data_4XAO # _entry.id 4XAO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.295 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4XAO WWPDB D_1000205353 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Same protein complexed with ehtinylestradiol' 4X1F unspecified PDB 'Same protein complexed with ehtinylestradiol and trans-nonachlor' 4X1G unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XAO _pdbx_database_status.recvd_initial_deposition_date 2014-12-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Delfosse, V.' 1 ? 'Huet, T.' 2 ? 'Bourguet, W.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 8089 _citation.page_last 8089 _citation.title 'Synergistic activation of human pregnane X receptor by binary cocktails of pharmaceutical and environmental compounds.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/ncomms9089 _citation.pdbx_database_id_PubMed 26333997 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Delfosse, V.' 1 primary 'Dendele, B.' 2 primary 'Huet, T.' 3 primary 'Grimaldi, M.' 4 primary 'Boulahtouf, A.' 5 primary 'Gerbal-Chaloin, S.' 6 primary 'Beucher, B.' 7 primary 'Roecklin, D.' 8 primary 'Muller, C.' 9 primary 'Rahmani, R.' 10 primary 'Cavailles, V.' 11 primary 'Daujat-Chavanieu, M.' 12 primary 'Vivat, V.' 13 primary 'Pascussi, J.M.' 14 primary 'Balaguer, P.' 15 primary 'Bourguet, W.' 16 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4XAO _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.300 _cell.length_a_esd ? _cell.length_b 92.300 _cell.length_b_esd ? _cell.length_c 86.300 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XAO _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear receptor subfamily 1 group I member 2' 36280.867 1 ? ? 'UNP residues 130-434' ? 2 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 1 ? ? ? ? 3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 4 water nat water 18.015 67 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Orphan nuclear receptor PAR1,Orphan nuclear receptor PXR,Pregnane X receptor,Steroid and xenobiotic receptor,SXR' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKKGHHHHHHGSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAK WSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKG AAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQ HRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKGHHHHHHGSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAK WSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKG AAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQ HRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 GLY n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 GLU n 1 14 ARG n 1 15 THR n 1 16 GLY n 1 17 THR n 1 18 GLN n 1 19 PRO n 1 20 LEU n 1 21 GLY n 1 22 VAL n 1 23 GLN n 1 24 GLY n 1 25 LEU n 1 26 THR n 1 27 GLU n 1 28 GLU n 1 29 GLN n 1 30 ARG n 1 31 MET n 1 32 MET n 1 33 ILE n 1 34 ARG n 1 35 GLU n 1 36 LEU n 1 37 MET n 1 38 ASP n 1 39 ALA n 1 40 GLN n 1 41 MET n 1 42 LYS n 1 43 THR n 1 44 PHE n 1 45 ASP n 1 46 THR n 1 47 THR n 1 48 PHE n 1 49 SER n 1 50 HIS n 1 51 PHE n 1 52 LYS n 1 53 ASN n 1 54 PHE n 1 55 ARG n 1 56 LEU n 1 57 PRO n 1 58 GLY n 1 59 VAL n 1 60 LEU n 1 61 SER n 1 62 SER n 1 63 GLY n 1 64 CYS n 1 65 GLU n 1 66 LEU n 1 67 PRO n 1 68 GLU n 1 69 SER n 1 70 LEU n 1 71 GLN n 1 72 ALA n 1 73 PRO n 1 74 SER n 1 75 ARG n 1 76 GLU n 1 77 GLU n 1 78 ALA n 1 79 ALA n 1 80 LYS n 1 81 TRP n 1 82 SER n 1 83 GLN n 1 84 VAL n 1 85 ARG n 1 86 LYS n 1 87 ASP n 1 88 LEU n 1 89 CYS n 1 90 SER n 1 91 LEU n 1 92 LYS n 1 93 VAL n 1 94 SER n 1 95 LEU n 1 96 GLN n 1 97 LEU n 1 98 ARG n 1 99 GLY n 1 100 GLU n 1 101 ASP n 1 102 GLY n 1 103 SER n 1 104 VAL n 1 105 TRP n 1 106 ASN n 1 107 TYR n 1 108 LYS n 1 109 PRO n 1 110 PRO n 1 111 ALA n 1 112 ASP n 1 113 SER n 1 114 GLY n 1 115 GLY n 1 116 LYS n 1 117 GLU n 1 118 ILE n 1 119 PHE n 1 120 SER n 1 121 LEU n 1 122 LEU n 1 123 PRO n 1 124 HIS n 1 125 MET n 1 126 ALA n 1 127 ASP n 1 128 MET n 1 129 SER n 1 130 THR n 1 131 TYR n 1 132 MET n 1 133 PHE n 1 134 LYS n 1 135 GLY n 1 136 ILE n 1 137 ILE n 1 138 SER n 1 139 PHE n 1 140 ALA n 1 141 LYS n 1 142 VAL n 1 143 ILE n 1 144 SER n 1 145 TYR n 1 146 PHE n 1 147 ARG n 1 148 ASP n 1 149 LEU n 1 150 PRO n 1 151 ILE n 1 152 GLU n 1 153 ASP n 1 154 GLN n 1 155 ILE n 1 156 SER n 1 157 LEU n 1 158 LEU n 1 159 LYS n 1 160 GLY n 1 161 ALA n 1 162 ALA n 1 163 PHE n 1 164 GLU n 1 165 LEU n 1 166 CYS n 1 167 GLN n 1 168 LEU n 1 169 ARG n 1 170 PHE n 1 171 ASN n 1 172 THR n 1 173 VAL n 1 174 PHE n 1 175 ASN n 1 176 ALA n 1 177 GLU n 1 178 THR n 1 179 GLY n 1 180 THR n 1 181 TRP n 1 182 GLU n 1 183 CYS n 1 184 GLY n 1 185 ARG n 1 186 LEU n 1 187 SER n 1 188 TYR n 1 189 CYS n 1 190 LEU n 1 191 GLU n 1 192 ASP n 1 193 THR n 1 194 ALA n 1 195 GLY n 1 196 GLY n 1 197 PHE n 1 198 GLN n 1 199 GLN n 1 200 LEU n 1 201 LEU n 1 202 LEU n 1 203 GLU n 1 204 PRO n 1 205 MET n 1 206 LEU n 1 207 LYS n 1 208 PHE n 1 209 HIS n 1 210 TYR n 1 211 MET n 1 212 LEU n 1 213 LYS n 1 214 LYS n 1 215 LEU n 1 216 GLN n 1 217 LEU n 1 218 HIS n 1 219 GLU n 1 220 GLU n 1 221 GLU n 1 222 TYR n 1 223 VAL n 1 224 LEU n 1 225 MET n 1 226 GLN n 1 227 ALA n 1 228 ILE n 1 229 SER n 1 230 LEU n 1 231 PHE n 1 232 SER n 1 233 PRO n 1 234 ASP n 1 235 ARG n 1 236 PRO n 1 237 GLY n 1 238 VAL n 1 239 LEU n 1 240 GLN n 1 241 HIS n 1 242 ARG n 1 243 VAL n 1 244 VAL n 1 245 ASP n 1 246 GLN n 1 247 LEU n 1 248 GLN n 1 249 GLU n 1 250 GLN n 1 251 PHE n 1 252 ALA n 1 253 ILE n 1 254 THR n 1 255 LEU n 1 256 LYS n 1 257 SER n 1 258 TYR n 1 259 ILE n 1 260 GLU n 1 261 CYS n 1 262 ASN n 1 263 ARG n 1 264 PRO n 1 265 GLN n 1 266 PRO n 1 267 ALA n 1 268 HIS n 1 269 ARG n 1 270 PHE n 1 271 LEU n 1 272 PHE n 1 273 LEU n 1 274 LYS n 1 275 ILE n 1 276 MET n 1 277 ALA n 1 278 MET n 1 279 LEU n 1 280 THR n 1 281 GLU n 1 282 LEU n 1 283 ARG n 1 284 SER n 1 285 ILE n 1 286 ASN n 1 287 ALA n 1 288 GLN n 1 289 HIS n 1 290 THR n 1 291 GLN n 1 292 ARG n 1 293 LEU n 1 294 LEU n 1 295 ARG n 1 296 ILE n 1 297 GLN n 1 298 ASP n 1 299 ILE n 1 300 HIS n 1 301 PRO n 1 302 PHE n 1 303 ALA n 1 304 THR n 1 305 PRO n 1 306 LEU n 1 307 MET n 1 308 GLN n 1 309 GLU n 1 310 LEU n 1 311 PHE n 1 312 GLY n 1 313 ILE n 1 314 THR n 1 315 GLY n 1 316 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 316 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NR1I2, PXR' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'Synthetic gene' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pRSETA _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NR1I2_HUMAN _struct_ref.pdbx_db_accession O75469 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSL KVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFN TVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQF AITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS ; _struct_ref.pdbx_align_begin 130 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4XAO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75469 _struct_ref_seq.db_align_beg 130 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 434 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 130 _struct_ref_seq.pdbx_auth_seq_align_end 434 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4XAO MET A 1 ? UNP O75469 ? ? 'initiating methionine' 119 1 1 4XAO LYS A 2 ? UNP O75469 ? ? 'expression tag' 120 2 1 4XAO LYS A 3 ? UNP O75469 ? ? 'expression tag' 121 3 1 4XAO GLY A 4 ? UNP O75469 ? ? 'expression tag' 122 4 1 4XAO HIS A 5 ? UNP O75469 ? ? 'expression tag' 123 5 1 4XAO HIS A 6 ? UNP O75469 ? ? 'expression tag' 124 6 1 4XAO HIS A 7 ? UNP O75469 ? ? 'expression tag' 125 7 1 4XAO HIS A 8 ? UNP O75469 ? ? 'expression tag' 126 8 1 4XAO HIS A 9 ? UNP O75469 ? ? 'expression tag' 127 9 1 4XAO HIS A 10 ? UNP O75469 ? ? 'expression tag' 128 10 1 4XAO GLY A 11 ? UNP O75469 ? ? 'expression tag' 129 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XAO _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Imidazole, 10% Isopropanol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8726 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8726 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 35.9 _reflns.entry_id 4XAO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.58 _reflns.d_resolution_low 41.28 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12258 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.11 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.66 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.58 _reflns_shell.d_res_low 2.69 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.08 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 78.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.472 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 39.6 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ;The protein PXR has been crystallized in presence of the pesticide trans-nonachlor. The ligand seems present in the ligand binding pocket but the density is not enough defined to model it. Other data from native mass spectrometry indicate that the ligand could bind PXR. ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XAO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.58 _refine.ls_d_res_low 41.28 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12258 _refine.ls_number_reflns_R_free 981 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.64 _refine.ls_percent_reflns_R_free 8.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1931 _refine.ls_R_factor_R_free 0.2391 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1892 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1ILG _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.56 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2155 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 2234 _refine_hist.d_res_high 2.58 _refine_hist.d_res_low 41.28 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2233 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.569 ? 3025 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.387 ? 812 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.022 ? 337 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 388 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.58 2.7113 . . 133 1536 98.00 . . . 0.2905 . 0.2111 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7113 2.8811 . . 138 1586 100.00 . . . 0.2800 . 0.2117 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8811 3.1035 . . 138 1583 100.00 . . . 0.2391 . 0.2148 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1035 3.4157 . . 139 1598 100.00 . . . 0.3035 . 0.2151 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4157 3.9096 . . 140 1605 100.00 . . . 0.2371 . 0.1823 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9096 4.9244 . . 141 1629 100.00 . . . 0.1836 . 0.1599 . . . . . . . . . . # _struct.entry_id 4XAO _struct.title 'Crystal structure of the hPXR-LBD obtained in presence of the pesticide trans-nonachlor' _struct.pdbx_descriptor 'Nuclear receptor subfamily 1 group I member 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XAO _struct_keywords.text 'HORMONE RECEPTOR, PESTICIDE, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 26 ? PHE A 44 ? THR A 144 PHE A 162 1 ? 19 HELX_P HELX_P2 AA2 ARG A 75 ? CYS A 89 ? ARG A 193 CYS A 207 1 ? 15 HELX_P HELX_P3 AA3 GLY A 115 ? SER A 120 ? GLY A 233 SER A 238 5 ? 6 HELX_P HELX_P4 AA4 LEU A 121 ? ILE A 143 ? LEU A 239 ILE A 261 1 ? 23 HELX_P HELX_P5 AA5 ILE A 143 ? ASP A 148 ? ILE A 261 ASP A 266 1 ? 6 HELX_P HELX_P6 AA6 PRO A 150 ? THR A 172 ? PRO A 268 THR A 290 1 ? 23 HELX_P HELX_P7 AA7 GLN A 199 ? LEU A 202 ? GLN A 317 LEU A 320 5 ? 4 HELX_P HELX_P8 AA8 GLU A 203 ? LEU A 215 ? GLU A 321 LEU A 333 1 ? 13 HELX_P HELX_P9 AA9 HIS A 218 ? PHE A 231 ? HIS A 336 PHE A 349 1 ? 14 HELX_P HELX_P10 AB1 GLN A 240 ? ARG A 263 ? GLN A 358 ARG A 381 1 ? 24 HELX_P HELX_P11 AB2 PHE A 270 ? HIS A 300 ? PHE A 388 HIS A 418 1 ? 31 HELX_P HELX_P12 AB3 THR A 304 ? PHE A 311 ? THR A 422 PHE A 429 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 104 ? TYR A 107 ? VAL A 222 TYR A 225 AA1 2 VAL A 93 ? ARG A 98 ? VAL A 211 ARG A 216 AA1 3 LEU A 186 ? LEU A 190 ? LEU A 304 LEU A 308 AA1 4 THR A 180 ? CYS A 183 ? THR A 298 CYS A 301 AA1 5 PHE A 174 ? ASN A 175 ? PHE A 292 ASN A 293 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TRP A 105 ? O TRP A 223 N LEU A 97 ? N LEU A 215 AA1 2 3 N SER A 94 ? N SER A 212 O CYS A 189 ? O CYS A 307 AA1 3 4 O LEU A 186 ? O LEU A 304 N CYS A 183 ? N CYS A 301 AA1 4 5 O THR A 180 ? O THR A 298 N ASN A 175 ? N ASN A 293 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MPD _struct_site.pdbx_auth_seq_id 502 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue MPD A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 THR A 172 ? THR A 290 . ? 1_555 ? 2 AC1 5 GLU A 219 ? GLU A 337 . ? 1_555 ? 3 AC1 5 TYR A 222 ? TYR A 340 . ? 1_555 ? 4 AC1 5 HOH D . ? HOH A 628 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 657 . ? 1_555 ? # _atom_sites.entry_id 4XAO _atom_sites.fract_transf_matrix[1][1] 0.010834 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010834 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011587 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 119 ? ? ? A . n A 1 2 LYS 2 120 ? ? ? A . n A 1 3 LYS 3 121 ? ? ? A . n A 1 4 GLY 4 122 ? ? ? A . n A 1 5 HIS 5 123 ? ? ? A . n A 1 6 HIS 6 124 ? ? ? A . n A 1 7 HIS 7 125 ? ? ? A . n A 1 8 HIS 8 126 ? ? ? A . n A 1 9 HIS 9 127 ? ? ? A . n A 1 10 HIS 10 128 ? ? ? A . n A 1 11 GLY 11 129 ? ? ? A . n A 1 12 SER 12 130 ? ? ? A . n A 1 13 GLU 13 131 ? ? ? A . n A 1 14 ARG 14 132 ? ? ? A . n A 1 15 THR 15 133 ? ? ? A . n A 1 16 GLY 16 134 ? ? ? A . n A 1 17 THR 17 135 ? ? ? A . n A 1 18 GLN 18 136 ? ? ? A . n A 1 19 PRO 19 137 ? ? ? A . n A 1 20 LEU 20 138 ? ? ? A . n A 1 21 GLY 21 139 ? ? ? A . n A 1 22 VAL 22 140 ? ? ? A . n A 1 23 GLN 23 141 ? ? ? A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 LEU 25 143 143 LEU LEU A . n A 1 26 THR 26 144 144 THR THR A . n A 1 27 GLU 27 145 145 GLU GLU A . n A 1 28 GLU 28 146 146 GLU GLU A . n A 1 29 GLN 29 147 147 GLN GLN A . n A 1 30 ARG 30 148 148 ARG ARG A . n A 1 31 MET 31 149 149 MET MET A . n A 1 32 MET 32 150 150 MET MET A . n A 1 33 ILE 33 151 151 ILE ILE A . n A 1 34 ARG 34 152 152 ARG ARG A . n A 1 35 GLU 35 153 153 GLU GLU A . n A 1 36 LEU 36 154 154 LEU LEU A . n A 1 37 MET 37 155 155 MET MET A . n A 1 38 ASP 38 156 156 ASP ASP A . n A 1 39 ALA 39 157 157 ALA ALA A . n A 1 40 GLN 40 158 158 GLN GLN A . n A 1 41 MET 41 159 159 MET MET A . n A 1 42 LYS 42 160 160 LYS LYS A . n A 1 43 THR 43 161 161 THR THR A . n A 1 44 PHE 44 162 162 PHE PHE A . n A 1 45 ASP 45 163 163 ASP ASP A . n A 1 46 THR 46 164 164 THR THR A . n A 1 47 THR 47 165 165 THR THR A . n A 1 48 PHE 48 166 166 PHE PHE A . n A 1 49 SER 49 167 167 SER SER A . n A 1 50 HIS 50 168 168 HIS HIS A . n A 1 51 PHE 51 169 169 PHE PHE A . n A 1 52 LYS 52 170 170 LYS LYS A . n A 1 53 ASN 53 171 171 ASN ASN A . n A 1 54 PHE 54 172 172 PHE PHE A . n A 1 55 ARG 55 173 173 ARG ARG A . n A 1 56 LEU 56 174 174 LEU LEU A . n A 1 57 PRO 57 175 175 PRO PRO A . n A 1 58 GLY 58 176 176 GLY GLY A . n A 1 59 VAL 59 177 177 VAL VAL A . n A 1 60 LEU 60 178 ? ? ? A . n A 1 61 SER 61 179 ? ? ? A . n A 1 62 SER 62 180 ? ? ? A . n A 1 63 GLY 63 181 ? ? ? A . n A 1 64 CYS 64 182 ? ? ? A . n A 1 65 GLU 65 183 ? ? ? A . n A 1 66 LEU 66 184 ? ? ? A . n A 1 67 PRO 67 185 ? ? ? A . n A 1 68 GLU 68 186 ? ? ? A . n A 1 69 SER 69 187 ? ? ? A . n A 1 70 LEU 70 188 ? ? ? A . n A 1 71 GLN 71 189 ? ? ? A . n A 1 72 ALA 72 190 ? ? ? A . n A 1 73 PRO 73 191 ? ? ? A . n A 1 74 SER 74 192 192 SER SER A . n A 1 75 ARG 75 193 193 ARG ARG A . n A 1 76 GLU 76 194 194 GLU GLU A . n A 1 77 GLU 77 195 195 GLU GLU A . n A 1 78 ALA 78 196 196 ALA ALA A . n A 1 79 ALA 79 197 197 ALA ALA A . n A 1 80 LYS 80 198 198 LYS LYS A . n A 1 81 TRP 81 199 199 TRP TRP A . n A 1 82 SER 82 200 200 SER SER A . n A 1 83 GLN 83 201 201 GLN GLN A . n A 1 84 VAL 84 202 202 VAL VAL A . n A 1 85 ARG 85 203 203 ARG ARG A . n A 1 86 LYS 86 204 204 LYS LYS A . n A 1 87 ASP 87 205 205 ASP ASP A . n A 1 88 LEU 88 206 206 LEU LEU A . n A 1 89 CYS 89 207 207 CYS CYS A . n A 1 90 SER 90 208 208 SER SER A . n A 1 91 LEU 91 209 209 LEU LEU A . n A 1 92 LYS 92 210 210 LYS LYS A . n A 1 93 VAL 93 211 211 VAL VAL A . n A 1 94 SER 94 212 212 SER SER A . n A 1 95 LEU 95 213 213 LEU LEU A . n A 1 96 GLN 96 214 214 GLN GLN A . n A 1 97 LEU 97 215 215 LEU LEU A . n A 1 98 ARG 98 216 216 ARG ARG A . n A 1 99 GLY 99 217 217 GLY GLY A . n A 1 100 GLU 100 218 218 GLU GLU A . n A 1 101 ASP 101 219 219 ASP ASP A . n A 1 102 GLY 102 220 220 GLY GLY A . n A 1 103 SER 103 221 221 SER SER A . n A 1 104 VAL 104 222 222 VAL VAL A . n A 1 105 TRP 105 223 223 TRP TRP A . n A 1 106 ASN 106 224 224 ASN ASN A . n A 1 107 TYR 107 225 225 TYR TYR A . n A 1 108 LYS 108 226 226 LYS LYS A . n A 1 109 PRO 109 227 227 PRO PRO A . n A 1 110 PRO 110 228 228 PRO PRO A . n A 1 111 ALA 111 229 229 ALA ALA A . n A 1 112 ASP 112 230 230 ASP ASP A . n A 1 113 SER 113 231 231 SER SER A . n A 1 114 GLY 114 232 232 GLY GLY A . n A 1 115 GLY 115 233 233 GLY GLY A . n A 1 116 LYS 116 234 234 LYS LYS A . n A 1 117 GLU 117 235 235 GLU GLU A . n A 1 118 ILE 118 236 236 ILE ILE A . n A 1 119 PHE 119 237 237 PHE PHE A . n A 1 120 SER 120 238 238 SER SER A . n A 1 121 LEU 121 239 239 LEU LEU A . n A 1 122 LEU 122 240 240 LEU LEU A . n A 1 123 PRO 123 241 241 PRO PRO A . n A 1 124 HIS 124 242 242 HIS HIS A . n A 1 125 MET 125 243 243 MET MET A . n A 1 126 ALA 126 244 244 ALA ALA A . n A 1 127 ASP 127 245 245 ASP ASP A . n A 1 128 MET 128 246 246 MET MET A . n A 1 129 SER 129 247 247 SER SER A . n A 1 130 THR 130 248 248 THR THR A . n A 1 131 TYR 131 249 249 TYR TYR A . n A 1 132 MET 132 250 250 MET MET A . n A 1 133 PHE 133 251 251 PHE PHE A . n A 1 134 LYS 134 252 252 LYS LYS A . n A 1 135 GLY 135 253 253 GLY GLY A . n A 1 136 ILE 136 254 254 ILE ILE A . n A 1 137 ILE 137 255 255 ILE ILE A . n A 1 138 SER 138 256 256 SER SER A . n A 1 139 PHE 139 257 257 PHE PHE A . n A 1 140 ALA 140 258 258 ALA ALA A . n A 1 141 LYS 141 259 259 LYS LYS A . n A 1 142 VAL 142 260 260 VAL VAL A . n A 1 143 ILE 143 261 261 ILE ILE A . n A 1 144 SER 144 262 262 SER SER A . n A 1 145 TYR 145 263 263 TYR TYR A . n A 1 146 PHE 146 264 264 PHE PHE A . n A 1 147 ARG 147 265 265 ARG ARG A . n A 1 148 ASP 148 266 266 ASP ASP A . n A 1 149 LEU 149 267 267 LEU LEU A . n A 1 150 PRO 150 268 268 PRO PRO A . n A 1 151 ILE 151 269 269 ILE ILE A . n A 1 152 GLU 152 270 270 GLU GLU A . n A 1 153 ASP 153 271 271 ASP ASP A . n A 1 154 GLN 154 272 272 GLN GLN A . n A 1 155 ILE 155 273 273 ILE ILE A . n A 1 156 SER 156 274 274 SER SER A . n A 1 157 LEU 157 275 275 LEU LEU A . n A 1 158 LEU 158 276 276 LEU LEU A . n A 1 159 LYS 159 277 277 LYS LYS A . n A 1 160 GLY 160 278 278 GLY GLY A . n A 1 161 ALA 161 279 279 ALA ALA A . n A 1 162 ALA 162 280 280 ALA ALA A . n A 1 163 PHE 163 281 281 PHE PHE A . n A 1 164 GLU 164 282 282 GLU GLU A . n A 1 165 LEU 165 283 283 LEU LEU A . n A 1 166 CYS 166 284 284 CYS CYS A . n A 1 167 GLN 167 285 285 GLN GLN A . n A 1 168 LEU 168 286 286 LEU LEU A . n A 1 169 ARG 169 287 287 ARG ARG A . n A 1 170 PHE 170 288 288 PHE PHE A . n A 1 171 ASN 171 289 289 ASN ASN A . n A 1 172 THR 172 290 290 THR THR A . n A 1 173 VAL 173 291 291 VAL VAL A . n A 1 174 PHE 174 292 292 PHE PHE A . n A 1 175 ASN 175 293 293 ASN ASN A . n A 1 176 ALA 176 294 294 ALA ALA A . n A 1 177 GLU 177 295 295 GLU GLU A . n A 1 178 THR 178 296 296 THR THR A . n A 1 179 GLY 179 297 297 GLY GLY A . n A 1 180 THR 180 298 298 THR THR A . n A 1 181 TRP 181 299 299 TRP TRP A . n A 1 182 GLU 182 300 300 GLU GLU A . n A 1 183 CYS 183 301 301 CYS CYS A . n A 1 184 GLY 184 302 302 GLY GLY A . n A 1 185 ARG 185 303 303 ARG ARG A . n A 1 186 LEU 186 304 304 LEU LEU A . n A 1 187 SER 187 305 305 SER SER A . n A 1 188 TYR 188 306 306 TYR TYR A . n A 1 189 CYS 189 307 307 CYS CYS A . n A 1 190 LEU 190 308 308 LEU LEU A . n A 1 191 GLU 191 309 309 GLU GLU A . n A 1 192 ASP 192 310 310 ASP ASP A . n A 1 193 THR 193 311 ? ? ? A . n A 1 194 ALA 194 312 ? ? ? A . n A 1 195 GLY 195 313 ? ? ? A . n A 1 196 GLY 196 314 ? ? ? A . n A 1 197 PHE 197 315 315 PHE PHE A . n A 1 198 GLN 198 316 316 GLN GLN A . n A 1 199 GLN 199 317 317 GLN GLN A . n A 1 200 LEU 200 318 318 LEU LEU A . n A 1 201 LEU 201 319 319 LEU LEU A . n A 1 202 LEU 202 320 320 LEU LEU A . n A 1 203 GLU 203 321 321 GLU GLU A . n A 1 204 PRO 204 322 322 PRO PRO A . n A 1 205 MET 205 323 323 MET MET A . n A 1 206 LEU 206 324 324 LEU LEU A . n A 1 207 LYS 207 325 325 LYS LYS A . n A 1 208 PHE 208 326 326 PHE PHE A . n A 1 209 HIS 209 327 327 HIS HIS A . n A 1 210 TYR 210 328 328 TYR TYR A . n A 1 211 MET 211 329 329 MET MET A . n A 1 212 LEU 212 330 330 LEU LEU A . n A 1 213 LYS 213 331 331 LYS LYS A . n A 1 214 LYS 214 332 332 LYS LYS A . n A 1 215 LEU 215 333 333 LEU LEU A . n A 1 216 GLN 216 334 334 GLN GLN A . n A 1 217 LEU 217 335 335 LEU LEU A . n A 1 218 HIS 218 336 336 HIS HIS A . n A 1 219 GLU 219 337 337 GLU GLU A . n A 1 220 GLU 220 338 338 GLU GLU A . n A 1 221 GLU 221 339 339 GLU GLU A . n A 1 222 TYR 222 340 340 TYR TYR A . n A 1 223 VAL 223 341 341 VAL VAL A . n A 1 224 LEU 224 342 342 LEU LEU A . n A 1 225 MET 225 343 343 MET MET A . n A 1 226 GLN 226 344 344 GLN GLN A . n A 1 227 ALA 227 345 345 ALA ALA A . n A 1 228 ILE 228 346 346 ILE ILE A . n A 1 229 SER 229 347 347 SER SER A . n A 1 230 LEU 230 348 348 LEU LEU A . n A 1 231 PHE 231 349 349 PHE PHE A . n A 1 232 SER 232 350 350 SER SER A . n A 1 233 PRO 233 351 351 PRO PRO A . n A 1 234 ASP 234 352 352 ASP ASP A . n A 1 235 ARG 235 353 353 ARG ARG A . n A 1 236 PRO 236 354 354 PRO PRO A . n A 1 237 GLY 237 355 355 GLY GLY A . n A 1 238 VAL 238 356 356 VAL VAL A . n A 1 239 LEU 239 357 357 LEU LEU A . n A 1 240 GLN 240 358 358 GLN GLN A . n A 1 241 HIS 241 359 359 HIS HIS A . n A 1 242 ARG 242 360 360 ARG ARG A . n A 1 243 VAL 243 361 361 VAL VAL A . n A 1 244 VAL 244 362 362 VAL VAL A . n A 1 245 ASP 245 363 363 ASP ASP A . n A 1 246 GLN 246 364 364 GLN GLN A . n A 1 247 LEU 247 365 365 LEU LEU A . n A 1 248 GLN 248 366 366 GLN GLN A . n A 1 249 GLU 249 367 367 GLU GLU A . n A 1 250 GLN 250 368 368 GLN GLN A . n A 1 251 PHE 251 369 369 PHE PHE A . n A 1 252 ALA 252 370 370 ALA ALA A . n A 1 253 ILE 253 371 371 ILE ILE A . n A 1 254 THR 254 372 372 THR THR A . n A 1 255 LEU 255 373 373 LEU LEU A . n A 1 256 LYS 256 374 374 LYS LYS A . n A 1 257 SER 257 375 375 SER SER A . n A 1 258 TYR 258 376 376 TYR TYR A . n A 1 259 ILE 259 377 377 ILE ILE A . n A 1 260 GLU 260 378 378 GLU GLU A . n A 1 261 CYS 261 379 379 CYS CYS A . n A 1 262 ASN 262 380 380 ASN ASN A . n A 1 263 ARG 263 381 381 ARG ARG A . n A 1 264 PRO 264 382 382 PRO PRO A . n A 1 265 GLN 265 383 383 GLN GLN A . n A 1 266 PRO 266 384 384 PRO PRO A . n A 1 267 ALA 267 385 385 ALA ALA A . n A 1 268 HIS 268 386 386 HIS HIS A . n A 1 269 ARG 269 387 387 ARG ARG A . n A 1 270 PHE 270 388 388 PHE PHE A . n A 1 271 LEU 271 389 389 LEU LEU A . n A 1 272 PHE 272 390 390 PHE PHE A . n A 1 273 LEU 273 391 391 LEU LEU A . n A 1 274 LYS 274 392 392 LYS LYS A . n A 1 275 ILE 275 393 393 ILE ILE A . n A 1 276 MET 276 394 394 MET MET A . n A 1 277 ALA 277 395 395 ALA ALA A . n A 1 278 MET 278 396 396 MET MET A . n A 1 279 LEU 279 397 397 LEU LEU A . n A 1 280 THR 280 398 398 THR THR A . n A 1 281 GLU 281 399 399 GLU GLU A . n A 1 282 LEU 282 400 400 LEU LEU A . n A 1 283 ARG 283 401 401 ARG ARG A . n A 1 284 SER 284 402 402 SER SER A . n A 1 285 ILE 285 403 403 ILE ILE A . n A 1 286 ASN 286 404 404 ASN ASN A . n A 1 287 ALA 287 405 405 ALA ALA A . n A 1 288 GLN 288 406 406 GLN GLN A . n A 1 289 HIS 289 407 407 HIS HIS A . n A 1 290 THR 290 408 408 THR THR A . n A 1 291 GLN 291 409 409 GLN GLN A . n A 1 292 ARG 292 410 410 ARG ARG A . n A 1 293 LEU 293 411 411 LEU LEU A . n A 1 294 LEU 294 412 412 LEU LEU A . n A 1 295 ARG 295 413 413 ARG ARG A . n A 1 296 ILE 296 414 414 ILE ILE A . n A 1 297 GLN 297 415 415 GLN GLN A . n A 1 298 ASP 298 416 416 ASP ASP A . n A 1 299 ILE 299 417 417 ILE ILE A . n A 1 300 HIS 300 418 418 HIS HIS A . n A 1 301 PRO 301 419 419 PRO PRO A . n A 1 302 PHE 302 420 420 PHE PHE A . n A 1 303 ALA 303 421 421 ALA ALA A . n A 1 304 THR 304 422 422 THR THR A . n A 1 305 PRO 305 423 423 PRO PRO A . n A 1 306 LEU 306 424 424 LEU LEU A . n A 1 307 MET 307 425 425 MET MET A . n A 1 308 GLN 308 426 426 GLN GLN A . n A 1 309 GLU 309 427 427 GLU GLU A . n A 1 310 LEU 310 428 428 LEU LEU A . n A 1 311 PHE 311 429 429 PHE PHE A . n A 1 312 GLY 312 430 430 GLY GLY A . n A 1 313 ILE 313 431 431 ILE ILE A . n A 1 314 THR 314 432 432 THR THR A . n A 1 315 GLY 315 433 433 GLY GLY A . n A 1 316 SER 316 434 434 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IPA 1 501 1 IPA IPA A . C 3 MPD 1 502 1 MPD MPD A . D 4 HOH 1 601 82 HOH HOH A . D 4 HOH 2 602 74 HOH HOH A . D 4 HOH 3 603 94 HOH HOH A . D 4 HOH 4 604 6 HOH HOH A . D 4 HOH 5 605 19 HOH HOH A . D 4 HOH 6 606 4 HOH HOH A . D 4 HOH 7 607 13 HOH HOH A . D 4 HOH 8 608 28 HOH HOH A . D 4 HOH 9 609 79 HOH HOH A . D 4 HOH 10 610 81 HOH HOH A . D 4 HOH 11 611 107 HOH HOH A . D 4 HOH 12 612 2 HOH HOH A . D 4 HOH 13 613 3 HOH HOH A . D 4 HOH 14 614 5 HOH HOH A . D 4 HOH 15 615 7 HOH HOH A . D 4 HOH 16 616 8 HOH HOH A . D 4 HOH 17 617 9 HOH HOH A . D 4 HOH 18 618 10 HOH HOH A . D 4 HOH 19 619 11 HOH HOH A . D 4 HOH 20 620 12 HOH HOH A . D 4 HOH 21 621 14 HOH HOH A . D 4 HOH 22 622 16 HOH HOH A . D 4 HOH 23 623 17 HOH HOH A . D 4 HOH 24 624 18 HOH HOH A . D 4 HOH 25 625 22 HOH HOH A . D 4 HOH 26 626 25 HOH HOH A . D 4 HOH 27 627 34 HOH HOH A . D 4 HOH 28 628 35 HOH HOH A . D 4 HOH 29 629 37 HOH HOH A . D 4 HOH 30 630 44 HOH HOH A . D 4 HOH 31 631 57 HOH HOH A . D 4 HOH 32 632 71 HOH HOH A . D 4 HOH 33 633 72 HOH HOH A . D 4 HOH 34 634 73 HOH HOH A . D 4 HOH 35 635 75 HOH HOH A . D 4 HOH 36 636 76 HOH HOH A . D 4 HOH 37 637 77 HOH HOH A . D 4 HOH 38 638 78 HOH HOH A . D 4 HOH 39 639 80 HOH HOH A . D 4 HOH 40 640 83 HOH HOH A . D 4 HOH 41 641 84 HOH HOH A . D 4 HOH 42 642 85 HOH HOH A . D 4 HOH 43 643 86 HOH HOH A . D 4 HOH 44 644 87 HOH HOH A . D 4 HOH 45 645 88 HOH HOH A . D 4 HOH 46 646 89 HOH HOH A . D 4 HOH 47 647 91 HOH HOH A . D 4 HOH 48 648 92 HOH HOH A . D 4 HOH 49 649 93 HOH HOH A . D 4 HOH 50 650 95 HOH HOH A . D 4 HOH 51 651 97 HOH HOH A . D 4 HOH 52 652 99 HOH HOH A . D 4 HOH 53 653 100 HOH HOH A . D 4 HOH 54 654 101 HOH HOH A . D 4 HOH 55 655 102 HOH HOH A . D 4 HOH 56 656 106 HOH HOH A . D 4 HOH 57 657 108 HOH HOH A . D 4 HOH 58 658 109 HOH HOH A . D 4 HOH 59 659 111 HOH HOH A . D 4 HOH 60 660 112 HOH HOH A . D 4 HOH 61 661 113 HOH HOH A . D 4 HOH 62 662 114 HOH HOH A . D 4 HOH 63 663 117 HOH HOH A . D 4 HOH 64 664 118 HOH HOH A . D 4 HOH 65 665 122 HOH HOH A . D 4 HOH 66 666 123 HOH HOH A . D 4 HOH 67 667 124 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2390 ? 1 MORE -19 ? 1 'SSA (A^2)' 26870 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_664 -y+1,-x+1,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 92.3000000000 -1.0000000000 0.0000000000 0.0000000000 92.3000000000 0.0000000000 0.0000000000 -1.0000000000 -43.1500000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-09 2 'Structure model' 1 1 2015-09-16 3 'Structure model' 1 2 2018-07-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Structure summary' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category audit_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_audit_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.8.4_1496)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.8.4_1496)' 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 301 ? ? -112.38 68.78 2 1 PHE A 349 ? ? -94.63 40.57 3 1 LEU A 357 ? ? -108.62 -61.13 4 1 PHE A 420 ? ? -155.79 -19.30 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 653 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.91 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 146 ? CD ? A GLU 28 CD 2 1 Y 1 A GLU 146 ? OE1 ? A GLU 28 OE1 3 1 Y 1 A GLU 146 ? OE2 ? A GLU 28 OE2 4 1 Y 1 A ARG 152 ? CD ? A ARG 34 CD 5 1 Y 1 A ARG 152 ? NE ? A ARG 34 NE 6 1 Y 1 A ARG 152 ? CZ ? A ARG 34 CZ 7 1 Y 1 A ARG 152 ? NH1 ? A ARG 34 NH1 8 1 Y 1 A ARG 152 ? NH2 ? A ARG 34 NH2 9 1 Y 1 A LYS 170 ? CD ? A LYS 52 CD 10 1 Y 1 A LYS 170 ? CE ? A LYS 52 CE 11 1 Y 1 A LYS 170 ? NZ ? A LYS 52 NZ 12 1 Y 1 A VAL 177 ? CG1 ? A VAL 59 CG1 13 1 Y 1 A VAL 177 ? CG2 ? A VAL 59 CG2 14 1 Y 1 A SER 192 ? OG ? A SER 74 OG 15 1 Y 1 A ARG 193 ? CG ? A ARG 75 CG 16 1 Y 1 A ARG 193 ? CD ? A ARG 75 CD 17 1 Y 1 A ARG 193 ? NE ? A ARG 75 NE 18 1 Y 1 A ARG 193 ? CZ ? A ARG 75 CZ 19 1 Y 1 A ARG 193 ? NH1 ? A ARG 75 NH1 20 1 Y 1 A ARG 193 ? NH2 ? A ARG 75 NH2 21 1 Y 1 A GLU 194 ? CG ? A GLU 76 CG 22 1 Y 1 A GLU 194 ? CD ? A GLU 76 CD 23 1 Y 1 A GLU 194 ? OE1 ? A GLU 76 OE1 24 1 Y 1 A GLU 194 ? OE2 ? A GLU 76 OE2 25 1 Y 1 A GLU 195 ? CD ? A GLU 77 CD 26 1 Y 1 A GLU 195 ? OE1 ? A GLU 77 OE1 27 1 Y 1 A GLU 195 ? OE2 ? A GLU 77 OE2 28 1 Y 1 A LYS 204 ? CG ? A LYS 86 CG 29 1 Y 1 A LYS 204 ? CD ? A LYS 86 CD 30 1 Y 1 A LYS 204 ? CE ? A LYS 86 CE 31 1 Y 1 A LYS 204 ? NZ ? A LYS 86 NZ 32 1 Y 1 A SER 208 ? OG ? A SER 90 OG 33 1 Y 1 A LEU 209 ? CG ? A LEU 91 CG 34 1 Y 1 A LEU 209 ? CD1 ? A LEU 91 CD1 35 1 Y 1 A LEU 209 ? CD2 ? A LEU 91 CD2 36 1 Y 1 A LYS 210 ? CG ? A LYS 92 CG 37 1 Y 1 A LYS 210 ? CD ? A LYS 92 CD 38 1 Y 1 A LYS 210 ? CE ? A LYS 92 CE 39 1 Y 1 A LYS 210 ? NZ ? A LYS 92 NZ 40 1 Y 1 A GLU 218 ? CG ? A GLU 100 CG 41 1 Y 1 A GLU 218 ? CD ? A GLU 100 CD 42 1 Y 1 A GLU 218 ? OE1 ? A GLU 100 OE1 43 1 Y 1 A GLU 218 ? OE2 ? A GLU 100 OE2 44 1 Y 1 A LYS 226 ? CD ? A LYS 108 CD 45 1 Y 1 A LYS 226 ? CE ? A LYS 108 CE 46 1 Y 1 A LYS 226 ? NZ ? A LYS 108 NZ 47 1 Y 1 A SER 231 ? OG ? A SER 113 OG 48 1 Y 1 A LYS 234 ? CG ? A LYS 116 CG 49 1 Y 1 A LYS 234 ? CD ? A LYS 116 CD 50 1 Y 1 A LYS 234 ? CE ? A LYS 116 CE 51 1 Y 1 A LYS 234 ? NZ ? A LYS 116 NZ 52 1 Y 1 A LYS 259 ? CE ? A LYS 141 CE 53 1 Y 1 A LYS 259 ? NZ ? A LYS 141 NZ 54 1 Y 1 A ARG 303 ? CG ? A ARG 185 CG 55 1 Y 1 A ARG 303 ? CD ? A ARG 185 CD 56 1 Y 1 A ARG 303 ? NE ? A ARG 185 NE 57 1 Y 1 A ARG 303 ? CZ ? A ARG 185 CZ 58 1 Y 1 A ARG 303 ? NH1 ? A ARG 185 NH1 59 1 Y 1 A ARG 303 ? NH2 ? A ARG 185 NH2 60 1 Y 1 A PHE 315 ? CG ? A PHE 197 CG 61 1 Y 1 A PHE 315 ? CD1 ? A PHE 197 CD1 62 1 Y 1 A PHE 315 ? CD2 ? A PHE 197 CD2 63 1 Y 1 A PHE 315 ? CE1 ? A PHE 197 CE1 64 1 Y 1 A PHE 315 ? CE2 ? A PHE 197 CE2 65 1 Y 1 A PHE 315 ? CZ ? A PHE 197 CZ 66 1 Y 1 A GLN 316 ? CG ? A GLN 198 CG 67 1 Y 1 A GLN 316 ? CD ? A GLN 198 CD 68 1 Y 1 A GLN 316 ? OE1 ? A GLN 198 OE1 69 1 Y 1 A GLN 316 ? NE2 ? A GLN 198 NE2 70 1 Y 1 A GLN 317 ? CG ? A GLN 199 CG 71 1 Y 1 A GLN 317 ? CD ? A GLN 199 CD 72 1 Y 1 A GLN 317 ? OE1 ? A GLN 199 OE1 73 1 Y 1 A GLN 317 ? NE2 ? A GLN 199 NE2 74 1 Y 1 A LEU 318 ? CG ? A LEU 200 CG 75 1 Y 1 A LEU 318 ? CD1 ? A LEU 200 CD1 76 1 Y 1 A LEU 318 ? CD2 ? A LEU 200 CD2 77 1 Y 1 A LYS 325 ? CD ? A LYS 207 CD 78 1 Y 1 A LYS 325 ? CE ? A LYS 207 CE 79 1 Y 1 A LYS 325 ? NZ ? A LYS 207 NZ 80 1 Y 1 A LYS 332 ? CD ? A LYS 214 CD 81 1 Y 1 A LYS 332 ? CE ? A LYS 214 CE 82 1 Y 1 A LYS 332 ? NZ ? A LYS 214 NZ 83 1 Y 1 A ARG 360 ? CG ? A ARG 242 CG 84 1 Y 1 A ARG 360 ? CD ? A ARG 242 CD 85 1 Y 1 A ARG 360 ? NE ? A ARG 242 NE 86 1 Y 1 A ARG 360 ? CZ ? A ARG 242 CZ 87 1 Y 1 A ARG 360 ? NH1 ? A ARG 242 NH1 88 1 Y 1 A ARG 360 ? NH2 ? A ARG 242 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 119 ? A MET 1 2 1 Y 1 A LYS 120 ? A LYS 2 3 1 Y 1 A LYS 121 ? A LYS 3 4 1 Y 1 A GLY 122 ? A GLY 4 5 1 Y 1 A HIS 123 ? A HIS 5 6 1 Y 1 A HIS 124 ? A HIS 6 7 1 Y 1 A HIS 125 ? A HIS 7 8 1 Y 1 A HIS 126 ? A HIS 8 9 1 Y 1 A HIS 127 ? A HIS 9 10 1 Y 1 A HIS 128 ? A HIS 10 11 1 Y 1 A GLY 129 ? A GLY 11 12 1 Y 1 A SER 130 ? A SER 12 13 1 Y 1 A GLU 131 ? A GLU 13 14 1 Y 1 A ARG 132 ? A ARG 14 15 1 Y 1 A THR 133 ? A THR 15 16 1 Y 1 A GLY 134 ? A GLY 16 17 1 Y 1 A THR 135 ? A THR 17 18 1 Y 1 A GLN 136 ? A GLN 18 19 1 Y 1 A PRO 137 ? A PRO 19 20 1 Y 1 A LEU 138 ? A LEU 20 21 1 Y 1 A GLY 139 ? A GLY 21 22 1 Y 1 A VAL 140 ? A VAL 22 23 1 Y 1 A GLN 141 ? A GLN 23 24 1 Y 1 A LEU 178 ? A LEU 60 25 1 Y 1 A SER 179 ? A SER 61 26 1 Y 1 A SER 180 ? A SER 62 27 1 Y 1 A GLY 181 ? A GLY 63 28 1 Y 1 A CYS 182 ? A CYS 64 29 1 Y 1 A GLU 183 ? A GLU 65 30 1 Y 1 A LEU 184 ? A LEU 66 31 1 Y 1 A PRO 185 ? A PRO 67 32 1 Y 1 A GLU 186 ? A GLU 68 33 1 Y 1 A SER 187 ? A SER 69 34 1 Y 1 A LEU 188 ? A LEU 70 35 1 Y 1 A GLN 189 ? A GLN 71 36 1 Y 1 A ALA 190 ? A ALA 72 37 1 Y 1 A PRO 191 ? A PRO 73 38 1 Y 1 A THR 311 ? A THR 193 39 1 Y 1 A ALA 312 ? A ALA 194 40 1 Y 1 A GLY 313 ? A GLY 195 41 1 Y 1 A GLY 314 ? A GLY 196 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'ANR CESA' France ? 1 'Plan Cancer Inserm' France ? 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ISOPROPYL ALCOHOL' IPA 3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 4 water HOH #