 1410 1410 LYS LYS A . n A 1 103 CYS 103 1411 1411 CYS CYS A . n A 1 104 SER 104 1412 1412 SER SER A . n A 1 105 SER 105 1413 1413 SER SER A . n A 1 106 LEU 106 1414 1414 LEU LEU A . n A 1 107 GLU 107 1415 1415 GLU GLU A . n A 1 108 LYS 108 1416 1416 LYS LYS A . n A 1 109 THR 109 1417 1417 THR THR A . n A 1 110 LYS 110 1418 1418 LYS LYS A . n A 1 111 HIS 111 1419 1419 HIS HIS A . n A 1 112 ARG 112 1420 1420 ARG ARG A . n A 1 113 LEU 113 1421 1421 LEU LEU A . n A 1 114 GLN 114 1422 1422 GLN GLN A . n A 1 115 ASN 115 1423 1423 ASN ASN A . n A 1 116 GLU 116 1424 1424 GLU GLU A . n A 1 117 ILE 117 1425 1425 ILE ILE A . n A 1 118 ASP 118 215 215 ASP ASP A . n A 1 119 PHE 119 216 216 PHE PHE A . n A 1 120 TYR 120 217 217 TYR TYR A . n A 1 121 PHE 121 218 218 PHE PHE A . n A 1 122 GLY 122 219 219 GLY GLY A . n A 1 123 LYS 123 220 220 LYS LYS A . n A 1 124 LEU 124 221 221 LEU LEU A . n A 1 125 ARG 125 222 222 ARG ARG A . n A 1 126 ASN 126 223 223 ASN ASN A . n A 1 127 ILE 127 224 224 ILE ILE A . n A 1 128 GLU 128 225 225 GLU GLU A . n A 1 129 LEU 129 226 226 LEU LEU A . n A 1 130 ILE 130 227 227 ILE ILE A . n A 1 131 CYS 131 228 228 CYS CYS A . n A 1 132 GLN 132 229 229 GLN GLN A . n A 1 133 GLU 133 230 230 GLU GLU A . n A 1 134 ASN 134 231 231 ASN ASN A . n A 1 135 GLU 135 232 ? ? ? A . n A 1 136 GLY 136 233 ? ? ? A . n A 1 137 GLU 137 234 ? ? ? A . n A 1 138 ASN 138 235 ? ? ? A . n A 1 139 ASP 139 236 236 ASP ASP A . n A 1 140 PRO 140 237 237 PRO PRO A . n A 1 141 VAL 141 238 238 VAL VAL A . n A 1 142 LEU 142 239 239 LEU LEU A . n A 1 143 GLN 143 240 240 GLN GLN A . n A 1 144 ARG 144 241 241 ARG ARG A . n A 1 145 ILE 145 242 242 ILE ILE A . n A 1 146 VAL 146 243 243 VAL VAL A . n A 1 147 ASP 147 244 244 ASP ASP A . n A 1 148 ILE 148 245 245 ILE ILE A . n A 1 149 LEU 149 246 246 LEU LEU A . n A 1 150 TYR 150 247 247 TYR TYR A . n A 1 151 ALA 151 248 ? ? ? A . n A 1 152 THR 152 249 ? ? ? A . n A 1 153 ASP 153 250 ? ? ? A . n A 1 154 GLU 154 251 ? ? ? A . n B 1 1 GLY 1 -2 ? ? ? B . n B 1 2 ALA 2 -1 ? ? ? B . n B 1 3 SER 3 0 ? ? ? B . n B 1 4 MET 4 1 1 MET MET B . n B 1 5 PRO 5 2 2 PRO PRO B . n B 1 6 LEU 6 3 3 LEU LEU B . n B 1 7 LYS 7 4 4 LYS LYS B . n B 1 8 PRO 8 5 5 PRO PRO B . n B 1 9 GLU 9 6 6 GLU GLU B . n B 1 10 GLU 10 7 7 GLU GLU B . n B 1 11 HIS 11 8 8 HIS HIS B . n B 1 12 GLU 12 9 9 GLU GLU B . n B 1 13 ASP 13 10 10 ASP ASP B . n B 1 14 ILE 14 11 11 ILE ILE B . n B 1 15 LEU 15 12 12 LEU LEU B . n B 1 16 ASN 16 13 13 ASN ASN B . n B 1 17 LYS 17 14 14 LYS LYS B . n B 1 18 LEU 18 15 15 LEU LEU B . n B 1 19 LEU 19 16 16 LEU LEU B . n B 1 20 ASP 20 17 17 ASP ASP B . n B 1 21 PRO 21 18 18 PRO PRO B . n B 1 22 GLU 22 19 19 GLU GLU B . n B 1 23 LEU 23 20 20 LEU LEU B . n B 1 24 ALA 24 21 21 ALA ALA B . n B 1 25 GLN 25 22 22 GLN GLN B . n B 1 26 SER 26 23 23 SER SER B . n B 1 27 GLU 27 24 24 GLU GLU B . n B 1 28 ARG 28 25 25 ARG ARG B . n B 1 29 THR 29 26 26 THR THR B . n B 1 30 GLU 30 27 27 GLU GLU B . n B 1 31 ALA 31 28 28 ALA ALA B . n B 1 32 LEU 32 29 29 LEU LEU B . n B 1 33 GLN 33 30 30 GLN GLN B . n B 1 34 GLN 34 31 31 GLN GLN B . n B 1 35 LEU 35 32 32 LEU LEU B . n B 1 36 ARG 36 33 33 ARG ARG B . n B 1 37 VAL 37 34 34 VAL VAL B . n B 1 38 ASN 38 35 35 ASN ASN B . n B 1 39 TYR 39 36 36 TYR TYR B . n B 1 40 GLY 40 37 37 GLY GLY B . n B 1 41 SER 41 38 38 SER SER B . n B 1 42 PHE 42 39 39 PHE PHE B . n B 1 43 VAL 43 40 40 VAL VAL B . n B 1 44 SER 44 41 41 SER SER B . n B 1 45 GLU 45 42 42 GLU GLU B . n B 1 46 TYR 46 43 43 TYR TYR B . n B 1 47 ASN 47 44 44 ASN ASN B . n B 1 48 ASP 48 45 45 ASP ASP B . n B 1 49 LEU 49 46 46 LEU LEU B . n B 1 50 THR 50 47 47 THR THR B . n B 1 51 LYS 51 48 48 LYS LYS B . n B 1 52 SER 52 49 49 SER SER B . n B 1 53 LEU 53 1361 1361 LEU LEU B . n B 1 54 SER 54 1362 1362 SER SER B . n B 1 55 LYS 55 1363 1363 LYS LYS B . n B 1 56 ALA 56 1364 1364 ALA ALA B . n B 1 57 ASN 57 1365 1365 ASN ASN B . n B 1 58 SER 58 1366 1366 SER SER B . n B 1 59 GLU 59 1367 1367 GLU GLU B . n B 1 60 VAL 60 1368 1368 VAL VAL B . n B 1 61 ALA 61 1369 1369 ALA ALA B . n B 1 62 GLN 62 1370 1370 GLN GLN B . n B 1 63 TRP 63 1371 1371 TRP TRP B . n B 1 64 ARG 64 1372 1372 ARG ARG B . n B 1 65 THR 65 1373 1373 THR THR B . n B 1 66 LYS 66 1374 1374 LYS LYS B . n B 1 67 TYR 67 1375 1375 TYR TYR B . n B 1 68 GLU 68 1376 1376 GLU GLU B . n B 1 69 THR 69 1377 1377 THR THR B . n B 1 70 ASP 70 1378 1378 ASP ASP B . n B 1 71 ALA 71 1379 1379 ALA ALA B . n B 1 72 ILE 72 1380 1380 ILE ILE B . n B 1 73 GLN 73 1381 1381 GLN GLN B . n B 1 74 ARG 74 1382 1382 ARG ARG B . n B 1 75 THR 75 1383 1383 THR THR B . n B 1 76 GLU 76 1384 1384 GLU GLU B . n B 1 77 GLU 77 1385 1385 GLU GLU B . n B 1 78 LEU 78 1386 1386 LEU LEU B . n B 1 79 GLU 79 1387 1387 GLU GLU B . n B 1 80 GLU 80 1388 1388 GLU GLU B . n B 1 81 ALA 81 1389 1389 ALA ALA B . n B 1 82 LYS 82 1390 1390 LYS LYS B . n B 1 83 LYS 83 1391 1391 LYS LYS B . n B 1 84 LYS 84 1392 1392 LYS LYS B . n B 1 85 LEU 85 1393 1393 LEU LEU B . n B 1 86 ALA 86 1394 1394 ALA ALA B . n B 1 87 GLN 87 1395 1395 GLN GLN B . n B 1 88 ARG 88 1396 1396 ARG ARG B . n B 1 89 LEU 89 1397 1397 LEU LEU B . n B 1 90 GLN 90 1398 1398 GLN GLN B . n B 1 91 GLU 91 1399 1399 GLU GLU B . n B 1 92 ALA 92 1400 1400 ALA ALA B . n B 1 93 GLU 93 1401 1401 GLU GLU B . n B 1 94 GLU 94 1402 1402 GLU GLU B . n B 1 95 ALA 95 1403 1403 ALA ALA B . n B 1 96 VAL 96 1404 1404 VAL VAL B . n B 1 97 GLU 97 1405 1405 GLU GLU B . n B 1 98 ALA 98 1406 1406 ALA ALA B . n B 1 99 VAL 99 1407 1407 VAL VAL B . n B 1 100 ASN 100 1408 1408 ASN ASN B . n B 1 101 ALA 101 1409 1409 ALA ALA B . n B 1 102 LYS 102 1410 1410 LYS LYS B . n B 1 103 CYS 103 1411 1411 CYS CYS B . n B 1 104 SER 104 1412 1412 SER SER B . n B 1 105 SER 105 1413 1413 SER SER B . n B 1 106 LEU 106 1414 1414 LEU LEU B . n B 1 107 GLU 107 1415 1415 GLU GLU B . n B 1 108 LYS 108 1416 1416 LYS LYS B . n B 1 109 THR 109 1417 1417 THR THR B . n B 1 110 LYS 110 1418 1418 LYS LYS B . n B 1 111 HIS 111 1419 1419 HIS HIS B . n B 1 112 ARG 112 1420 1420 ARG ARG B . n B 1 113 LEU 113 1421 1421 LEU LEU B . n B 1 114 GLN 114 1422 1422 GLN GLN B . n B 1 115 ASN 115 1423 1423 ASN ASN B . n B 1 116 GLU 116 1424 1424 GLU GLU B . n B 1 117 ILE 117 1425 1425 ILE ILE B . n B 1 118 ASP 118 215 215 ASP ASP B . n B 1 119 PHE 119 216 216 PHE PHE B . n B 1 120 TYR 120 217 217 TYR TYR B . n B 1 121 PHE 121 218 218 PHE PHE B . n B 1 122 GLY 122 219 219 GLY GLY B . n B 1 123 LYS 123 220 220 LYS LYS B . n B 1 124 LEU 124 221 221 LEU LEU B . n B 1 125 ARG 125 222 222 ARG ARG B . n B 1 126 ASN 126 223 223 ASN ASN B . n B 1 127 ILE 127 224 224 ILE ILE B . n B 1 128 GLU 128 225 225 GLU GLU B . n B 1 129 LEU 129 226 226 LEU LEU B . n B 1 130 ILE 130 227 227 ILE ILE B . n B 1 131 CYS 131 228 228 CYS CYS B . n B 1 132 GLN 132 229 229 GLN GLN B . n B 1 133 GLU 133 230 230 GLU GLU B . n B 1 134 ASN 134 231 231 ASN ASN B . n B 1 135 GLU 135 232 ? ? ? B . n B 1 136 GLY 136 233 ? ? ? B . n B 1 137 GLU 137 234 ? ? ? B . n B 1 138 ASN 138 235 ? ? ? B . n B 1 139 ASP 139 236 236 ASP ASP B . n B 1 140 PRO 140 237 237 PRO PRO B . n B 1 141 VAL 141 238 238 VAL VAL B . n B 1 142 LEU 142 239 239 LEU LEU B . n B 1 143 GLN 143 240 240 GLN GLN B . n B 1 144 ARG 144 241 241 ARG ARG B . n B 1 145 ILE 145 242 242 ILE ILE B . n B 1 146 VAL 146 243 243 VAL VAL B . n B 1 147 ASP 147 244 244 ASP ASP B . n B 1 148 ILE 148 245 245 ILE ILE B . n B 1 149 LEU 149 246 246 LEU LEU B . n B 1 150 TYR 150 247 ? ? ? B . n B 1 151 ALA 151 248 ? ? ? B . n B 1 152 THR 152 249 ? ? ? B . n B 1 153 ASP 153 250 ? ? ? B . n B 1 154 GLU 154 251 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 1501 2 HOH HOH A . C 2 HOH 2 1502 21 HOH HOH A . C 2 HOH 3 1503 36 HOH HOH A . C 2 HOH 4 1504 33 HOH HOH A . C 2 HOH 5 1505 5 HOH HOH A . C 2 HOH 6 1506 9 HOH HOH A . D 2 HOH 1 1501 26 HOH HOH B . D 2 HOH 2 1502 4 HOH HOH B . D 2 HOH 3 1503 31 HOH HOH B . D 2 HOH 4 1504 12 HOH HOH B . D 2 HOH 5 1505 1 HOH HOH B . D 2 HOH 6 1506 13 HOH HOH B . D 2 HOH 7 1507 20 HOH HOH B . D 2 HOH 8 1508 23 HOH HOH B . D 2 HOH 9 1509 25 HOH HOH B . D 2 HOH 10 1510 29 HOH HOH B . D 2 HOH 11 1511 30 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7350 ? 1 MORE -72 ? 1 'SSA (A^2)' 18690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-01 2 'Structure model' 1 1 2015-07-15 3 'Structure model' 1 2 2015-07-29 4 'Structure model' 1 3 2017-09-27 5 'Structure model' 1 4 2019-12-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Source and taxonomy' 7 5 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' entity_src_gen 3 4 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 4 'Structure model' '_pdbx_audit_support.funding_organization' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 5 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: dev_1819)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 246 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -77.84 _pdbx_validate_torsion.psi -167.97 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 236 ? CG ? A ASP 139 CG 2 1 Y 1 A ASP 236 ? OD1 ? A ASP 139 OD1 3 1 Y 1 A ASP 236 ? OD2 ? A ASP 139 OD2 4 1 Y 1 A VAL 238 ? CG1 ? A VAL 141 CG1 5 1 Y 1 A VAL 238 ? CG2 ? A VAL 141 CG2 6 1 Y 1 B ASP 236 ? CG ? B ASP 139 CG 7 1 Y 1 B ASP 236 ? OD1 ? B ASP 139 OD1 8 1 Y 1 B ASP 236 ? OD2 ? B ASP 139 OD2 9 1 Y 1 B LEU 246 ? CG ? B LEU 149 CG 10 1 Y 1 B LEU 246 ? CD1 ? B LEU 149 CD1 11 1 Y 1 B LEU 246 ? CD2 ? B LEU 149 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A ALA -1 ? A ALA 2 3 1 Y 1 A SER 0 ? A SER 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A GLU 232 ? A GLU 135 6 1 Y 1 A GLY 233 ? A GLY 136 7 1 Y 1 A GLU 234 ? A GLU 137 8 1 Y 1 A ASN 235 ? A ASN 138 9 1 Y 1 A ALA 248 ? A ALA 151 10 1 Y 1 A THR 249 ? A THR 152 11 1 Y 1 A ASP 250 ? A ASP 153 12 1 Y 1 A GLU 251 ? A GLU 154 13 1 Y 1 B GLY -2 ? B GLY 1 14 1 Y 1 B ALA -1 ? B ALA 2 15 1 Y 1 B SER 0 ? B SER 3 16 1 Y 1 B GLU 232 ? B GLU 135 17 1 Y 1 B GLY 233 ? B GLY 136 18 1 Y 1 B GLU 234 ? B GLU 137 19 1 Y 1 B ASN 235 ? B ASN 138 20 1 Y 1 B TYR 247 ? B TYR 150 21 1 Y 1 B ALA 248 ? B ALA 151 22 1 Y 1 B THR 249 ? B THR 152 23 1 Y 1 B ASP 250 ? B ASP 153 24 1 Y 1 B GLU 251 ? B GLU 154 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number HL111237 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #